[UP]
[1][TOP] >UniRef100_Q01AC1 Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01AC1_OSTTA Length = 872 Score = 72.8 bits (177), Expect = 1e-11 Identities = 47/114 (41%), Positives = 50/114 (43%) Frame = +3 Query: 27 PCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PT 206 PCS A + C LL + S LP P SSPPP PS S SP P Sbjct: 462 PCSNANSDGTFPKVCYNGACTLLS--SVPSSELPTAP-PVSSPPPSPSPPPSPPPSPPP- 517 Query: 207 RAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 PS PP PPP+PPP SP PPP PP PPPP SPPP Sbjct: 518 ----------------PSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPP 555 Score = 66.2 bits (160), Expect = 1e-09 Identities = 39/81 (48%), Positives = 41/81 (50%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP PS S P P A R P SP P PPPP+PPP SP PPP Sbjct: 533 PPSPPPPSPSPPPSPPPPPSPPPGSAA-----RPP--SPPPPSPPPPSPPPPSP---PPP 582 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 583 PSPPPSPPPPPSPPPPSPPPP 603 [2][TOP] >UniRef100_C7IYE4 Os02g0557000 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=C7IYE4_ORYSJ Length = 188 Score = 69.3 bits (168), Expect = 1e-10 Identities = 44/123 (35%), Positives = 51/123 (41%), Gaps = 12/123 (9%) Frame = +3 Query: 153 PPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPS---WPPPPPPAPPPQSPLL-LPPP 320 PPP P +S +P P A+ WPCWS S PPPP P PP P PP Sbjct: 5 PPPPPPRWSRSPTTPNPPPPPPPPATASTWPCWSASPSALPPPPRPRTPPSRPSSPASPP 64 Query: 321 RQKPPSHPPPPHSPPPTRH--------RPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPS P PP +PPPT RP T + R P PP+ P P Sbjct: 65 PSSPPSPPSPPAAPPPTTRSPRSPPPPRPSTTSTASSPRP---PTPSHPTSSAPPSPPPP 121 Query: 477 LSS 485 S+ Sbjct: 122 TSA 124 [3][TOP] >UniRef100_C0SFQ9 Putative uncharacterized protein n=1 Tax=Paracoccidioides brasiliensis Pb03 RepID=C0SFQ9_PARBP Length = 675 Score = 68.2 bits (165), Expect = 3e-10 Identities = 50/136 (36%), Positives = 58/136 (42%), Gaps = 4/136 (2%) Frame = +3 Query: 87 PLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWP 266 P L + G+S P+ P SPPP P H S A+ P P A A +R+ P S P Sbjct: 433 PTLPHKVPHGTSGPV-SAPPPSPPPRP-HVSPSAI-PQPPPASAPPPARQPPPPVSAPAP 489 Query: 267 PPPPPAPPPQSPLLLPPPRQKPPSHPP----PPHSPPPTRHRPCGTCRRRT*RQRCRPLR 434 PPPPP PP +P PP PP PP PP PPP+ P P Sbjct: 490 PPPPPPPPGPAPSTAVPPPPPPPPPPPSGSAPPPPPPPSGSAPPPPPHPAPSASHSPPPP 549 Query: 435 RSARGGGPPAGPEPLS 482 SA PP P P S Sbjct: 550 LSAPSSSPPPPPPPAS 565 [4][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 67.8 bits (164), Expect = 4e-10 Identities = 42/98 (42%), Positives = 46/98 (46%), Gaps = 16/98 (16%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHF----SSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPP 290 LPL T SPPP P S SP P+R + + P SPS PPPPPP PP Sbjct: 437 LPLPSTSTPSPPPSPPSSTPSPSPSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPP 496 Query: 291 PQSPLLLPPPRQKP------------PSHPPPPHSPPP 368 P+ P PPP Q P PS PPPP PPP Sbjct: 497 PRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPP 534 [5][TOP] >UniRef100_C1GKW7 Predicted protein n=1 Tax=Paracoccidioides brasiliensis Pb18 RepID=C1GKW7_PARBD Length = 663 Score = 67.4 bits (163), Expect = 5e-10 Identities = 51/139 (36%), Positives = 60/139 (43%), Gaps = 7/139 (5%) Frame = +3 Query: 87 PLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWP 266 P L + G+S P+ P SPPP P H S A+ P P A A +R+ P S P Sbjct: 433 PTLPHKVPHGTSGPV-SAPPPSPPPRP-HASPSAI-PQPPPASAPPPARQPPPPVSAPAP 489 Query: 267 PPPPPAPPPQSP-LLLPPPRQKPP------SHPPPPHSPPPTRHRPCGTCRRRT*RQRCR 425 PPPPP PP +P +PPP PP + PPPPH P H P Sbjct: 490 PPPPPPPPGPAPSTAVPPPPPPPPPPPSGSAPPPPPHPAPSASHSP-------------- 535 Query: 426 PLRRSARGGGPPAGPEPLS 482 P SA PP P P S Sbjct: 536 PPPLSAPSSSPPPPPPPAS 554 [6][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 62.8 bits (151), Expect(2) = 7e-10 Identities = 33/73 (45%), Positives = 33/73 (45%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLR 434 P PPPPPP PPP P PPP PP PPPP PPP P T P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPPVTTA----------PGS 379 Query: 435 RSARGGGPPAGPE 473 S GG P AG E Sbjct: 380 NSVEGGRPHAGVE 392 Score = 24.3 bits (51), Expect(2) = 7e-10 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 321 PPPPPPPPPPPPPPPP 336 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 PPPPPP PPP P PPP PP PPPP PPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 PPPPPP PPP P PPP PP PPPP PPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 [7][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 62.8 bits (151), Expect(2) = 7e-10 Identities = 33/74 (44%), Positives = 33/74 (44%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLR 434 P PPPPPP PPP P PPP PP PPPP PPP R R R LR Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPLSALFARPVPRDLR 119 Query: 435 RSARGGGPPAGPEP 476 GG PEP Sbjct: 120 EMVWSGGDSPAPEP 133 Score = 24.3 bits (51), Expect(2) = 7e-10 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 4 PPPPPPPPPPPPPPPP 19 Score = 56.6 bits (135), Expect(2) = 5e-08 Identities = 36/95 (37%), Positives = 38/95 (40%), Gaps = 15/95 (15%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCG----------TCRRR 404 P PPPPPP PPP P PPP PP PPPP PPP P R Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRP 105 Query: 405 T*RQRCRPLRRSAR-----GGGPPAGPEPLSSTRG 494 RP+ R R GG PA P + RG Sbjct: 106 LSALFARPVPRDLREMVWSGGDSPAPEPPFYAPRG 140 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 2 PPPPPPPPPPPPPPPP 17 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 3 PPPPPPPPPPPPPPPP 18 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 5 PPPPPPPPPPPPPPPP 20 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 6 PPPPPPPPPPPPPPPP 21 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 7 PPPPPPPPPPPPPPPP 22 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 8 PPPPPPPPPPPPPPPP 23 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 9 PPPPPPPPPPPPPPPP 24 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 10 PPPPPPPPPPPPPPPP 25 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 11 PPPPPPPPPPPPPPPP 26 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 12 PPPPPPPPPPPPPPPP 27 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 13 PPPPPPPPPPPPPPPP 28 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 14 PPPPPPPPPPPPPPPP 29 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 15 PPPPPPPPPPPPPPPP 30 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 16 PPPPPPPPPPPPPPPP 31 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 17 PPPPPPPPPPPPPPPP 32 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 18 PPPPPPPPPPPPPPPP 33 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 19 PPPPPPPPPPPPPPPP 34 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 20 PPPPPPPPPPPPPPPP 35 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 21 PPPPPPPPPPPPPPPP 36 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 22 PPPPPPPPPPPPPPPP 37 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 23 PPPPPPPPPPPPPPPP 38 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 24 PPPPPPPPPPPPPPPP 39 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 25 PPPPPPPPPPPPPPPP 40 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 26 PPPPPPPPPPPPPPPP 41 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 27 PPPPPPPPPPPPPPPP 42 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 28 PPPPPPPPPPPPPPPP 43 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 29 PPPPPPPPPPPPPPPP 44 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 30 PPPPPPPPPPPPPPPP 45 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 31 PPPPPPPPPPPPPPPP 46 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 32 PPPPPPPPPPPPPPPP 47 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 33 PPPPPPPPPPPPPPPP 48 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 34 PPPPPPPPPPPPPPPP 49 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 35 PPPPPPPPPPPPPPPP 50 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 36 PPPPPPPPPPPPPPPP 51 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 37 PPPPPPPPPPPPPPPP 52 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 38 PPPPPPPPPPPPPPPP 53 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 [8][TOP] >UniRef100_A7XQ02 Latex protein n=1 Tax=Morus alba RepID=A7XQ02_MORAL Length = 415 Score = 66.6 bits (161), Expect = 9e-10 Identities = 40/96 (41%), Positives = 42/96 (43%), Gaps = 10/96 (10%) Frame = +3 Query: 246 CWS---PSWPPPPPPAPPPQS------PLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCR 398 CWS P PPPPPP+PPP S P PPP PP PPPP PPP+ P G Sbjct: 64 CWSSPPPPSPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPGGP-- 121 Query: 399 RRT*RQRCRPLRRSARG-GGPPAGPEPLSSTRGCCG 503 RP R R G PP P S CG Sbjct: 122 -------ERPDHRCGRALGNPPCNPGRCCSIHNWCG 150 [9][TOP] >UniRef100_A4RWC6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RWC6_OSTLU Length = 4003 Score = 66.6 bits (161), Expect = 9e-10 Identities = 29/49 (59%), Positives = 31/49 (63%) Frame = +3 Query: 237 RWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 RW +PS PP PPP+PPP SP PPP PPS PPPP SPPP P Sbjct: 1539 RWTVPTPSPPPSPPPSPPPPSPPPSPPPPPPPPSPPPPPPSPPPPPPSP 1587 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/78 (42%), Positives = 34/78 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 PT SPPP P SP P P PS PPPPPP PP P PPP Sbjct: 1543 PTPSPPPSPPP------SPPP-------------PSPPPSPPPPPPPPSPPPPPPSPPPP 1583 Query: 321 RQKPPSHPPPPHSPPPTR 374 PP PP P PPP + Sbjct: 1584 PPSPPPSPPSPPPPPPAK 1601 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/48 (58%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +3 Query: 243 PCWSPSWPPP-PPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PS PPP PPP+PPP P PPP PPS PPPP SPPP+ P Sbjct: 1549 PSPPPSPPPPSPPPSPPPPPPPPSPPP--PPPSPPPPPPSPPPSPPSP 1594 [10][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 66.2 bits (160), Expect = 1e-09 Identities = 35/81 (43%), Positives = 37/81 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P P PPPPPP+PPP P PPP Sbjct: 285 PPSPPPPSPPPPSPPPPSPPP-------------PSPPPPSPPPPPPSPPPSPPPPSPPP 331 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 332 PSPPPPSPPPPSPPPPSPPPP 352 Score = 66.2 bits (160), Expect = 1e-09 Identities = 38/81 (46%), Positives = 40/81 (49%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 316 PPPSPPPSPPPPSPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPSP---PPP 362 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP SPPP+ P Sbjct: 363 SPPPPSPPPPPPSPPPSPPPP 383 Score = 66.2 bits (160), Expect = 1e-09 Identities = 35/81 (43%), Positives = 37/81 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P P PPPPPP+PPP P PPP Sbjct: 341 PPSPPPPSPPPPSPPPPSPPP-------------PSPPPPSPPPPPPSPPPSPPPPSPPP 387 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 388 PSPPPPSPPPPSPPPPSPPPP 408 Score = 65.5 bits (158), Expect = 2e-09 Identities = 36/81 (44%), Positives = 38/81 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 206 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 265 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 266 PSPPPPSPPPPSPPPPSPPPP 286 Score = 65.1 bits (157), Expect = 3e-09 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P SP P PPPP+PPP SP PPP Sbjct: 265 PPSPPPPSPPPPSPPPPSPPPP---------------SPPPPSPPPPSPPPPSP---PPP 306 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP SPPP+ P Sbjct: 307 SPPPPSPPPPPPSPPPSPPPP 327 Score = 63.9 bits (154), Expect = 6e-09 Identities = 35/81 (43%), Positives = 37/81 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP P PPP Sbjct: 211 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPP 270 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 271 PSPPPPSPPPPSPPPPSPPPP 291 Score = 63.5 bits (153), Expect = 7e-09 Identities = 35/81 (43%), Positives = 36/81 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP PPP P PPP Sbjct: 216 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPP 275 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 276 PSPPPPSPPPPSPPPPSPPPP 296 Score = 63.5 bits (153), Expect = 7e-09 Identities = 35/81 (43%), Positives = 36/81 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP PPPPP PPP P PPP Sbjct: 221 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPP 280 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 281 PSPPPPSPPPPSPPPPSPPPP 301 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/81 (43%), Positives = 36/81 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP PPPPP PPP P PPP Sbjct: 126 PPSPPPPSPPPPSPPPPSPPPPSPP---------PPPSPPPPPPPPSPPPPSPPPPSPPP 176 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 177 PSPPPPSPPPPSPPPPSPPPP 197 Score = 62.8 bits (151), Expect = 1e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 392 PPSPPPPSPPPPSPPPPSPPPPSPP---------PPPSPPPPSPPPPSPPPPSPPSPPPP 442 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 443 SPPPPS-PPPPSPPPPSPPPP 462 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/81 (44%), Positives = 40/81 (49%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S P P + + P SP P PPPP+PPP SP PPP Sbjct: 356 PPSPPPPSPPPPSPPPPPPSPPPSPPPPSP----PPPSPPPPSPPPPSPPPPSP---PPP 408 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 409 SPPPPSPPPPPSPPPPSPPPP 429 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/81 (43%), Positives = 37/81 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S SP P SP P PPPP+PPP SP PPP Sbjct: 372 PPPSPPPSPPPPSPPPPSPPPP---------------SPPPPSPPPPSPPPPSP---PPP 413 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 414 SPPPPPSPPPPSPPPPSPPPP 434 Score = 61.6 bits (148), Expect = 3e-08 Identities = 37/81 (45%), Positives = 40/81 (49%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P + P SP P PPPP+PPP SP PPP Sbjct: 131 PPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSP---PPP 187 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 188 SPPPPS-PPPPSPPPPSPPPP 207 Score = 61.2 bits (147), Expect = 4e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 161 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP---PPP 217 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 218 SPPPPS-PPPPSPPPPSPPPP 237 Score = 61.2 bits (147), Expect = 4e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 166 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP---PPP 222 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 223 SPPPPS-PPPPSPPPPSPPPP 242 Score = 61.2 bits (147), Expect = 4e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 171 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP---PPP 227 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 228 SPPPPS-PPPPSPPPPSPPPP 247 Score = 61.2 bits (147), Expect = 4e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 436 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP---PPP 492 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 493 SPPPPS-PPPPSPPPPSPPPP 512 Score = 61.2 bits (147), Expect = 4e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 441 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP---PPP 497 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 498 SPPPPS-PPPPSPPPPSPPPP 517 Score = 60.8 bits (146), Expect = 5e-08 Identities = 36/77 (46%), Positives = 38/77 (49%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 446 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP---PPP 502 Query: 321 RQKPPSHPPPPHSPPPT 371 PPS PPPP PPP+ Sbjct: 503 SPPPPS-PPPPSPPPPS 518 Score = 60.5 bits (145), Expect = 6e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 151 PPPSPPPPPPPPSPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPSP---PPP 197 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 198 SPPPPS-PPPPSPPPPSPPPP 217 Score = 60.5 bits (145), Expect = 6e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 241 PPSPPPPSPPPPSPPPPSPPPPP-----------PPPSPPPPSPPPPSPPPPSP---PPP 286 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 287 SPPPPS-PPPPSPPPPSPPPP 306 Score = 60.1 bits (144), Expect = 8e-08 Identities = 36/81 (44%), Positives = 38/81 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP PS P P P SP P PPPP+PPP SP PPP Sbjct: 411 PPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSP---PPP 467 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 468 SPPPPS-PPPPSPPPPSPPPP 487 Score = 59.3 bits (142), Expect = 1e-07 Identities = 37/81 (45%), Positives = 41/81 (50%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P + + P PS P PPPP+PPP SP PPP Sbjct: 397 PPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPP-PPSPPSPPPPSPPPPSP---PPP 452 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 453 SPPPPS-PPPPSPPPPSPPPP 472 Score = 58.9 bits (141), Expect = 2e-07 Identities = 38/81 (46%), Positives = 40/81 (49%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP PS S SP P P SP P PPPP+PPP SP PPP Sbjct: 427 PPPSPPP-PSPPSPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPSP---PPP 472 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 473 SPPPPS-PPPPSPPPPSPPPP 492 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/77 (45%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PP Sbjct: 461 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 520 Query: 321 RQKPPSHPP--PPHSPP 365 PPSHPP PP PP Sbjct: 521 PSPPPSHPPSHPPMHPP 537 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/77 (46%), Positives = 37/77 (48%), Gaps = 2/77 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 466 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 525 Query: 321 RQKPPSHPP--PPHSPP 365 PPSHPP PP PP Sbjct: 526 -SHPPSHPPMHPPMHPP 541 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +3 Query: 243 PCWSPSWPPP--PPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PS PPP PPP+PPP SP PPP PPS PPPP PPP Sbjct: 118 PSPPPSQPPPSPPPPSPPPPSP---PPPSPPPPSPPPPPSPPPP 158 Score = 55.1 bits (131), Expect = 3e-06 Identities = 35/85 (41%), Positives = 36/85 (42%), Gaps = 4/85 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP-P---APPPQSPLL 308 P S PPP P S SP P PS PPPPP P PPP P Sbjct: 290 PPSPPPPSPPPPSPPPPSPPP-----------------PSPPPPPPSPPPSPPPPSPPPP 332 Query: 309 LPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP PP PPPP PPP+ P Sbjct: 333 SPPPPSPPPPSPPPPSPPPPSPPPP 357 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = +3 Query: 246 CWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 C+ P P PPP+PPP P PPP PP PPPP PPP+ P Sbjct: 109 CYIP--PTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPP 152 Score = 53.9 bits (128), Expect = 6e-06 Identities = 37/86 (43%), Positives = 37/86 (43%), Gaps = 5/86 (5%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP-APPPQSPLLLPP 317 P S PPP P S SP P P SP P PPPP PPP P PP Sbjct: 456 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 515 Query: 318 PRQKPPSHPP--PPHSPP--PTRHRP 383 P PPS PP PP PP P H P Sbjct: 516 PPSPPPSPPPSHPPSHPPMHPPMHPP 541 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/49 (53%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +3 Query: 243 PCWSPSWPPP--PPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P P PPP PPP+PPP SP PPP PPS PPP PPP+ P Sbjct: 113 PTTPPPSPPPSQPPPSPPPPSP---PPPSPPPPSPPPPSPPPPPSPPPP 158 Score = 53.5 bits (127), Expect = 8e-06 Identities = 34/79 (43%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP P PP Sbjct: 471 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSHPP- 529 Query: 321 RQKPPSHPP--PPHSPPPT 371 PP HPP PP PP T Sbjct: 530 -SHPPMHPPMHPPFLPPTT 547 [11][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 66.2 bits (160), Expect = 1e-09 Identities = 37/81 (45%), Positives = 37/81 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P PS PPPPPP PPP SP PP Sbjct: 289 PPSPPPPSPPPPSPPPPSPPP-----------------PSPPPPPPPRPPPPSPPPPSPP 331 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP RP Sbjct: 332 PPPPPSPPPPPSPPPPPPPRP 352 Score = 62.4 bits (150), Expect = 2e-08 Identities = 38/83 (45%), Positives = 38/83 (45%), Gaps = 2/83 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP--PPAPPPQSPLLLP 314 P S PPP P S SP P S P SP PPPP PP PPP P P Sbjct: 242 PPSPPPPSPPPPSPPPPSPPPPPP----PSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSP 297 Query: 315 PPRQKPPSHPPPPHSPPPTRHRP 383 PP PP PPPP PPP RP Sbjct: 298 PPPSPPPPSPPPPSPPPPPPPRP 320 Score = 61.2 bits (147), Expect = 4e-08 Identities = 34/81 (41%), Positives = 35/81 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P S SP P P SP PP PPP PPP+ P PPP Sbjct: 312 PPPPPPPRPPPPSPPPPSPPPP------------PPPSPPPPPSPPPPPPPRPPPPSPPP 359 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP P Sbjct: 360 PSPPPPSPPPPSPPPPPPPSP 380 Score = 61.2 bits (147), Expect = 4e-08 Identities = 33/85 (38%), Positives = 35/85 (41%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS P P P P PPPPPP PP P PPP Sbjct: 370 PSPPPPPPPSPPPPPPPRPPPPSPPP--------PSPPPPSPPPPPPPSPPPPPPPRPPP 421 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTC 395 PP PPPP PPP+ C C Sbjct: 422 PSPPPPSPPPPSPPPPSPPARCRVC 446 Score = 60.8 bits (146), Expect = 5e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 192 PPSPPPPSPPPPSPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPSP---PPP 238 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 239 SPPPPS-PPPPSPPPPSPPPP 258 Score = 60.8 bits (146), Expect = 5e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 197 PPSPPPPSPPPPSPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPSP---PPP 243 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 244 SPPPPS-PPPPSPPPPSPPPP 263 Score = 60.5 bits (145), Expect = 6e-08 Identities = 37/83 (44%), Positives = 38/83 (45%), Gaps = 2/83 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PP Sbjct: 202 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 261 Query: 321 RQKPPS--HPPPPHSPPPTRHRP 383 PPS PPPP PPP RP Sbjct: 262 PPPPPSPPPPPPPSPPPPPPPRP 284 Score = 60.1 bits (144), Expect = 8e-08 Identities = 42/122 (34%), Positives = 42/122 (34%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P S SP P P P PPPPPP PP P PPP Sbjct: 344 PPPPPPPRPPPPSPPPPSPPP-------------PSPPPPSPPPPPPPSPPPPPPPRPPP 390 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSSTRGCC 500 PP PPPP PPP P R P PP P P S C Sbjct: 391 PSPPPPSPPPPSPPPPPPPSPPPPPPPRP------PPPSPPPPSPPPPSPPPPSPPARCR 444 Query: 501 GC 506 C Sbjct: 445 VC 446 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/79 (44%), Positives = 37/79 (46%) Frame = +3 Query: 147 SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQ 326 S PPP P S SP P SP P PPPP+PPP SP PPP Sbjct: 189 SPPPPSPPPPSPPPPSPPPP---------------SPPPPSPPPPSPPPPSP---PPPSP 230 Query: 327 KPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 231 PPPS-PPPPSPPPPSPPPP 248 Score = 55.1 bits (131), Expect = 3e-06 Identities = 35/88 (39%), Positives = 36/88 (40%), Gaps = 2/88 (2%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P R P S PPP P + P P SP PPPP P PP P Sbjct: 317 PPRPPPPSPPPPSPPPPPPPSPPPPP----------------SPPPPPPPRPPPPSPPPP 360 Query: 306 LLPPPRQKPPS--HPPPPHSPPPTRHRP 383 PPP PPS PPPP PPP RP Sbjct: 361 SPPPPSPPPPSPPPPPPPSPPPPPPPRP 388 [12][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 66.2 bits (160), Expect = 1e-09 Identities = 42/123 (34%), Positives = 47/123 (38%) Frame = +3 Query: 138 CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP 317 CPT P F + +P P AS P P PPPPPP PPP SP PP Sbjct: 192 CPTGVTGPGGPTFPTPVSAPPPPFRDRPVASPSPPP---PPPPPPPPPPPPPPSPPPPPP 248 Query: 318 PRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSSTRGC 497 P PP PPPP PPP+ + P PP GP P + Sbjct: 249 PPPPPPPPPPPPSPPPPSPNPP------------------------PPKGPSPTPNNFPY 284 Query: 498 CGC 506 C C Sbjct: 285 CNC 287 [13][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 65.9 bits (159), Expect = 1e-09 Identities = 35/81 (43%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP PS +P P+ P PS PP PPP+PPP + PPP Sbjct: 1128 PPPSPPPPPSPPPPTPDAPPPSP-----------PPPPPSPPPSPPPSPPPPPSPMPPPP 1176 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP SPPP H P Sbjct: 1177 PSPPPPRPPPPPSPPPPVHEP 1197 Score = 64.7 bits (156), Expect = 3e-09 Identities = 38/95 (40%), Positives = 44/95 (46%), Gaps = 4/95 (4%) Frame = +3 Query: 111 GGSSLPLRGCPTSS---PPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP 281 GG L GC T+ PP + + P P + P PS PPPPPP Sbjct: 1049 GGDELTREGCLTNERFPAPPAAAMDNRPCEKPPPPSPPS--------PPSPPSPPPPPPP 1100 Query: 282 APPPQSPLLLPPPRQKPPSHPPPP-HSPPPTRHRP 383 +PPP P PPPR PP PPPP H PPP+ P Sbjct: 1101 SPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPP 1135 Score = 64.3 bits (155), Expect = 4e-09 Identities = 35/81 (43%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP PS SP P R + PS PPPP P+PPP SP+ PP Sbjct: 1161 PPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPS 1220 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 1221 PMPPPPSPPPPSPPPPSPMPP 1241 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/82 (41%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P P P+ P SP PPPPP+P P P PPP Sbjct: 1135 PPSPPPPTPDAPPPSPPPPPPS------------PPPSPPPSPPPPPSPMPPPPPSPPPP 1182 Query: 321 RQKPPSHPPPP-HSPPPTRHRP 383 R PP PPPP H PPP+ P Sbjct: 1183 RPPPPPSPPPPVHEPPPSPPPP 1204 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/76 (42%), Positives = 35/76 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS + P P+ P P PPPP P PPP SP PPP Sbjct: 1199 PSPPPPPNPSPPPPSPMPPPPSPMPPP-------PSPPPPSPPPPSPMPPPPSP---PPP 1248 Query: 321 RQKPPSHPPPPHSPPP 368 PP PP P SPPP Sbjct: 1249 IPSPPPPPPTPRSPPP 1264 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/77 (42%), Positives = 37/77 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P R + P P PPPPP+PPP P P Sbjct: 1092 PSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPP--PVHEPPPSPPPPPSPPP------PTP 1143 Query: 321 RQKPPSHPPPPHSPPPT 371 PPS PPPP SPPP+ Sbjct: 1144 DAPPPSPPPPPPSPPPS 1160 [14][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 65.5 bits (158), Expect = 2e-09 Identities = 46/119 (38%), Positives = 50/119 (42%), Gaps = 4/119 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP---PPQSPLLL 311 P SPPP PS + SP P+ P SP PP PPPAP PP SP Sbjct: 828 PPPSPPPPPSSPPPPSPSPPPSPP----------PAPSPPPPPNPPPAPTPPPPPSPPPS 877 Query: 312 PPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPP-AGPEPLSS 485 PPP PP PPPP SPPP+ P P PP + P PLSS Sbjct: 878 PPPSPPPPPSPPPPPSPPPSPSPP--------------PSSNPPLSSPPPLSSPPPLSS 922 Score = 59.3 bits (142), Expect = 1e-07 Identities = 35/80 (43%), Positives = 40/80 (50%), Gaps = 4/80 (5%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQS--PLLLP 314 P SPPP P+ + P P+ + S P P PPP P+PPP S PL P Sbjct: 852 PAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSP 911 Query: 315 PPRQKPP--SHPPPPHSPPP 368 PP PP S PPPP SPPP Sbjct: 912 PPLSSPPPLSSPPPPSSPPP 931 Score = 57.4 bits (137), Expect = 5e-07 Identities = 36/83 (43%), Positives = 37/83 (44%), Gaps = 2/83 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP-PPAPPPQSPLLLPP 317 P+ SPPP P S P P A P PS PPPP PP PP P PP Sbjct: 842 PSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPP 901 Query: 318 PRQKPP-SHPPPPHSPPPTRHRP 383 P PP S PPP SPPP P Sbjct: 902 PSSNPPLSSPPPLSSPPPLSSPP 924 Score = 56.6 bits (135), Expect = 9e-07 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PS PPPP P PPP P PPP P PPPP SPPP P Sbjct: 793 PPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSP 839 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/81 (41%), Positives = 35/81 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P SP P SP PPPPPP+PPP PP Sbjct: 788 PPSPPPPLPP-------SPPPPP--------------SPP-PPPPPPSPPPPPNPPTPPS 825 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP SPPP P Sbjct: 826 PPPPPSPPPPPSSPPPPSPSP 846 Score = 54.3 bits (129), Expect = 4e-06 Identities = 34/87 (39%), Positives = 36/87 (41%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 LP P SPPP P SP P P P+ P PPPP PP P Sbjct: 795 LPPSPPPPPSPPPPPP-----PPSPPP-------------PPNPPTPPSPPPPPSPPPPP 836 Query: 303 LLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP PP PPP SPPP + P Sbjct: 837 SSPPPPSPSPPPSPPPAPSPPPPPNPP 863 [15][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 65.5 bits (158), Expect = 2e-09 Identities = 45/122 (36%), Positives = 50/122 (40%), Gaps = 9/122 (7%) Frame = +3 Query: 30 CSPAVASWRAGSCAR---QTRCPLLKRRELGGSSLPLRGCPTSS------PPPYPSHFSS 182 C+P + +G CA T C + LPL P S PPP PS S Sbjct: 179 CTPP-PGYPSGFCAAAIFDTTCECCPISQASTLPLPLPNAPPSPLPPSPPPPPPPSPPPS 237 Query: 183 GALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSP 362 P P + P P PPPPPP PPP SP PPP PP PPPP P Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Query: 363 PP 368 PP Sbjct: 298 PP 299 Score = 61.6 bits (148), Expect = 3e-08 Identities = 35/85 (41%), Positives = 35/85 (41%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P P PPPPPP P P P PPP Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPP--------PPPPPPPPPPPPPPPSPPPPPPPPPP 286 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTC 395 PP PPPP PPP C C Sbjct: 287 PPPPPPPPPPPPPPPPVYPDQCSVC 311 Score = 58.2 bits (139), Expect = 3e-07 Identities = 40/106 (37%), Positives = 49/106 (46%), Gaps = 6/106 (5%) Frame = +3 Query: 84 CPLLKRRELGGSSLPLRGCPT-----SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPC 248 C +LK LG +GC T + PP YPS F + A+ T + P Sbjct: 160 CIILKNNRLG------KGCTTLEQLCTPPPGYPSGFCAAAIFD-TTCECCPISQASTLPL 212 Query: 249 WSPSWPPPP-PPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P+ PP P PP+PPP P PP PP PPPP SPPP+ P Sbjct: 213 PLPNAPPSPLPPSPPPPPPP--SPPPSPPPPPPPPPPSPPPSPPPP 256 [16][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 65.5 bits (158), Expect = 2e-09 Identities = 46/127 (36%), Positives = 51/127 (40%), Gaps = 4/127 (3%) Frame = +3 Query: 138 CPTS----SPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 CP S +PPP PS P P+ P SP+ P PPPP+P P SP Sbjct: 211 CPVSILGNAPPPPPSPQPPSPQPPSPSPP----------PPPSPAPPSPPPPSPLPPSPP 260 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSS 485 PPP PP PPPP PPP P Q P R+ PPA P P S Sbjct: 261 PPPPPSPPPPPPPPPPPPPPPPPPSPSPPPPELPPAQPVTPARKRP---PPPAPPPPPRS 317 Query: 486 TRGCCGC 506 C C Sbjct: 318 DFPFCQC 324 Score = 56.6 bits (135), Expect = 9e-07 Identities = 35/96 (36%), Positives = 39/96 (40%), Gaps = 9/96 (9%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ SPPP PS P P P P PPPPPP PPP P PPP Sbjct: 234 PSPSPPPPPSPAPPSPPPPSPLPPSPPPPPP---PSPPPPPPPPPPPPPPPPPPSPSPPP 290 Query: 321 RQKPPSHP---------PPPHSPPPTRHRPCGTCRR 401 + PP+ P PP PPP P C+R Sbjct: 291 PELPPAQPVTPARKRPPPPAPPPPPRSDFPFCQCQR 326 [17][TOP] >UniRef100_Q2QVU2 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q2QVU2_ORYSJ Length = 1008 Score = 58.5 bits (140), Expect(2) = 2e-09 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 P +P PPPPPPAP P +P L PPP PP PPPP PPP P T R+ Sbjct: 535 PAPTPPAPPPPPPAPSPLAP-LPPPPAPSPPPPPPPPPPPPPCPPAPPKTRSRQ 587 Score = 26.6 bits (57), Expect(2) = 2e-09 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PP PP P PT PA P Sbjct: 528 PPAPPSPPAPTPPAPP 543 [18][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 65.1 bits (157), Expect = 3e-09 Identities = 34/76 (44%), Positives = 34/76 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P P PPPPPP PPP P PPP Sbjct: 2254 PPSPPPPSPHPPSPPPPSPPPPSPP---------PPTPPPSPPPPPPTPPPSPPPPSPPP 2304 Query: 321 RQKPPSHPPPPHSPPP 368 PP PPPP PPP Sbjct: 2305 PSPPPPSPPPPSQPPP 2320 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/81 (44%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S SP P+ P SP P PPPP+PPP SP PPP Sbjct: 2672 PPPSPPPSPPP-PSPPPSPPPSP-----------PPPSPPPPSPPPPSPPPPSPPPSPPP 2719 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 2720 PSPPPPSPPPPSPPPPSPPPP 2740 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/81 (44%), Positives = 38/81 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP PS S SP P P SP P PPPP+PPP P PPP Sbjct: 2676 PPPSPPP-PSPPPSPPPSPPPPSP----------PPPSPPPPSPPPPSPPPSPPPPSPPP 2724 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 2725 PSPPPPSPPPPSPPPPSPPPP 2745 Score = 61.2 bits (147), Expect = 4e-08 Identities = 37/81 (45%), Positives = 40/81 (49%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P+ P SP P PPPP+PPP SP PPP Sbjct: 2695 PPSPPPPSPPPPSPPPPSPPPSP-----------PPPSPPPPSPPPPSPPPPSP---PPP 2740 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 2741 SPPPPS-PPPPSPPPPSPPPP 2760 Score = 60.8 bits (146), Expect = 5e-08 Identities = 37/81 (45%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 2690 PPSPPPPSPPPPSPPPPSPPPPS-----------PPPSPPPPSPPPPSPPPPSP---PPP 2735 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 2736 SPPPPS-PPPPSPPPPSPPPP 2755 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPS-HPPPPHSPPPTRHRPCGT 392 P P PPPPPP+PPP SP PPP PPS PPPP SPPP P T Sbjct: 212 PPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPT 262 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/89 (42%), Positives = 40/89 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PP Sbjct: 2714 PPSPPPPSPPPPSPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPSPPPPLPP 2763 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTCRRRT 407 PP PPPP SPPP+ P R T Sbjct: 2764 APSPPPSPPPP-SPPPSPPPPSPPDRTST 2791 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/81 (40%), Positives = 34/81 (41%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S SP P SP P PPP PPP P PPP Sbjct: 2685 PPPSPPPSPPPPSPPPPSPPPP---------------SPPPPSPPPSPPPPSPPPPSPPP 2729 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP+ P Sbjct: 2730 PSPPPPSPPPPSPPPPSPPPP 2750 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/48 (58%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +3 Query: 243 PCWSPSWPPPPPP-APPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PC PS PPP PP +PPP P LPPP PP PPPP SPPP+ P Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPP-SPPPSPPPP 2572 Score = 58.2 bits (139), Expect = 3e-07 Identities = 33/77 (42%), Positives = 36/77 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S SP P P SP P PPPP+PPP SP PP Sbjct: 2709 PPPSPPPSPPPPSPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPSPPPPSPP 2758 Query: 321 RQKPPSHPPPPHSPPPT 371 PP+ PPP PPP+ Sbjct: 2759 PPLPPAPSPPPSPPPPS 2775 Score = 55.8 bits (133), Expect(2) = 3e-07 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 SP P PPPP+PPP S PPP PPS PPPP +PPP+ P Sbjct: 2261 SPHPPSPPPPSPPPPS----PPPPTPPPSPPPPPPTPPPSPPPP 2300 Score = 21.9 bits (45), Expect(2) = 3e-07 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPP P P P P+ P Sbjct: 2253 PPPSPPPPSPHPPSPP 2268 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 SP PP PPP+PPP SP PPP PPS PPPP PPP+ P Sbjct: 2669 SPPPPPSPPPSPPPPSPPPSPPPSPPPPS-PPPPSPPPPSPPPP 2711 Score = 57.0 bits (136), Expect = 7e-07 Identities = 37/83 (44%), Positives = 39/83 (46%) Frame = +3 Query: 138 CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP 317 C SPPP PS S SP P P P PPPP+PPP SP PP Sbjct: 2527 CSPPSPPP-PSPPPSPPPSPPPPL---------------PPPPSPPPPSPPPPSPPPSPP 2570 Query: 318 PRQKPPSHPPPPHSPPPTRHRPC 386 P PPS PPP SPPP + PC Sbjct: 2571 PPSPPPS--PPPPSPPP--YPPC 2589 Score = 56.6 bits (135), Expect = 9e-07 Identities = 28/56 (50%), Positives = 32/56 (57%) Frame = +3 Query: 216 AG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 AG + + C PS PPPPP+PPP SP PPP PP PPPP PPP+ P Sbjct: 1160 AGTVMGKYFSCNPPS--PPPPPSPPPPSP---PPPPSPPPPSPPPPLPPPPSPPPP 1210 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPS-HPPPPHSPPPTRHRP 383 SP PPPPPP PPP P PPP PPS PPPP SPPP P Sbjct: 204 SPPPPPPPPPLPPPPPP--PPPPSPPPPSPPPPPPPSPPPPSPPP 246 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/56 (44%), Positives = 29/56 (51%), Gaps = 11/56 (19%) Frame = +3 Query: 252 SPSWPPPPPPAP-----------PPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPC 386 SP P PPPP+P PP +P PPP PP PPPP PPP++ PC Sbjct: 2266 SPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPPPC 2321 Score = 54.7 bits (130), Expect = 3e-06 Identities = 36/85 (42%), Positives = 36/85 (42%), Gaps = 1/85 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P P PPPP P PPP P PPP Sbjct: 2724 PPSPPPPSPPPPSPPPPSPPP-------------PSPPPPSPPPPSP-PPPLPPAPSPPP 2769 Query: 321 RQKPPSHPP-PPHSPPPTRHRPCGT 392 PPS PP PP PP R GT Sbjct: 2770 SPPPPSPPPSPPPPSPPDRTSTSGT 2794 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/45 (51%), Positives = 24/45 (53%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCG 389 P P PPPP+PPP P PPP PP P PP PPP P G Sbjct: 221 PPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPTG 265 [19][TOP] >UniRef100_C7BGM8 Formin 2A n=1 Tax=Physcomitrella patens RepID=C7BGM8_PHYPA Length = 1238 Score = 65.1 bits (157), Expect = 3e-09 Identities = 45/126 (35%), Positives = 49/126 (38%), Gaps = 6/126 (4%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP--- 287 S P P PPP+ +SGA P P A P PPPPPP P Sbjct: 608 SGAPAPPPPPPPPPPFGGRSNSGAPPPPPPPPSRPGAPPPPSPPGRSGAPPPPPPLPPGR 667 Query: 288 ---PPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGP 458 PP P L PP P+ PPPP PPP RP G + P RGG P Sbjct: 668 SNAPPPPPPLPAPPGGARPAGPPPPPPPPPGGARPAGPPPPPS------PPGGRGRGGPP 721 Query: 459 PAGPEP 476 P P P Sbjct: 722 PPPPPP 727 [20][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 55.1 bits (131), Expect(2) = 3e-09 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PP P PPP PP PPPP PPP P Sbjct: 639 PPAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPP 681 Score = 29.6 bits (65), Expect(2) = 3e-09 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVPCRHDPHA 210 PPPPP P P +PA P P A Sbjct: 601 PPPPPAPAPPPAPAPPAPAPPPA 623 Score = 57.0 bits (136), Expect = 7e-07 Identities = 33/77 (42%), Positives = 36/77 (46%) Frame = +3 Query: 153 PPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKP 332 PPP P+ P P A A A P P+ PPPPPP PPP P PP P Sbjct: 601 PPPPPA--------PAPPPAPAPPA-----PAPPPAPPPPPPPPPPPAPPPPPAPPPPPP 647 Query: 333 PSHPPPPHSPPPTRHRP 383 P+ PPPP PPP P Sbjct: 648 PAPPPPPAPPPPPAPAP 664 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/80 (42%), Positives = 37/80 (46%), Gaps = 4/80 (5%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP----PPAPPPQSPLL 308 P PPP P+ A P P A P P+ PPPP PPAPPP P Sbjct: 626 PPPPPPPPPAPPPPPAPPPPPPPA----------PPPPPAPPPPPAPAPPPAPPPPPP-- 673 Query: 309 LPPPRQKPPSHPPPPHSPPP 368 PPP PP PPPP +PPP Sbjct: 674 -PPPAPPPPPAPPPPPAPPP 692 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/41 (58%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +3 Query: 252 SPSWPPPPPPAPP--PQSPLLLPPPRQKPPSHPPPPHSPPP 368 SP PPPP PAPP P P PPP PP PPPP +PPP Sbjct: 598 SPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPP 638 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/86 (37%), Positives = 35/86 (40%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P +PPP P A P P P +P PP PPP P P P Sbjct: 615 PPAPAPPPAPPPPPPPPPPPAPPPPPAPPPP--------PPPAPPPPPAPPPPPAPAPPP 666 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP PP+ PPPP PPP P Sbjct: 667 APPPPPPPPPAPPPPPAPPPPPAPPP 692 Score = 53.5 bits (127), Expect = 8e-06 Identities = 31/76 (40%), Positives = 35/76 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P +PPP P+ A +P P A P P PPPPP PPP P PPP Sbjct: 605 PAPAPPPAPA---PPAPAPPP-------APPPPPPPPPPPAPPPPPAPPPPPPPAPPPPP 654 Query: 321 RQKPPSHPPPPHSPPP 368 PP P PP +PPP Sbjct: 655 APPPPPAPAPPPAPPP 670 [21][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 64.3 bits (155), Expect = 4e-09 Identities = 39/89 (43%), Positives = 43/89 (48%), Gaps = 8/89 (8%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWS------PSWPPPPPPAPPPQSP 302 P PPP+P S P P A A++ WP PS PPPP P PPP SP Sbjct: 2078 PPPPPPPWPPPPSP---PPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPPPSP 2134 Query: 303 --LLLPPPRQKPPSHPPPPHSPPPTRHRP 383 LPPP PP PPPP SPPP+ P Sbjct: 2135 PPAPLPPPPPSPPPSPPPPPSPPPSPPAP 2163 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/81 (41%), Positives = 35/81 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P + PPP P S P P P SP PPPPPPAP P P LPPP Sbjct: 2021 PPNHPPPSPPPLPSPPPLPSPPPPSP--------PPLSPPPPPPPPPAPLPPPPPPLPPP 2072 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 P PPPP PPP P Sbjct: 2073 APSPSPPPPPPPWPPPPSPPP 2093 Score = 57.8 bits (138), Expect = 4e-07 Identities = 37/89 (41%), Positives = 37/89 (41%), Gaps = 10/89 (11%) Frame = +3 Query: 147 SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPR- 323 S PPP P S P P P SPS PPPPPP PPP SP PPP Sbjct: 2040 SPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAP 2099 Query: 324 ---------QKPPSHPPPPHSPPPTRHRP 383 PPS PPP SPPP P Sbjct: 2100 PPGAAQAPWPPPPSPSPPPPSPPPPPSPP 2128 Score = 55.8 bits (133), Expect = 2e-06 Identities = 33/86 (38%), Positives = 36/86 (41%), Gaps = 5/86 (5%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP-----APPPQSPL 305 P+ PPP P+ A +P P P SP PPP PP PPP P Sbjct: 2089 PSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPPPSPPPAPLPPPPPSPPP 2148 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP PPS P PP PPP P Sbjct: 2149 SPPPPPSPPPSPPAPPPHPPPEPPAP 2174 Score = 53.9 bits (128), Expect = 6e-06 Identities = 36/81 (44%), Positives = 36/81 (44%), Gaps = 5/81 (6%) Frame = +3 Query: 141 PTSSPPPYPSHF--SSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQ---SPL 305 P SPPP PS S LSP P P PPPPPP PPP SP Sbjct: 2031 PLPSPPPLPSPPPPSPPPLSPPPPP-----------PPPPAPLPPPPPPLPPPAPSPSPP 2079 Query: 306 LLPPPRQKPPSHPPPPHSPPP 368 PPP PPS PPPP PP Sbjct: 2080 PPPPPWPPPPSPPPPPPPAPP 2100 [22][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 64.3 bits (155), Expect = 4e-09 Identities = 37/91 (40%), Positives = 38/91 (41%), Gaps = 7/91 (7%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRR-RT*RQRCRPL 431 P PPPPPP PPP P PPP PP PPPP PPP C CRR C P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPCCEKCRRGPCCHHFCMPT 136 Query: 432 RRSARGGGPPAGPEPLSSTR------GCCGC 506 PP P P + GCC C Sbjct: 137 -------VPPYCPVPCRRSECDKWGDGCCSC 160 [23][TOP] >UniRef100_A4QSC9 Predicted protein n=1 Tax=Magnaporthe grisea RepID=A4QSC9_MAGGR Length = 309 Score = 64.3 bits (155), Expect = 4e-09 Identities = 43/101 (42%), Positives = 46/101 (45%), Gaps = 20/101 (19%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALS-------P*PTRAGAG*ASRRRW-------PCWSPSWPPPPP 278 PT PPP PSH S P P A + RR P +PS PPPPP Sbjct: 173 PTQPPPPPPSHTPKPPPSHSPKPPPPPPISHSAAASLPRRTLPSRLPPPSHTPSPPPPPP 232 Query: 279 ----PAPPPQSPLLLPPPRQKPPSH--PPPPHSPPPTRHRP 383 PAPPP S PPP PPS PPPP PPP+ RP Sbjct: 233 PSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPPPPPSSTRP 273 Score = 57.0 bits (136), Expect = 7e-07 Identities = 37/89 (41%), Positives = 41/89 (46%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQ 296 +SLP R P+ PPP SH S P P+ A P P PPPP PPP Sbjct: 207 ASLPRRTLPSRLPPP--SHTPSPPPPPPPSHTPA--------PPPPSHTPAPPPPPPPPS 256 Query: 297 SPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 S L PPP P S PPP PPP + P Sbjct: 257 SSLPPPPPPPPPSSTRPPP--PPPAQTTP 283 [24][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 58.5 bits (140), Expect(2) = 5e-09 Identities = 28/53 (52%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPP--PTRHRPCGTC 395 P PS PPPPPP PPP P PPP PP HPPPP PP P C C Sbjct: 673 PPLPPSPPPPPPPPPPPPPPP--PPPPPPPPPHPPPPSPPPLVPALPPSCEVC 723 Score = 25.4 bits (54), Expect(2) = 5e-09 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P +P Sbjct: 661 PPPPPPPPPPPPPPLP 676 Score = 57.8 bits (138), Expect(2) = 2e-08 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PPS PPPP PPP Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 595 PPPPPPPPPPPPPPPP 610 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/76 (44%), Positives = 34/76 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P P PPPPPP PPP P PPP Sbjct: 211 PPSPPPPPPLPPSPPPPSPPPPP-----------PSPPPPLPPPPPPPPPPPPPPPPPPP 259 Query: 321 RQKPPSHPPPPHSPPP 368 PP PPPP PPP Sbjct: 260 PPPPPPPPPPPPPPPP 275 Score = 57.0 bits (136), Expect(2) = 3e-08 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PPP P PPP PP PPPP PPP P Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHP 704 Score = 24.3 bits (51), Expect(2) = 3e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 606 PPPPPPPPPPPPPPPP 621 Score = 56.6 bits (135), Expect(2) = 4e-08 Identities = 31/74 (41%), Positives = 31/74 (41%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLR 434 P PPPPPP PPP P PPP PP PPPP PPP P PL Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--------------PLP 676 Query: 435 RSARGGGPPAGPEP 476 S PP P P Sbjct: 677 PSPPPPPPPPPPPP 690 Score = 24.3 bits (51), Expect(2) = 4e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 575 PPPPPPPPPPPPPPPP 590 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 26/49 (53%), Positives = 26/49 (53%), Gaps = 6/49 (12%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLL------PPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PPP P L PPP PP PPPP PPP H P Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 292 PPPPPPPPPPPPPPPP 307 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 293 PPPPPPPPPPPPPPPP 308 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 294 PPPPPPPPPPPPPPPP 309 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 295 PPPPPPPPPPPPPPPP 310 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 296 PPPPPPPPPPPPPPPP 311 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 297 PPPPPPPPPPPPPPPP 312 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 298 PPPPPPPPPPPPPPPP 313 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 299 PPPPPPPPPPPPPPPP 314 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 300 PPPPPPPPPPPPPPPP 315 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 301 PPPPPPPPPPPPPPPP 316 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 302 PPPPPPPPPPPPPPPP 317 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 303 PPPPPPPPPPPPPPPP 318 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 304 PPPPPPPPPPPPPPPP 319 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 305 PPPPPPPPPPPPPPPP 320 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 306 PPPPPPPPPPPPPPPP 321 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 307 PPPPPPPPPPPPPPPP 322 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 308 PPPPPPPPPPPPPPPP 323 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 309 PPPPPPPPPPPPPPPP 324 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 310 PPPPPPPPPPPPPPPP 325 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 311 PPPPPPPPPPPPPPPP 326 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 312 PPPPPPPPPPPPPPPP 327 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 313 PPPPPPPPPPPPPPPP 328 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 314 PPPPPPPPPPPPPPPP 329 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 315 PPPPPPPPPPPPPPPP 330 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 316 PPPPPPPPPPPPPPPP 331 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 317 PPPPPPPPPPPPPPPP 332 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 318 PPPPPPPPPPPPPPPP 333 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 319 PPPPPPPPPPPPPPPP 334 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 320 PPPPPPPPPPPPPPPP 335 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 321 PPPPPPPPPPPPPPPP 336 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 322 PPPPPPPPPPPPPPPP 337 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 323 PPPPPPPPPPPPPPPP 338 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 324 PPPPPPPPPPPPPPPP 339 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 325 PPPPPPPPPPPPPPPP 340 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 326 PPPPPPPPPPPPPPPP 341 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 327 PPPPPPPPPPPPPPPP 342 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 328 PPPPPPPPPPPPPPPP 343 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 329 PPPPPPPPPPPPPPPP 344 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 330 PPPPPPPPPPPPPPPP 345 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 331 PPPPPPPPPPPPPPPP 346 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 332 PPPPPPPPPPPPPPPP 347 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 333 PPPPPPPPPPPPPPPP 348 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 334 PPPPPPPPPPPPPPPP 349 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 335 PPPPPPPPPPPPPPPP 350 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 336 PPPPPPPPPPPPPPPP 351 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 337 PPPPPPPPPPPPPPPP 352 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 338 PPPPPPPPPPPPPPPP 353 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 339 PPPPPPPPPPPPPPPP 354 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 340 PPPPPPPPPPPPPPPP 355 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 341 PPPPPPPPPPPPPPPP 356 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 342 PPPPPPPPPPPPPPPP 357 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 343 PPPPPPPPPPPPPPPP 358 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 344 PPPPPPPPPPPPPPPP 359 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 345 PPPPPPPPPPPPPPPP 360 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 346 PPPPPPPPPPPPPPPP 361 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 347 PPPPPPPPPPPPPPPP 362 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 348 PPPPPPPPPPPPPPPP 363 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 349 PPPPPPPPPPPPPPPP 364 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 350 PPPPPPPPPPPPPPPP 365 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 351 PPPPPPPPPPPPPPPP 366 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 352 PPPPPPPPPPPPPPPP 367 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 353 PPPPPPPPPPPPPPPP 368 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 354 PPPPPPPPPPPPPPPP 369 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 355 PPPPPPPPPPPPPPPP 370 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 356 PPPPPPPPPPPPPPPP 371 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 357 PPPPPPPPPPPPPPPP 372 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 358 PPPPPPPPPPPPPPPP 373 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 359 PPPPPPPPPPPPPPPP 374 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 360 PPPPPPPPPPPPPPPP 375 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 361 PPPPPPPPPPPPPPPP 376 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 362 PPPPPPPPPPPPPPPP 377 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 363 PPPPPPPPPPPPPPPP 378 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 364 PPPPPPPPPPPPPPPP 379 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 365 PPPPPPPPPPPPPPPP 380 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 366 PPPPPPPPPPPPPPPP 381 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 367 PPPPPPPPPPPPPPPP 382 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 368 PPPPPPPPPPPPPPPP 383 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 369 PPPPPPPPPPPPPPPP 384 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 370 PPPPPPPPPPPPPPPP 385 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 371 PPPPPPPPPPPPPPPP 386 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 372 PPPPPPPPPPPPPPPP 387 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 373 PPPPPPPPPPPPPPPP 388 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 374 PPPPPPPPPPPPPPPP 389 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 375 PPPPPPPPPPPPPPPP 390 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 376 PPPPPPPPPPPPPPPP 391 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 377 PPPPPPPPPPPPPPPP 392 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 378 PPPPPPPPPPPPPPPP 393 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 379 PPPPPPPPPPPPPPPP 394 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 380 PPPPPPPPPPPPPPPP 395 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 381 PPPPPPPPPPPPPPPP 396 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 382 PPPPPPPPPPPPPPPP 397 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 383 PPPPPPPPPPPPPPPP 398 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 384 PPPPPPPPPPPPPPPP 399 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 385 PPPPPPPPPPPPPPPP 400 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 386 PPPPPPPPPPPPPPPP 401 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 387 PPPPPPPPPPPPPPPP 402 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 388 PPPPPPPPPPPPPPPP 403 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 389 PPPPPPPPPPPPPPPP 404 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 390 PPPPPPPPPPPPPPPP 405 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 391 PPPPPPPPPPPPPPPP 406 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 392 PPPPPPPPPPPPPPPP 407 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 393 PPPPPPPPPPPPPPPP 408 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 394 PPPPPPPPPPPPPPPP 409 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 395 PPPPPPPPPPPPPPPP 410 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 396 PPPPPPPPPPPPPPPP 411 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 397 PPPPPPPPPPPPPPPP 412 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 398 PPPPPPPPPPPPPPPP 413 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 399 PPPPPPPPPPPPPPPP 414 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 400 PPPPPPPPPPPPPPPP 415 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 401 PPPPPPPPPPPPPPPP 416 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 402 PPPPPPPPPPPPPPPP 417 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 403 PPPPPPPPPPPPPPPP 418 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 404 PPPPPPPPPPPPPPPP 419 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 405 PPPPPPPPPPPPPPPP 420 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 406 PPPPPPPPPPPPPPPP 421 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 407 PPPPPPPPPPPPPPPP 422 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 408 PPPPPPPPPPPPPPPP 423 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 409 PPPPPPPPPPPPPPPP 424 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 410 PPPPPPPPPPPPPPPP 425 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 411 PPPPPPPPPPPPPPPP 426 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 412 PPPPPPPPPPPPPPPP 427 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 413 PPPPPPPPPPPPPPPP 428 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 414 PPPPPPPPPPPPPPPP 429 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 415 PPPPPPPPPPPPPPPP 430 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 416 PPPPPPPPPPPPPPPP 431 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 417 PPPPPPPPPPPPPPPP 432 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 418 PPPPPPPPPPPPPPPP 433 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 419 PPPPPPPPPPPPPPPP 434 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 420 PPPPPPPPPPPPPPPP 435 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 421 PPPPPPPPPPPPPPPP 436 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 422 PPPPPPPPPPPPPPPP 437 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 423 PPPPPPPPPPPPPPPP 438 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 424 PPPPPPPPPPPPPPPP 439 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 425 PPPPPPPPPPPPPPPP 440 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 426 PPPPPPPPPPPPPPPP 441 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 427 PPPPPPPPPPPPPPPP 442 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 428 PPPPPPPPPPPPPPPP 443 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 429 PPPPPPPPPPPPPPPP 444 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 430 PPPPPPPPPPPPPPPP 445 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 431 PPPPPPPPPPPPPPPP 446 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 432 PPPPPPPPPPPPPPPP 447 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 433 PPPPPPPPPPPPPPPP 448 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 434 PPPPPPPPPPPPPPPP 449 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 435 PPPPPPPPPPPPPPPP 450 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 436 PPPPPPPPPPPPPPPP 451 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 437 PPPPPPPPPPPPPPPP 452 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 438 PPPPPPPPPPPPPPPP 453 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 439 PPPPPPPPPPPPPPPP 454 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 440 PPPPPPPPPPPPPPPP 455 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 441 PPPPPPPPPPPPPPPP 456 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 442 PPPPPPPPPPPPPPPP 457 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 443 PPPPPPPPPPPPPPPP 458 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 444 PPPPPPPPPPPPPPPP 459 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 445 PPPPPPPPPPPPPPPP 460 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 446 PPPPPPPPPPPPPPPP 461 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 447 PPPPPPPPPPPPPPPP 462 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 448 PPPPPPPPPPPPPPPP 463 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 449 PPPPPPPPPPPPPPPP 464 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 450 PPPPPPPPPPPPPPPP 465 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 451 PPPPPPPPPPPPPPPP 466 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 452 PPPPPPPPPPPPPPPP 467 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 453 PPPPPPPPPPPPPPPP 468 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 454 PPPPPPPPPPPPPPPP 469 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 455 PPPPPPPPPPPPPPPP 470 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 456 PPPPPPPPPPPPPPPP 471 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 457 PPPPPPPPPPPPPPPP 472 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 458 PPPPPPPPPPPPPPPP 473 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 459 PPPPPPPPPPPPPPPP 474 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 460 PPPPPPPPPPPPPPPP 475 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 461 PPPPPPPPPPPPPPPP 476 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 462 PPPPPPPPPPPPPPPP 477 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 463 PPPPPPPPPPPPPPPP 478 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 464 PPPPPPPPPPPPPPPP 479 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 465 PPPPPPPPPPPPPPPP 480 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 466 PPPPPPPPPPPPPPPP 481 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 467 PPPPPPPPPPPPPPPP 482 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 468 PPPPPPPPPPPPPPPP 483 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 469 PPPPPPPPPPPPPPPP 484 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 470 PPPPPPPPPPPPPPPP 485 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 471 PPPPPPPPPPPPPPPP 486 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 472 PPPPPPPPPPPPPPPP 487 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 473 PPPPPPPPPPPPPPPP 488 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 474 PPPPPPPPPPPPPPPP 489 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 475 PPPPPPPPPPPPPPPP 490 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 476 PPPPPPPPPPPPPPPP 491 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 477 PPPPPPPPPPPPPPPP 492 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 478 PPPPPPPPPPPPPPPP 493 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 479 PPPPPPPPPPPPPPPP 494 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 480 PPPPPPPPPPPPPPPP 495 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 481 PPPPPPPPPPPPPPPP 496 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 482 PPPPPPPPPPPPPPPP 497 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 483 PPPPPPPPPPPPPPPP 498 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 484 PPPPPPPPPPPPPPPP 499 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 485 PPPPPPPPPPPPPPPP 500 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 486 PPPPPPPPPPPPPPPP 501 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 487 PPPPPPPPPPPPPPPP 502 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 488 PPPPPPPPPPPPPPPP 503 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 489 PPPPPPPPPPPPPPPP 504 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 490 PPPPPPPPPPPPPPPP 505 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 491 PPPPPPPPPPPPPPPP 506 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 492 PPPPPPPPPPPPPPPP 507 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 493 PPPPPPPPPPPPPPPP 508 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 494 PPPPPPPPPPPPPPPP 509 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 495 PPPPPPPPPPPPPPPP 510 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 496 PPPPPPPPPPPPPPPP 511 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 497 PPPPPPPPPPPPPPPP 512 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 498 PPPPPPPPPPPPPPPP 513 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 499 PPPPPPPPPPPPPPPP 514 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 500 PPPPPPPPPPPPPPPP 515 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 501 PPPPPPPPPPPPPPPP 516 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 502 PPPPPPPPPPPPPPPP 517 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 503 PPPPPPPPPPPPPPPP 518 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 504 PPPPPPPPPPPPPPPP 519 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 505 PPPPPPPPPPPPPPPP 520 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 506 PPPPPPPPPPPPPPPP 521 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 507 PPPPPPPPPPPPPPPP 522 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 508 PPPPPPPPPPPPPPPP 523 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 509 PPPPPPPPPPPPPPPP 524 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 510 PPPPPPPPPPPPPPPP 525 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 511 PPPPPPPPPPPPPPPP 526 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 512 PPPPPPPPPPPPPPPP 527 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 513 PPPPPPPPPPPPPPPP 528 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 514 PPPPPPPPPPPPPPPP 529 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 515 PPPPPPPPPPPPPPPP 530 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 516 PPPPPPPPPPPPPPPP 531 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 517 PPPPPPPPPPPPPPPP 532 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 518 PPPPPPPPPPPPPPPP 533 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 519 PPPPPPPPPPPPPPPP 534 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 520 PPPPPPPPPPPPPPPP 535 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 521 PPPPPPPPPPPPPPPP 536 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 522 PPPPPPPPPPPPPPPP 537 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 523 PPPPPPPPPPPPPPPP 538 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 524 PPPPPPPPPPPPPPPP 539 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 525 PPPPPPPPPPPPPPPP 540 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 526 PPPPPPPPPPPPPPPP 541 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 527 PPPPPPPPPPPPPPPP 542 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 528 PPPPPPPPPPPPPPPP 543 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 529 PPPPPPPPPPPPPPPP 544 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 530 PPPPPPPPPPPPPPPP 545 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 531 PPPPPPPPPPPPPPPP 546 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 532 PPPPPPPPPPPPPPPP 547 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 533 PPPPPPPPPPPPPPPP 548 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 534 PPPPPPPPPPPPPPPP 549 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 535 PPPPPPPPPPPPPPPP 550 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 536 PPPPPPPPPPPPPPPP 551 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 537 PPPPPPPPPPPPPPPP 552 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 538 PPPPPPPPPPPPPPPP 553 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 539 PPPPPPPPPPPPPPPP 554 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 540 PPPPPPPPPPPPPPPP 555 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 541 PPPPPPPPPPPPPPPP 556 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 542 PPPPPPPPPPPPPPPP 557 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 543 PPPPPPPPPPPPPPPP 558 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 544 PPPPPPPPPPPPPPPP 559 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 545 PPPPPPPPPPPPPPPP 560 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 546 PPPPPPPPPPPPPPPP 561 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 547 PPPPPPPPPPPPPPPP 562 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 548 PPPPPPPPPPPPPPPP 563 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 549 PPPPPPPPPPPPPPPP 564 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 550 PPPPPPPPPPPPPPPP 565 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 551 PPPPPPPPPPPPPPPP 566 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 552 PPPPPPPPPPPPPPPP 567 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 553 PPPPPPPPPPPPPPPP 568 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 554 PPPPPPPPPPPPPPPP 569 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 555 PPPPPPPPPPPPPPPP 570 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 556 PPPPPPPPPPPPPPPP 571 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 557 PPPPPPPPPPPPPPPP 572 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 558 PPPPPPPPPPPPPPPP 573 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 559 PPPPPPPPPPPPPPPP 574 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 560 PPPPPPPPPPPPPPPP 575 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 561 PPPPPPPPPPPPPPPP 576 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 562 PPPPPPPPPPPPPPPP 577 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 563 PPPPPPPPPPPPPPPP 578 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 564 PPPPPPPPPPPPPPPP 579 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 565 PPPPPPPPPPPPPPPP 580 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 566 PPPPPPPPPPPPPPPP 581 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 567 PPPPPPPPPPPPPPPP 582 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 568 PPPPPPPPPPPPPPPP 583 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 569 PPPPPPPPPPPPPPPP 584 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 570 PPPPPPPPPPPPPPPP 585 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 571 PPPPPPPPPPPPPPPP 586 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 572 PPPPPPPPPPPPPPPP 587 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 573 PPPPPPPPPPPPPPPP 588 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 574 PPPPPPPPPPPPPPPP 589 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 576 PPPPPPPPPPPPPPPP 591 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 577 PPPPPPPPPPPPPPPP 592 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 578 PPPPPPPPPPPPPPPP 593 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 579 PPPPPPPPPPPPPPPP 594 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 580 PPPPPPPPPPPPPPPP 595 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 581 PPPPPPPPPPPPPPPP 596 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 582 PPPPPPPPPPPPPPPP 597 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 583 PPPPPPPPPPPPPPPP 598 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 584 PPPPPPPPPPPPPPPP 599 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 585 PPPPPPPPPPPPPPPP 600 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 586 PPPPPPPPPPPPPPPP 601 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 587 PPPPPPPPPPPPPPPP 602 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 588 PPPPPPPPPPPPPPPP 603 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 589 PPPPPPPPPPPPPPPP 604 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 590 PPPPPPPPPPPPPPPP 605 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 591 PPPPPPPPPPPPPPPP 606 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 592 PPPPPPPPPPPPPPPP 607 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 593 PPPPPPPPPPPPPPPP 608 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 594 PPPPPPPPPPPPPPPP 609 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 596 PPPPPPPPPPPPPPPP 611 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 597 PPPPPPPPPPPPPPPP 612 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 598 PPPPPPPPPPPPPPPP 613 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 599 PPPPPPPPPPPPPPPP 614 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 600 PPPPPPPPPPPPPPPP 615 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 601 PPPPPPPPPPPPPPPP 616 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 602 PPPPPPPPPPPPPPPP 617 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 603 PPPPPPPPPPPPPPPP 618 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 604 PPPPPPPPPPPPPPPP 619 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 605 PPPPPPPPPPPPPPPP 620 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 607 PPPPPPPPPPPPPPPP 622 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 608 PPPPPPPPPPPPPPPP 623 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 609 PPPPPPPPPPPPPPPP 624 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 610 PPPPPPPPPPPPPPPP 625 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 611 PPPPPPPPPPPPPPPP 626 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 612 PPPPPPPPPPPPPPPP 627 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 613 PPPPPPPPPPPPPPPP 628 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 614 PPPPPPPPPPPPPPPP 629 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 615 PPPPPPPPPPPPPPPP 630 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 616 PPPPPPPPPPPPPPPP 631 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 617 PPPPPPPPPPPPPPPP 632 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 618 PPPPPPPPPPPPPPPP 633 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 619 PPPPPPPPPPPPPPPP 634 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 620 PPPPPPPPPPPPPPPP 635 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 621 PPPPPPPPPPPPPPPP 636 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 622 PPPPPPPPPPPPPPPP 637 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 623 PPPPPPPPPPPPPPPP 638 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 624 PPPPPPPPPPPPPPPP 639 Score = 60.1 bits (144), Expect = 8e-08 Identities = 36/82 (43%), Positives = 36/82 (43%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 LP P S PPP PS L P P P P PPPPPP PPP P Sbjct: 220 LPPSPPPPSPPPPPPS--PPPPLPPPPP------------PPPPPPPPPPPPPPPPPPPP 265 Query: 303 LLLPPPRQKPPSHPPPPHSPPP 368 PPP PP PPPP PPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPP 287 Score = 55.1 bits (131), Expect(2) = 1e-07 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP P P SP PPP PP PPPP PPP P Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 24.3 bits (51), Expect(2) = 1e-07 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 625 PPPPPPPPPPPPPPPP 640 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/85 (40%), Positives = 37/85 (43%), Gaps = 4/85 (4%) Frame = +3 Query: 126 PLRGCPTSSP----PPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPP 293 P + CP S+ PP PS L P P P PPPPPP+PPP Sbjct: 195 PCQCCPVSTVIGYNPPPPSPPPPPPLPPSPP----------------PPSPPPPPPSPPP 238 Query: 294 QSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPP PP PPPP PPP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/76 (42%), Positives = 32/76 (42%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P P P P P PPPPPP PPP P PPP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPP-------------PPPPPPPPPPPPPPPPPPPPPPPPPP 279 Query: 321 RQKPPSHPPPPHSPPP 368 PP PPPP PPP Sbjct: 280 PPPPPPPPPPPPPPPP 295 Score = 53.5 bits (127), Expect(2) = 3e-07 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPP PP+PPP P PPP PP PPPP PPP P Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 24.3 bits (51), Expect(2) = 3e-07 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 626 PPPPPPPPPPPPPPPP 641 Score = 57.0 bits (136), Expect = 7e-07 Identities = 33/81 (40%), Positives = 33/81 (40%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 PL P PPP P P P P P PPPPPP PPP P Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPP-------------PPPPPPPPPPPPPPPPPPPPP 285 Query: 306 LLPPPRQKPPSHPPPPHSPPP 368 PPP PP PPPP PPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPP 306 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 51.6 bits (122), Expect(2) = 1e-06 Identities = 23/41 (56%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 255 PSWPPPPPP--APPPQSPLLLPPPRQKPPSHPPPPHSPPPT 371 P PPPP P PPP P PPP PP PPPPH PPP+ Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPS 708 Score = 24.3 bits (51), Expect(2) = 1e-06 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 627 PPPPPPPPPPPPPPPP 642 [25][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 63.9 bits (154), Expect = 6e-09 Identities = 39/79 (49%), Positives = 40/79 (50%) Frame = +3 Query: 129 LRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLL 308 +R P SSPPP PS SS SP P S R P P PPPPPP PPP P Sbjct: 214 VRRPPPSSPPPPPSA-SSPPSSPSP--------SPRPPPPPMPPPPPPPPPPPPPPPPPP 264 Query: 309 LPPPRQKPPSHPPPPHSPP 365 PPP PP PPPP PP Sbjct: 265 SPPPPPPPPPPPPPPLLPP 283 [26][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 59.7 bits (143), Expect(2) = 6e-09 Identities = 36/80 (45%), Positives = 37/80 (46%), Gaps = 9/80 (11%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTR-HRPCGTCRRRT---*RQRC 422 P PPPPPP PPP P PPP PP PPPP PPP R H P + T R Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPSSATATALGARANV 128 Query: 423 RPLRRSARGG-----GPPAG 467 R S R G GPP G Sbjct: 129 VDERGSGRAGLRDPSGPPRG 148 Score = 24.3 bits (51), Expect(2) = 6e-09 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 13 PPPPPPPPPPPPPPPP 28 Score = 57.0 bits (136), Expect(2) = 4e-08 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHR 380 P PPPPPP PPP P PPP PP PPPP PPP R Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQR 108 Score = 24.3 bits (51), Expect(2) = 4e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 11 PPPPPPPPPPPPPPPP 26 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 2 PPPPPPPPPPPPPPPP 17 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 3 PPPPPPPPPPPPPPPP 18 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 4 PPPPPPPPPPPPPPPP 19 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 5 PPPPPPPPPPPPPPPP 20 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 6 PPPPPPPPPPPPPPPP 21 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 7 PPPPPPPPPPPPPPPP 22 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 8 PPPPPPPPPPPPPPPP 23 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 9 PPPPPPPPPPPPPPPP 24 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 10 PPPPPPPPPPPPPPPP 25 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 12 PPPPPPPPPPPPPPPP 27 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 14 PPPPPPPPPPPPPPPP 29 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 15 PPPPPPPPPPPPPPPP 30 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 16 PPPPPPPPPPPPPPPP 31 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 17 PPPPPPPPPPPPPPPP 32 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 18 PPPPPPPPPPPPPPPP 33 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 19 PPPPPPPPPPPPPPPP 34 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 20 PPPPPPPPPPPPPPPP 35 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 21 PPPPPPPPPPPPPPPP 36 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 22 PPPPPPPPPPPPPPPP 37 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 23 PPPPPPPPPPPPPPPP 38 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 24 PPPPPPPPPPPPPPPP 39 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 25 PPPPPPPPPPPPPPPP 40 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 26 PPPPPPPPPPPPPPPP 41 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 27 PPPPPPPPPPPPPPPP 42 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 28 PPPPPPPPPPPPPPPP 43 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 29 PPPPPPPPPPPPPPPP 44 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 30 PPPPPPPPPPPPPPPP 45 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 31 PPPPPPPPPPPPPPPP 46 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 32 PPPPPPPPPPPPPPPP 47 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 33 PPPPPPPPPPPPPPPP 48 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 34 PPPPPPPPPPPPPPPP 49 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 35 PPPPPPPPPPPPPPPP 50 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 36 PPPPPPPPPPPPPPPP 51 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 37 PPPPPPPPPPPPPPPP 52 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 38 PPPPPPPPPPPPPPPP 53 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 39 PPPPPPPPPPPPPPPP 54 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 40 PPPPPPPPPPPPPPPP 55 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 41 PPPPPPPPPPPPPPPP 56 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 42 PPPPPPPPPPPPPPPP 57 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 43 PPPPPPPPPPPPPPPP 58 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 44 PPPPPPPPPPPPPPPP 59 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 45 PPPPPPPPPPPPPPPP 60 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 46 PPPPPPPPPPPPPPPP 61 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 47 PPPPPPPPPPPPPPPP 62 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 48 PPPPPPPPPPPPPPPP 63 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 49 PPPPPPPPPPPPPPPP 64 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 50 PPPPPPPPPPPPPPPP 65 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 51 PPPPPPPPPPPPPPPP 66 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 52 PPPPPPPPPPPPPPPP 67 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 53 PPPPPPPPPPPPPPPP 68 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 54 PPPPPPPPPPPPPPPP 69 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 55 PPPPPPPPPPPPPPPP 70 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 56 PPPPPPPPPPPPPPPP 71 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 57 PPPPPPPPPPPPPPPP 72 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 58 PPPPPPPPPPPPPPPP 73 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [27][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 58.2 bits (139), Expect(2) = 6e-09 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PPP P PPP PP PPPP PPP + P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEP 102 Score = 25.8 bits (55), Expect(2) = 6e-09 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTSPAVP 189 +L R A PPPPP P P P P Sbjct: 33 SLFLQQSRNAHSPPPPPPPPPPPPPPPP 60 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 46 PPPPPPPPPPPPPPPP 61 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 47 PPPPPPPPPPPPPPPP 62 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 48 PPPPPPPPPPPPPPPP 63 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 49 PPPPPPPPPPPPPPPP 64 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 50 PPPPPPPPPPPPPPPP 65 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 51 PPPPPPPPPPPPPPPP 66 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 52 PPPPPPPPPPPPPPPP 67 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 SP PPPPPP PPP P PPP PP PPPP PPP Sbjct: 44 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 [28][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 58.9 bits (141), Expect(2) = 7e-09 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLL-LPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PPP P+ PPP PP HPPPP PPP P Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPP 186 Score = 24.6 bits (52), Expect(2) = 7e-09 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 118 HPCRYAGVPPPPPLPTLPTSPAVP 189 H R +PPPP LP P P P Sbjct: 119 HHHRGRFMPPPPVLPGPPVGPPPP 142 Score = 61.2 bits (147), Expect = 4e-08 Identities = 38/98 (38%), Positives = 43/98 (43%), Gaps = 6/98 (6%) Frame = +3 Query: 108 LGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP----P 275 + G +P P + P P P G +P P G P SP PPP P Sbjct: 182 VAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVE-GPPPPKGPPPPPHSPPGPPPAEGPP 240 Query: 276 PPA--PPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPA PPP P+ PPP PP H PPPH PPP P Sbjct: 241 PPAKVPPPAPPVEGPPPPHSPPPHGPPPHFPPPAEGPP 278 Score = 58.5 bits (140), Expect = 2e-07 Identities = 35/88 (39%), Positives = 40/88 (45%), Gaps = 2/88 (2%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P+ G P PP P H G P A + P P PPPP +PPP P Sbjct: 213 PVEGPPPPKGPPPPPHSPPG-----PPPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPP 267 Query: 306 L-LPPPRQ-KPPSHPPPPHSPPPTRHRP 383 PPP + PP H PPPHSPPP+ P Sbjct: 268 PHFPPPAEGPPPPHGPPPHSPPPSEGPP 295 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/42 (57%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPR--QKPPSHPPPPHSPPPTRHRP 383 PPPPPP PPP P PPP PP PPPPH PPP P Sbjct: 140 PPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPP 181 Score = 53.9 bits (128), Expect = 6e-06 Identities = 30/76 (39%), Positives = 33/76 (43%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLR 434 P PPPPPP PPP P PPP P + PPPP PPP H P Sbjct: 136 PVGPPPPPPPPPPPPP---PPPPPPPMAGPPPPPGPPPP-HPP----------------- 174 Query: 435 RSARGGGPPAGPEPLS 482 PPAGP P++ Sbjct: 175 -------PPAGPPPVA 183 [29][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 63.5 bits (153), Expect = 7e-09 Identities = 38/92 (41%), Positives = 45/92 (48%) Frame = +3 Query: 108 LGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP 287 + G S+P C T+S P SS L P P+ G +S P +PS PPPPPP P Sbjct: 506 ISGPSIP---CGTTSVPGVAGALSSTTLVP-PSSPLLGSSSVENGPVSAPSPPPPPPPPP 561 Query: 288 PPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PP P PPP P + PP P PPP P Sbjct: 562 PPPPP---PPPPPLPSAEPPVPPPPPPPPGAP 590 [30][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 63.5 bits (153), Expect = 7e-09 Identities = 38/92 (41%), Positives = 45/92 (48%) Frame = +3 Query: 108 LGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP 287 + G S+P C T+S P SS L P P+ G +S P +PS PPPPPP P Sbjct: 518 ISGPSIP---CGTTSVPGVAGALSSTTLVP-PSSPLLGSSSVENGPVSAPSPPPPPPPPP 573 Query: 288 PPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PP P PPP P + PP P PPP P Sbjct: 574 PPPPP---PPPPPLPSAEPPVPPPPPPPPGAP 602 [31][TOP] >UniRef100_Q948Y7 VMP3 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y7_VOLCA Length = 687 Score = 63.5 bits (153), Expect = 7e-09 Identities = 39/84 (46%), Positives = 41/84 (48%), Gaps = 3/84 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 PTS PP P+ S SP P A P +P P PPPP PPP SP PPP Sbjct: 569 PTSPDPPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSP---PPP 625 Query: 321 RQKPPSHP---PPPHSPPPTRHRP 383 PPS P PPP SPPP RP Sbjct: 626 SPPPPSPPPPNPPPPSPPPPSPRP 649 Score = 58.9 bits (141), Expect = 2e-07 Identities = 44/117 (37%), Positives = 48/117 (41%), Gaps = 3/117 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P + SP P P SP P PPPP+PPP +P PPP Sbjct: 594 PPSPPPPSPPPPNPPPPSPPPPNP----------PPPSPPPPSPPPPSPPPPNP---PPP 640 Query: 321 RQKPPS---HPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPS PPP SPPP R P R P RRS P P +S Sbjct: 641 SPPPPSPRPPTPPPPSPPPPRPPP-----------RPPPTRRSPPPTSSPPPPVAVS 686 Score = 55.8 bits (133), Expect = 2e-06 Identities = 33/75 (44%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = +3 Query: 255 PSWPP-PPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPL 431 PS PP PPPP+PPP P PPP PP+ PP P PPP+ P R + R RP Sbjct: 476 PSAPPSPPPPSPPPPRP---PPPSPVPPTPPPSPR-PPPSPRPPNPPPRPPSPRPPPRPP 531 Query: 432 RRSARGGGPPAGPEP 476 R + PP P P Sbjct: 532 PRPSSPRPPPPDPSP 546 [32][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 63.5 bits (153), Expect = 7e-09 Identities = 37/85 (43%), Positives = 40/85 (47%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P P SP P PPPP+PPP SP PPP Sbjct: 494 PSPPPPPPPSPPPPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPSP---PPP 540 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTC 395 PP PPPP PPP+ PC C Sbjct: 541 ---PPPSPPPPSPPPPSPPPPCQVC 562 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/81 (44%), Positives = 37/81 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 194 PPSPPPPSPPPPSPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPSPPPPPPP 243 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPP PPP P Sbjct: 244 SPPPPSPPPPSPPPPPPPSPP 264 Score = 62.4 bits (150), Expect = 2e-08 Identities = 38/81 (46%), Positives = 41/81 (50%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P + P PS PPPPPP+PPP SP PPP Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPP------PPPPPSPPPPPPPSPPPPSP---PPP 406 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 407 SPPPPS-PPPPSPPPPSPPPP 426 Score = 62.4 bits (150), Expect = 2e-08 Identities = 35/81 (43%), Positives = 37/81 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P PS PPPPPP+PPP P PPP Sbjct: 405 PPSPPPPSPPPPSPPPPSPPPPSPP---------PPPPPSPPPPPPPSPPPPPPPSPPPP 455 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 P PPPP PPP+ P Sbjct: 456 PPPSPPPPPPPSPPPPSPPPP 476 Score = 62.4 bits (150), Expect = 2e-08 Identities = 38/81 (46%), Positives = 41/81 (50%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P + P PS PPPPPP+PPP SP PPP Sbjct: 470 PPSPPPPSPPPPSPPPPSPPPPPPPSPP------PPPPPSPPPPPPPSPPPPSP---PPP 520 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP+ P Sbjct: 521 SPPPPS-PPPPSPPPPSPPPP 540 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/82 (43%), Positives = 38/82 (46%), Gaps = 1/82 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS P P P PS PPPPPP+PPP P PPP Sbjct: 253 PSPPPPPPPSPPPPSPPPPSPP------------PPPPPSPPPPPPPSPPPPPPPSPPPP 300 Query: 321 RQKPPS-HPPPPHSPPPTRHRP 383 PPS PPPP SPPP P Sbjct: 301 SPPPPSPPPPPPPSPPPPSPPP 322 Score = 61.6 bits (148), Expect = 3e-08 Identities = 37/82 (45%), Positives = 38/82 (46%), Gaps = 1/82 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP P PPP Sbjct: 199 PPSPPPPSPPPPSPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPPPPSPPPP 248 Query: 321 RQKPPS-HPPPPHSPPPTRHRP 383 PPS PPPP SPPP P Sbjct: 249 SPPPPSPPPPPPPSPPPPSPPP 270 Score = 61.2 bits (147), Expect = 4e-08 Identities = 36/77 (46%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP P PPP Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPP------------PPPSPPPPSPPPPSPPPPPPPSPPPP 266 Query: 321 RQKPPS-HPPPPHSPPP 368 PPS PPPP SPPP Sbjct: 267 SPPPPSPPPPPPPSPPP 283 Score = 61.2 bits (147), Expect = 4e-08 Identities = 34/81 (41%), Positives = 34/81 (41%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P P PP PPP PPP P PPP Sbjct: 312 PPSPPPPSPPPPSPPPPSPPPPPP----------PSPPPPPPPSPPPPPPPSPPPPSPPP 361 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP P Sbjct: 362 PSPPPPSPPPPSPPPPPPPSP 382 Score = 60.8 bits (146), Expect = 5e-08 Identities = 36/77 (46%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P PS PPPPPP+PPP SP PPP Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPP------------PSPPPPPPPSPPPPSP---PPP 323 Query: 321 RQKPPS-HPPPPHSPPP 368 PPS PPPP SPPP Sbjct: 324 SPPPPSPPPPPPPSPPP 340 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/81 (41%), Positives = 36/81 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P P SP P PPPP+PPP P PPP Sbjct: 271 PSPPPPPPPSPPPPPPPSPPPP------------PPPSPPPPSPPPPSPPPPPPPSPPPP 318 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPP PPP P Sbjct: 319 SPPPPSPPPPSPPPPPPPSPP 339 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/81 (40%), Positives = 34/81 (41%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P P P PP PPP PPP P PPP Sbjct: 426 PSPPPPPPPSPPPPPPPSPPPPPP----------PSPPPPPPPSPPPPPPPSPPPPSPPP 475 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP P Sbjct: 476 PSPPPPSPPPPSPPPPPPPSP 496 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/77 (46%), Positives = 39/77 (50%), Gaps = 1/77 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P + P SP P PPPP+PPP SP PPP Sbjct: 372 PSPPPPPPPSPPPPPPPSPPPPPPPSP-------PPPSPPPPSPPPPSPPPPSP---PPP 421 Query: 321 RQKPPS-HPPPPHSPPP 368 PPS PPPP SPPP Sbjct: 422 SPPPPSPPPPPPPSPPP 438 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/77 (45%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P P SP P PPPP+PPP SP PP Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPP------------PPPSPPPPSPPPPSPPPPSPPPPSPP 375 Query: 321 RQKPPS-HPPPPHSPPP 368 PPS PPPP SPPP Sbjct: 376 PPPPPSPPPPPPPSPPP 392 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/77 (45%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P P SP P PPPP+PPP SP PP Sbjct: 442 PSPPPPPPPSPPPPPPPSPPPP------------PPPSPPPPSPPPPSPPPPSPPPPSPP 489 Query: 321 RQKPPS-HPPPPHSPPP 368 PPS PPPP SPPP Sbjct: 490 PPPPPSPPPPPPPSPPP 506 Score = 57.0 bits (136), Expect = 7e-07 Identities = 37/80 (46%), Positives = 39/80 (48%), Gaps = 4/80 (5%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP---PPAPPPQSPLLL 311 P+ PPP PS SP P P SP PPPP PP+PPP SP Sbjct: 434 PSPPPPPPPSPPPPPPPSPPPP------------PPPSPPPPPPPSPPPPSPPPPSP--- 478 Query: 312 PPPRQKPPS-HPPPPHSPPP 368 PPP PPS PPPP SPPP Sbjct: 479 PPPSPPPPSPPPPPPPSPPP 498 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/47 (55%), Positives = 29/47 (61%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P +P P PPPP+PPP SP PPP PPS PPPP PPP+ P Sbjct: 183 PISTPGIPSPPPPSPPPPSP---PPPSPPPPS-PPPPSPPPPSPPPP 225 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 SP P PPPP+PPP SP PPP PPS PPPP PPP+ P Sbjct: 191 SPPPPSPPPPSPPPPSP---PPPSPPPPS-PPPPSPPPPSPPPP 230 Score = 53.5 bits (127), Expect = 8e-06 Identities = 31/81 (38%), Positives = 33/81 (40%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P P P PPPP P PP P PPP Sbjct: 380 PSPPPPPPPSPPPPPPPSPPP-------------PSPPPPSPPPPSPPPPSPPPPSPPPP 426 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP P PP PPP+ P Sbjct: 427 SPPPPPPPSPPPPPPPSPPPP 447 [33][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 63.5 bits (153), Expect = 7e-09 Identities = 35/75 (46%), Positives = 35/75 (46%), Gaps = 2/75 (2%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSA 443 PPPPPP PPP P PPP PP PPPP PPP P R T PLRR Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAFPPAPLRRDT 62 Query: 444 RGGGP--PAGPEPLS 482 GP P PLS Sbjct: 63 ASTGPSQETYPAPLS 77 [34][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 58.9 bits (141), Expect(2) = 8e-09 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PPP P PPP PP PPPP PPP RP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 Score = 24.6 bits (52), Expect(2) = 8e-09 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 139 VPPPPPLPTLPTSPAVP 189 +PPPPP P P P P Sbjct: 2 LPPPPPPPPPPPPPPPP 18 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 4 PPPPPPPPPPPPPPPP 19 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 5 PPPPPPPPPPPPPPPP 20 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 6 PPPPPPPPPPPPPPPP 21 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 7 PPPPPPPPPPPPPPPP 22 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 8 PPPPPPPPPPPPPPPP 23 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +3 Query: 258 SWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 S PPPPPP PPP P PPP PP PPPP PPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [35][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 56.2 bits (134), Expect(2) = 9e-09 Identities = 32/80 (40%), Positives = 37/80 (46%), Gaps = 2/80 (2%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLR 434 P PPPPPP PPP P PPP PP PPPP PPP P PL Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPL-------------PLP 294 Query: 435 RSARGGGPPAGPEP--LSST 488 ++ PP+ +P LS+T Sbjct: 295 TTSATVAPPSTSQPTQLSTT 314 Score = 26.9 bits (58), Expect(2) = 9e-09 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 109 LVAHPCRYAGVPPPPPLPTLPTSPAVP 189 +V P + VPPPPP P P P P Sbjct: 223 VVVPPPQVQVVPPPPPPPPPPPPPPPP 249 Score = 55.8 bits (133), Expect(2) = 7e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 24.3 bits (51), Expect(2) = 7e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 235 PPPPPPPPPPPPPPPP 250 Score = 52.4 bits (124), Expect(2) = 8e-07 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPP PPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 24.3 bits (51), Expect(2) = 8e-07 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 236 PPPPPPPPPPPPPPPP 251 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 [36][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 63.2 bits (152), Expect = 1e-08 Identities = 47/123 (38%), Positives = 51/123 (41%), Gaps = 3/123 (2%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQ 296 S P R P S PPP PS + P P+ P PS PPPP P PPP Sbjct: 514 SPRPPRPSPPSPPPP-PSPPPPPSPPPPPS------------PPPPPSPPPPPSPPPPPS 560 Query: 297 SPLLLPPPRQKPPSHPPPPHSPPP---TRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAG 467 P PPP PP PPPP SPPP RH P R R R + PP+ Sbjct: 561 PP---PPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQ------------PPSP 605 Query: 468 PEP 476 P P Sbjct: 606 PSP 608 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/81 (44%), Positives = 36/81 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P S SP P R P PS PPPP P PPP P PPP Sbjct: 497 PFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPP---PPP 553 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP SPPP P Sbjct: 554 SPPPPPSPPPPPSPPPPPSPP 574 [37][TOP] >UniRef100_Q5VR02 Hydroxyproline-rich glycoprotein-like n=1 Tax=Oryza sativa Japonica Group RepID=Q5VR02_ORYSJ Length = 1026 Score = 63.2 bits (152), Expect = 1e-08 Identities = 37/88 (42%), Positives = 41/88 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PP P S A P P P SP PPPPPPAP P +P L PPP Sbjct: 518 PSPPAPPSPPAPSPPAPPPPP-------------PALSPPAPPPPPPAPSPPAP-LPPPP 563 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 PP+ PPPP PPP P T R+ Sbjct: 564 APSPPAPPPPPPPPPPCPPAPPKTRSRQ 591 [38][TOP] >UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9RZI2_RICCO Length = 829 Score = 63.2 bits (152), Expect = 1e-08 Identities = 43/121 (35%), Positives = 50/121 (41%), Gaps = 6/121 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSS---GALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLL 311 P SPPP S G P PT++ + P +SP P PPPP P P+ Sbjct: 629 PGQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVNSPPPPVYSPPPPSPPPPVHSPPPPVYS 688 Query: 312 PPPRQKPP---SHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPP PP S PPP HSPPP H P P S PP+ P P+ Sbjct: 689 PPPPSPPPPVHSPPPPVHSPPPPVHSP-------------PPPVYSPPPPSPPSPPPPMH 735 Query: 483 S 485 S Sbjct: 736 S 736 Score = 56.2 bits (134), Expect = 1e-06 Identities = 37/91 (40%), Positives = 40/91 (43%), Gaps = 5/91 (5%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P+ P SPPP P H P P + P +SP P PP P PP SP Sbjct: 685 PVYSPPPPSPPP-PVHSP-----PPPVHSPPPPVHSPPPPVYSPPPPSPPSPPPPMHSP- 737 Query: 306 LLPPPRQKPP-----SHPPPPHSPPPTRHRP 383 PPP PP S PPP HSPPP H P Sbjct: 738 --PPPVYSPPPPPVRSPPPPVHSPPPPVHSP 766 [39][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 63.2 bits (152), Expect = 1e-08 Identities = 34/81 (41%), Positives = 38/81 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+S PPP P SP P + + PS PPPPPP+PPP P PPP Sbjct: 14 PSSPPPPPPPSPPPPPPSPPPPPPPSPPSPL------PPSPPPPPPPSPPPPPPSQPPPP 67 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP P Sbjct: 68 PSSPPPPPPPPSPPPPPPPSP 88 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/81 (43%), Positives = 36/81 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP PS LSP P P P PPP PP PPP P LPPP Sbjct: 125 PLSPPPPPPSPPPPPLLSPPPP------------PPSPPPPPPPSPPPPPPSPPPPLPPP 172 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP P PPH PP+ P Sbjct: 173 SPLPPPPPSPPHPLPPSPPPP 193 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/81 (40%), Positives = 34/81 (41%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P L P P P P PPPPPP+ PP P PPP Sbjct: 28 PPPSPPPPPPPSPPSPLPPSP-------------PPPPPPSPPPPPPSQPPPPPSSPPPP 74 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 P PPPP SPPP P Sbjct: 75 PPPPSPPPPPPPSPPPPLPSP 95 Score = 59.7 bits (143), Expect = 1e-07 Identities = 36/81 (44%), Positives = 38/81 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S P P+ S P P PPPPPP+PPP PLL PPP Sbjct: 91 PLPSPPPPPPLPSPPPPPPLPSSPPPPPPS----PPPPPLSPPPPPPSPPPP-PLLSPPP 145 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 P PPPP PPP P Sbjct: 146 PPPSPPPPPPPSPPPPPPSPP 166 Score = 59.3 bits (142), Expect = 1e-07 Identities = 36/84 (42%), Positives = 38/84 (45%), Gaps = 3/84 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP---PPAPPPQSPLLL 311 P PPP P H + P P + P PS PPPP PPAP P SP L Sbjct: 174 PLPPPPPSPPHPLPPSPPPPPPPSPP--------PPPPPSPPPPPLPSPPAPSPPSPPLP 225 Query: 312 PPPRQKPPSHPPPPHSPPPTRHRP 383 PPP P PPPP SPPP P Sbjct: 226 PPPPPPPSPPPPPPPSPPPPSPPP 249 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/78 (43%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP--APPPQSPLLLP 314 P+ PPP PS S SP P + P PS PPPPPP +PPP P P Sbjct: 30 PSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPP 89 Query: 315 PPRQKPPSHPPPPHSPPP 368 PP PP PP P PPP Sbjct: 90 PPLPSPPPPPPLPSPPPP 107 Score = 57.8 bits (138), Expect = 4e-07 Identities = 37/89 (41%), Positives = 38/89 (42%), Gaps = 8/89 (8%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP- 317 P S PPP PS SP P P P PPPP P+PPP PL PP Sbjct: 53 PPSPPPPPPSQPPPPPSSPPPPPPPPSP------PPPPPPSPPPPLPSPPPPPPLPSPPP 106 Query: 318 -------PRQKPPSHPPPPHSPPPTRHRP 383 P PPS PPPP SPPP P Sbjct: 107 PPPLPSSPPPPPPSPPPPPLSPPPPPPSP 135 Score = 57.4 bits (137), Expect = 5e-07 Identities = 33/73 (45%), Positives = 35/73 (47%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P + P SP PP PPP PPP SP PPP Sbjct: 188 PSPPPPPPPSPPPPPPPSPPPPPLPSP-------PAPSPPSPPLPPPPPPPPSPPPPPPP 240 Query: 321 RQKPPSHPPPPHS 359 PPS PPPP S Sbjct: 241 SPPPPSPPPPPPS 253 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPS------HPPPPHSPPP 368 P SP PPPP P PPP SP PPP PPS PPPP SPPP Sbjct: 13 PPSSPPPPPPPSPPPPPPSP--PPPPPPSPPSPLPPSPPPPPPPSPPP 58 Score = 23.9 bits (50), Expect(2) = 1e-06 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 P PPP P P+SP P Sbjct: 5 PSPPPPPPPPSSPPPP 20 Score = 51.6 bits (122), Expect(2) = 3e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 SP PPPPP +PPP P PPP PP PPPP SPP Sbjct: 6 SPPPPPPPPSSPPPPPPPSPPPPPPSPP--PPPPPSPP 41 Score = 23.1 bits (48), Expect(2) = 3e-06 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 142 PPPPPLPTLPTSP 180 PPPPP P P P Sbjct: 1 PPPPPSPPPPPPP 13 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 267 PPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 PPPPP+PPP P PP PPS PPPP SPPP Sbjct: 1 PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPP 34 [40][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 58.9 bits (141), Expect(2) = 1e-08 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHR 380 P PPPPPP PPP P PPP PP PPPP PPP R R Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRAR 62 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 9 PPPPPPPPPPPPPPPP 24 Score = 57.8 bits (138), Expect(2) = 2e-08 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTR 374 P PPPPPP PPP P PPP PP PPPP PPP R Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 10 PPPPPPPPPPPPPPPP 25 Score = 57.0 bits (136), Expect(2) = 4e-08 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHR 380 P PPPPPP PPP P PPP PP PPPP PPP R Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 Score = 24.3 bits (51), Expect(2) = 4e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 11 PPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 +P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 8 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.6 bits (135), Expect = 9e-07 Identities = 26/49 (53%), Positives = 26/49 (53%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRR 401 P PPPPPP PPP P PPP PP PPPP PPP P RR Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 [41][TOP] >UniRef100_UPI000186A01D hypothetical protein BRAFLDRAFT_106142 n=1 Tax=Branchiostoma floridae RepID=UPI000186A01D Length = 550 Score = 55.8 bits (133), Expect(2) = 1e-08 Identities = 23/39 (58%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSP---LLLPPPRQKPPSHPPPPHSP 362 P +PPPPPP PPP P L PPP Q P +PPPPH P Sbjct: 112 PPYPPPPPPPPPPPPPPPNSLPPPPPQSKPPYPPPPHPP 150 Score = 26.9 bits (58), Expect(2) = 1e-08 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 121 PCRYAGVPPPPPLPTLPTSPAVP 189 P A P PPPLPT P P P Sbjct: 96 PPPLANPPSPPPLPTPPPYPPPP 118 [42][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 61.2 bits (147), Expect(2) = 1e-08 Identities = 32/69 (46%), Positives = 33/69 (47%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSA 443 PPPPPP PPP P PPP PPS PPPP PPP + R T Q PL R Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAWT-------QEPSPLDRDP 117 Query: 444 RGGGPPAGP 470 G GP Sbjct: 118 LGYDVGHGP 126 Score = 21.6 bits (44), Expect(2) = 1e-08 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 148 PPPLPTLPTSPAVP 189 PPPLP P P P Sbjct: 59 PPPLPPPPPPPPPP 72 [43][TOP] >UniRef100_UPI0001982E1E PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982E1E Length = 664 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/83 (42%), Positives = 40/83 (48%), Gaps = 2/83 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P++SPPP PS SS + SP P PS PPPP +PPP S PPP Sbjct: 13 PSASPPPPPSPDSSSSASPPP-----------------PSSPPPPDSSPPPPSSSSPPPP 55 Query: 321 RQKPPSH--PPPPHSPPPTRHRP 383 PP PPPP +PPP P Sbjct: 56 LASPPPSPPPPPPGAPPPKNSSP 78 Score = 56.6 bits (135), Expect = 9e-07 Identities = 33/86 (38%), Positives = 39/86 (45%), Gaps = 7/86 (8%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P +S PP P S P P++ +G P SP PPPP PPP S + PPP Sbjct: 73 PKNSSPPPPPQNSKSPPPPPPSKNTSG-------PATSPPPPPPPSSPPPPSSNFVPPPP 125 Query: 321 RQK--PP-----SHPPPPHSPPPTRH 377 R PP PPPPH P+ H Sbjct: 126 RSSLSPPHAATRKSPPPPHKSWPSNH 151 [44][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 62.8 bits (151), Expect = 1e-08 Identities = 34/76 (44%), Positives = 35/76 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP PS SP P PS PPPPPP+PPP P PPP Sbjct: 142 PPPSPPPPPSPPPPPPPSPPPP----------------PSPPPPPPPSPPPPPPPPPPPP 185 Query: 321 RQKPPSHPPPPHSPPP 368 PP PPPP PPP Sbjct: 186 PPPPPPPPPPPPPPPP 201 Score = 57.4 bits (137), Expect = 5e-07 Identities = 33/79 (41%), Positives = 35/79 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP PS SP P + P SP PPPP P PPP P PPP Sbjct: 128 PECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPP 187 Query: 321 RQKPPSHPPPPHSPPPTRH 377 PP PPPP PP R+ Sbjct: 188 PPPPPPPPPPPPPPPVDRN 206 Score = 53.9 bits (128), Expect = 6e-06 Identities = 31/78 (39%), Positives = 32/78 (41%) Frame = +3 Query: 150 SPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQK 329 SPPP + G P P P P PP PPP PPP P PP Sbjct: 112 SPPP---EYEEGCPPPPPE------------PECPPPPPPSPPPPPPPSPPPPPSPPPPP 156 Query: 330 PPSHPPPPHSPPPTRHRP 383 PPS PPPP PPP P Sbjct: 157 PPSPPPPPSPPPPPPPSP 174 [45][TOP] >UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA Length = 464 Score = 62.8 bits (151), Expect = 1e-08 Identities = 42/112 (37%), Positives = 45/112 (40%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP PS SP P R+ P SP PPPPP A PP P PPP Sbjct: 338 PPSPPPPRPSP------SPPPPRSSPSPPP----PVVSP--PPPPPRASPPPPPASSPPP 385 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 +PP PPP PPP P +R GGPP G P Sbjct: 386 PPRPPPPSPPPSPPPPATAA----------ANPPSPAPSRSRAGGPPLGTRP 427 Score = 61.2 bits (147), Expect = 4e-08 Identities = 35/76 (46%), Positives = 38/76 (50%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SSPPP P S SP P R+ SP P PPPP+PPP P PPP Sbjct: 306 PVSSPPPPPPPRPSP--SPPPPRSSP-----------SPPPPSPPPPSPPPPRPSPSPPP 352 Query: 321 RQKPPSHPPPPHSPPP 368 + PS PPP SPPP Sbjct: 353 PRSSPSPPPPVVSPPP 368 Score = 53.5 bits (127), Expect = 8e-06 Identities = 38/91 (41%), Positives = 40/91 (43%), Gaps = 10/91 (10%) Frame = +3 Query: 141 PTSSPPPYPSHFSSG---ALSP*PTRAGAG*ASRRRWPCWSPSWPPP-----PPPAPPPQ 296 P +SPPP P S SP P P SPS PPP PPP PPP+ Sbjct: 268 PKTSPPPPPRVPPSPPPPVASPPPPPP----------PRVSPSPPPPQPVSSPPPPPPPR 317 Query: 297 SPLLLPPPRQKPPSHPP--PPHSPPPTRHRP 383 PPPR P PP PP SPPP R P Sbjct: 318 PSPSPPPPRSSPSPPPPSPPPPSPPPPRPSP 348 [46][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/77 (45%), Positives = 36/77 (46%) Frame = +3 Query: 138 CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP 317 CPTS YP SP P + P PS PPPPPP PPP P PP Sbjct: 196 CPTSRASKYPPPPPPPPPSPSPPPS----------PPPPPSPPPPPPPPPPPSPP---PP 242 Query: 318 PRQKPPSHPPPPHSPPP 368 P PP PPPP SPPP Sbjct: 243 PPPPPPPSPPPPPSPPP 259 Score = 55.5 bits (132), Expect(2) = 2e-08 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P SP PPPPP+PPP P PPP PP PPPP SPPP P Sbjct: 213 PSPSPPPSPPPPPSPPPPPP-PPPPPSPPPPPPPPPPPSPPPPPSPP 258 Score = 26.6 bits (57), Expect(2) = 2e-08 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 12/59 (20%) Frame = +1 Query: 49 RGGQA--------AAPGRRAVPC*RGVNLVAHPC----RYAGVPPPPPLPTLPTSPAVP 189 RGGQ ++PG A C + A C R + PPPPP P P SP+ P Sbjct: 162 RGGQGCTTLEQLCSSPGFSAGTCTAAMYDTACDCCPTSRASKYPPPPPPP--PPSPSPP 218 [47][TOP] >UniRef100_C5G899 Predicted protein n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5G899_AJEDR Length = 269 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/87 (40%), Positives = 41/87 (47%), Gaps = 6/87 (6%) Frame = +3 Query: 144 TSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPR 323 TSSPP P+ ++ A P P A P PPPPP PPP P +PPP Sbjct: 97 TSSPPSPPAPITTKAPEPPPPPPPA-----------IPPPPPPPPAIPPPPPPPAVPPPS 145 Query: 324 QKPPSHPPPPHSPPP------TRHRPC 386 PP+ PPPP + PP T H PC Sbjct: 146 PPPPATPPPPPTFPPPPGGICTEHSPC 172 [48][TOP] >UniRef100_B6HQ39 Pc22g23920 protein n=1 Tax=Penicillium chrysogenum Wisconsin 54-1255 RepID=B6HQ39_PENCW Length = 662 Score = 62.8 bits (151), Expect = 1e-08 Identities = 44/114 (38%), Positives = 48/114 (42%), Gaps = 2/114 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP--APPPQSPLLLP 314 P + PPP P G +SP P A P +SPS PPPPPP A P P P Sbjct: 467 PAAPPPPPPR----GPVSPPPAPPSA--------PTYSPSVPPPPPPPGAAAPGGPPPPP 514 Query: 315 PPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PP + PS PPPP P P P G P A GGG P P P Sbjct: 515 PPGRGGPSIPPPPPPPAPASRAPGG--------PPPPPPPPGAPGGGAPPPPPP 560 [49][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 62.4 bits (150), Expect = 2e-08 Identities = 32/77 (41%), Positives = 35/77 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S P P+ PS PPP PP+PPP P PPP Sbjct: 55 PPSPPPPLPPPSPSPPSPPPPSPP-------------PPSPPPPSPPSPPPSPPPPSPPP 101 Query: 321 RQKPPSHPPPPHSPPPT 371 PP PPPP PPP+ Sbjct: 102 PSPPPPSPPPPSPPPPS 118 Score = 62.4 bits (150), Expect = 2e-08 Identities = 38/112 (33%), Positives = 47/112 (41%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP+ S+ P P+ + + +S P + P PPPP+PPP SP PPP Sbjct: 163 PPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPP 222 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PP PP P+ PP P P RS R PP P P Sbjct: 223 PPPPPPSPPSPNPPPSASPSP--------------PFGRSLRSPPPPPPPPP 260 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/77 (45%), Positives = 38/77 (49%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S + P P P SP P PPPP+PPP SP PPP Sbjct: 74 PPSPPPPSPPPPSPPSPPPSPPPPSP--------PPPSPPPPSPPPPSPPPPSPPPSPPP 125 Query: 321 RQKPPSHPPPPHSPPPT 371 PPS PPPP PPP+ Sbjct: 126 SPSPPS-PPPPSPPPPS 141 Score = 60.1 bits (144), Expect = 8e-08 Identities = 36/83 (43%), Positives = 38/83 (45%), Gaps = 2/83 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP--PPPAPPPQSPLLLP 314 P S PPP P S SP P P PPP PPP+PPP P LP Sbjct: 19 PPSPPPPSPPPPSPPPPSPPPL---------------PPPLPPPSPPPPSPPPSPPPPLP 63 Query: 315 PPRQKPPSHPPPPHSPPPTRHRP 383 PP PPS PPPP PPP+ P Sbjct: 64 PPSPSPPS-PPPPSPPPPSPPPP 85 Score = 55.1 bits (131), Expect = 3e-06 Identities = 35/86 (40%), Positives = 39/86 (45%), Gaps = 5/86 (5%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP--PPPAPPPQSPLL-- 308 P S PPP P L P P+ + PS PPP PPP+PPP SP Sbjct: 46 PPSPPPPSPPPSPPPPLPP-PSPS-------------PPSPPPPSPPPPSPPPPSPPSPP 91 Query: 309 -LPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP PP PPPP PPP+ P Sbjct: 92 PSPPPPSPPPPSPPPPSPPPPSPPPP 117 Score = 53.9 bits (128), Expect = 6e-06 Identities = 35/84 (41%), Positives = 36/84 (42%), Gaps = 3/84 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP PS S SP P S P P PPPP PPP P PPP Sbjct: 59 PPPLPPPSPSPPSPPPPSPPPPSPPP--PSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 116 Query: 321 RQKPPSHPP---PPHSPPPTRHRP 383 PPS PP PP PPP+ P Sbjct: 117 PSPPPSPPPSPSPPSPPPPSPPPP 140 Score = 53.9 bits (128), Expect = 6e-06 Identities = 37/94 (39%), Positives = 39/94 (41%), Gaps = 13/94 (13%) Frame = +3 Query: 150 SPPP---YPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 SPPP PS SS + +P P A P SP PPPPPP PPP P PPP Sbjct: 179 SPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPP-SPPPPPPPPPPPPPSPPSPNPPP 237 Query: 321 RQKP----------PSHPPPPHSPPPTRHRPCGT 392 P P PPPP PP C T Sbjct: 238 SASPSPPFGRSLRSPPPPPPPPPPPGLPSEICAT 271 [50][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 62.4 bits (150), Expect = 2e-08 Identities = 37/91 (40%), Positives = 44/91 (48%), Gaps = 4/91 (4%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 LPL P+ PP P L P P+ + S P SP P PPPPAPPP +P Sbjct: 1005 LPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAP 1064 Query: 303 LLLPPPRQKPPSHPPP----PHSPPPTRHRP 383 PPP PP+ PPP P+ PPP+ P Sbjct: 1065 PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPP 1095 Score = 62.4 bits (150), Expect = 2e-08 Identities = 37/91 (40%), Positives = 44/91 (48%), Gaps = 4/91 (4%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 LPL P+ PP P L P P+ + S P SP P PPPPAPPP +P Sbjct: 1096 LPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAP 1155 Query: 303 LLLPPPRQKPPSHPPP----PHSPPPTRHRP 383 PPP PP+ PPP P+ PPP+ P Sbjct: 1156 PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPP 1186 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/76 (42%), Positives = 34/76 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P L P P P PS PP PPP+PPP P PPP Sbjct: 938 PPVPPPPSPPPLPPPPLPPPPLPPP---------PSPPPSPPPSPPPSPPPSPPPPTPPP 988 Query: 321 RQKPPSHPPPPHSPPP 368 PP +PPPP PPP Sbjct: 989 PAPPPPNPPPPSPPPP 1004 Score = 61.2 bits (147), Expect = 4e-08 Identities = 35/77 (45%), Positives = 38/77 (49%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S P P + P PS PP PPP+PPP PL LPPP Sbjct: 1553 PPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPP--PLPLPPP 1610 Query: 321 RQKPPSHPPPPHSPPPT 371 PP PPPP PPP+ Sbjct: 1611 PSPPPPLPPPPVPPPPS 1627 Score = 60.5 bits (145), Expect = 6e-08 Identities = 37/83 (44%), Positives = 39/83 (46%), Gaps = 2/83 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPP--PPPPAPPPQSPLLLP 314 P+ SP P P FS SP P P SPS PP PPP PPP P LP Sbjct: 344 PSLSPSPPPPSFSP---SPPP-------------PSLSPSPPPATPPPSPPPPSPPPPLP 387 Query: 315 PPRQKPPSHPPPPHSPPPTRHRP 383 PP PP PPPP PPP+ P Sbjct: 388 PPPSPPPPLPPPPIPPPPSPPPP 410 Score = 60.1 bits (144), Expect = 8e-08 Identities = 35/81 (43%), Positives = 38/81 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P L P P + S P SP P PPPPAPPP +P PPP Sbjct: 707 PPSPPPPLPPP----PLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPP 762 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 P P PP SPPP+ P Sbjct: 763 SPPPSPPPSPPPSPPPSPPPP 783 Score = 60.1 bits (144), Expect = 8e-08 Identities = 35/83 (42%), Positives = 38/83 (45%), Gaps = 2/83 (2%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP--PPAPPPQS 299 PL P+ P P PS S SP P P P PPPP PP+PPP Sbjct: 848 PLPPPPSPPPSPPPSPPPSPPPSPPP-------------PTPPPPAPPPPAPPPSPPPSP 894 Query: 300 PLLLPPPRQKPPSHPPPPHSPPP 368 P PPP PP +PPPP PPP Sbjct: 895 PPPTPPPPAPPPPNPPPPSPPPP 917 Score = 60.1 bits (144), Expect = 8e-08 Identities = 34/81 (41%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P SP P+ + S P SPS PPPP PPP PL PP Sbjct: 1624 PPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPL 1683 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP++P P+ P Sbjct: 1684 PAPPPPSPPPPNAPSPSSMPP 1704 Score = 59.7 bits (143), Expect = 1e-07 Identities = 37/85 (43%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 +P P SPPP P SP P+ + P SP P PPPP PPP SP Sbjct: 1575 VPPSPLPPPSPPPSPPP------SPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSP 1628 Query: 303 LLLPPPRQKPPSHPP--PPHSPPPT 371 LPPP PP PP PP SPPP+ Sbjct: 1629 PPLPPPPLPPPPSPPPSPPPSPPPS 1653 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/82 (41%), Positives = 36/82 (43%), Gaps = 1/82 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP-PPAPPPQSPLLLPP 317 P SPPP P + +P P P P PPPP PP P P PL LPP Sbjct: 863 PPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP 922 Query: 318 PRQKPPSHPPPPHSPPPTRHRP 383 P PP PPPP PPP P Sbjct: 923 PPSPPPPLPPPPLPPPPVPPPP 944 Score = 59.3 bits (142), Expect = 1e-07 Identities = 36/81 (44%), Positives = 39/81 (48%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 PL P+ P P PS S SP P P +P P PPPP+PPP PL Sbjct: 958 PLPPPPSPPPSPPPSPPPSPPPSPPPPTP----------PPPAPPPPNPPPPSPPP--PL 1005 Query: 306 LLPPPRQKPPSHPPPPHSPPP 368 LPPP PP PPPP PPP Sbjct: 1006 PLPPPPSPPPPLPPPPLPPPP 1026 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/77 (42%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP-PPAPPPQSPLLLPP 317 P SPPP P + +P P P P PPPP PP P P PL LPP Sbjct: 772 PPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP 831 Query: 318 PRQKPPSHPPPPHSPPP 368 P PP PPPP PPP Sbjct: 832 PPSPPPPLPPPPLPPPP 848 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/81 (40%), Positives = 35/81 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P S L P P P P PPP PP PP SP PPP Sbjct: 933 PPLPPPPVPPPPSPPPLPPPPLPPP---------PLPPPPSPPPSPPPSPPPSPPPSPPP 983 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPPP+ PPP+ P Sbjct: 984 PTPPPPAPPPPNPPPPSPPPP 1004 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/77 (42%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP-PPAPPPQSPLLLPP 317 P SPPP P + +P P P P PPPP PP P P PL LPP Sbjct: 1041 PPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP 1100 Query: 318 PRQKPPSHPPPPHSPPP 368 P PP PPPP PPP Sbjct: 1101 PPSPPPPLPPPPLPPPP 1117 Score = 58.5 bits (140), Expect = 2e-07 Identities = 35/85 (41%), Positives = 40/85 (47%), Gaps = 4/85 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P P P PS S SP P+ P SP P PPPPAPPP +P PPP Sbjct: 754 PAPPPAPPPSPPPSPPPSPPPS------------PPPSPPPPTPPPPAPPPPTPPPSPPP 801 Query: 321 RQKPPSHPPP----PHSPPPTRHRP 383 PP+ PPP P+ PPP+ P Sbjct: 802 SPPPPTPPPPAPPPPNPPPPSPPPP 826 Score = 58.5 bits (140), Expect = 2e-07 Identities = 39/92 (42%), Positives = 43/92 (46%), Gaps = 4/92 (4%) Frame = +3 Query: 120 SLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP---PPAPP 290 S PL P SPPP P+ S ++ P + P P PPPP PP PP Sbjct: 1680 SPPLPAPPPPSPPP-PNAPSPSSMPP---------SQSPPPPLPPPPLPPPPNPPPPLPP 1729 Query: 291 PQSPLLLPPPRQKPPSHPP-PPHSPPPTRHRP 383 P SP PPP PPS PP PP SPPP P Sbjct: 1730 PPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPP 1761 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/77 (44%), Positives = 37/77 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P + +P P P P P PPPP PPP SP LPPP Sbjct: 1160 PPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPP 1219 Query: 321 RQKPPSHPPPPHSPPPT 371 PP PPPP SPPP+ Sbjct: 1220 PLPPPPLPPPP-SPPPS 1235 Score = 58.2 bits (139), Expect = 3e-07 Identities = 35/78 (44%), Positives = 38/78 (48%), Gaps = 1/78 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P L P P+ P P P PPPP+PPP P LPPP Sbjct: 1598 PPSPPPPLP-------LPPPPSP-----------PPPLPPPPVPPPPSPPPLPPPPLPPP 1639 Query: 321 RQKPPSHPP-PPHSPPPT 371 PPS PP PP SPPP+ Sbjct: 1640 PSPPPSPPPSPPPSPPPS 1657 Score = 57.8 bits (138), Expect = 4e-07 Identities = 36/91 (39%), Positives = 39/91 (42%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P SP P+ P PS PP PPP+PPP +P PP Sbjct: 1214 PPLPPPPLPPPPLPPPPSPPPSPP----------PSPPPSPPPSPPPSPPPPTPPPPAPP 1263 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTCRRRT*R 413 PP PPPP PPP P TC R R Sbjct: 1264 PPTPPPSPPPPTPPPPPPLAPF-TCEDRASR 1293 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/77 (45%), Positives = 37/77 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P L P P+ P P P PPPP PPP SP LPPP Sbjct: 911 PPSPPPPLP-------LPPPPSP-----------PPPLPPPPLPPPPVPPPPSPPPLPPP 952 Query: 321 RQKPPSHPPPPHSPPPT 371 PP PPPP SPPP+ Sbjct: 953 PLPPPPLPPPP-SPPPS 968 Score = 57.0 bits (136), Expect = 7e-07 Identities = 35/89 (39%), Positives = 38/89 (42%), Gaps = 2/89 (2%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 LPL P+ PP P L P P+ PS PP PPP+PPP P Sbjct: 827 LPLPPPPSPPPPLPPPPLPPPPLPPPPSPP--------------PSPPPSPPPSPPPSPP 872 Query: 303 LLLPPPRQKPPSHPP--PPHSPPPTRHRP 383 PPP PP PP PP SPPP P Sbjct: 873 PPTPPPPAPPPPAPPPSPPPSPPPPTPPP 901 Score = 56.6 bits (135), Expect = 9e-07 Identities = 38/95 (40%), Positives = 38/95 (40%), Gaps = 8/95 (8%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP------- 281 LP P SPPP P S P PT P PS PPP PP Sbjct: 1118 LPPPPSPPPSPPPSPPP-SPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP 1176 Query: 282 -APPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP P LPPP PP PPPP PPP P Sbjct: 1177 NPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPP 1211 Score = 56.6 bits (135), Expect = 9e-07 Identities = 37/85 (43%), Positives = 43/85 (50%), Gaps = 2/85 (2%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP--PPAPPPQS 299 P + P SPPP PS + L P P+ + P P PPPP PP PPPQS Sbjct: 2156 PPQSPPLPSPPP-PSPPTPPPLPP-PSPS----------PLPPPPIPPPPSPPPHPPPQS 2203 Query: 300 PLLLPPPRQKPPSHPPPPHSPPPTR 374 PL PP PP PPP SPPP++ Sbjct: 2204 PLPPSPPPPPPPPPLPPPPSPPPSQ 2228 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/82 (43%), Positives = 38/82 (46%), Gaps = 1/82 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP PS P P+ P SP PPPP PPP P LPPP Sbjct: 682 PPSPPPPSPS--------PPPSP-----------PPPSPPPSPPPPSPPPPLPPPPLPPP 722 Query: 321 RQKPPSHPP-PPHSPPPTRHRP 383 PPS PP PP SPPP+ P Sbjct: 723 PLPPPSPPPSPPPSPPPSPPPP 744 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/88 (40%), Positives = 38/88 (43%) Frame = +3 Query: 120 SLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQS 299 SLP P+ PP P S L P P P PS PP PPP PP S Sbjct: 2096 SLP-SSSPSPPPPSPPLPPSPPPLPPPPVPPP---------PTPPPSPPPLPPPPTPPPS 2145 Query: 300 PLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P LPPP PP PP P PPP+ P Sbjct: 2146 PPPLPPPPTPPPQSPPLPSPPPPSPPTP 2173 Score = 55.5 bits (132), Expect = 2e-06 Identities = 36/86 (41%), Positives = 39/86 (45%), Gaps = 3/86 (3%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPP--Q 296 LP P SPPP P + P A P P P PPPP+PPP Sbjct: 959 LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 1018 Query: 297 SPLLLPPPRQKPPSHPP-PPHSPPPT 371 P L PPP PPS PP PP SPPP+ Sbjct: 1019 PPPLPPPPLPPPPSPPPSPPPSPPPS 1044 Score = 55.1 bits (131), Expect = 3e-06 Identities = 34/80 (42%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPP--QSPLLLP 314 P S PPP P + +P P P P P PPPP+PPP P L P Sbjct: 800 PPSPPPPTPPPPAPPPPNPPP-------------PSPPPPLPLPPPPSPPPPLPPPPLPP 846 Query: 315 PPRQKPPSHPP-PPHSPPPT 371 PP PPS PP PP SPPP+ Sbjct: 847 PPLPPPPSPPPSPPPSPPPS 866 Score = 55.1 bits (131), Expect = 3e-06 Identities = 34/80 (42%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPP--QSPLLLP 314 P S PPP P + +P P P P P PPPP+PPP P L P Sbjct: 1069 PPSPPPPTPPPPAPPPPNPPP-------------PSPPPPLPLPPPPSPPPPLPPPPLPP 1115 Query: 315 PPRQKPPSHPP-PPHSPPPT 371 PP PPS PP PP SPPP+ Sbjct: 1116 PPLPPPPSPPPSPPPSPPPS 1135 Score = 55.1 bits (131), Expect = 3e-06 Identities = 34/87 (39%), Positives = 40/87 (45%), Gaps = 1/87 (1%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPP-PQSP 302 PL P+ P P PS S SP P+ P P P PPPP+PP P P Sbjct: 1635 PLPPPPSPPPSPPPSPPPSPPPSPPPS------------PSPLPPPPTPPPPSPPLPSPP 1682 Query: 303 LLLPPPRQKPPSHPPPPHSPPPTRHRP 383 L PPP PP + P P S PP++ P Sbjct: 1683 LPAPPPPSPPPPNAPSPSSMPPSQSPP 1709 Score = 54.7 bits (130), Expect = 3e-06 Identities = 36/86 (41%), Positives = 36/86 (41%), Gaps = 3/86 (3%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 LP P SPPP P S P PT P P PPP PP PP SP Sbjct: 719 LPPPPLPPPSPPPSPPP-SPPPSPPPPTPPP---------PAPPPPAPPPAPPPSPPPSP 768 Query: 303 LLLPPPR---QKPPSHPPPPHSPPPT 371 PPP PP PPPP PPPT Sbjct: 769 PPSPPPSPPPSPPPPTPPPPAPPPPT 794 Score = 54.7 bits (130), Expect = 3e-06 Identities = 35/81 (43%), Positives = 36/81 (44%), Gaps = 4/81 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP---APPPQSPLLL 311 P S PPP P S P P P P PPPP P PPP P L Sbjct: 1180 PPSPPPPLPPPPSPPPPLPPP-------------PLPPPPVPPPPSPPPLPPPPLPPPPL 1226 Query: 312 PPPRQKPPSHPP-PPHSPPPT 371 PPP PPS PP PP SPPP+ Sbjct: 1227 PPPPSPPPSPPPSPPPSPPPS 1247 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/77 (41%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP PS P P+ P SP P PPPP+PPP + P P Sbjct: 1654 PPPSPPPSPSPLPPPPTPPPPSP-----------PLPSPPLPAPPPPSPPPPNA---PSP 1699 Query: 321 RQKPPSH-PPPPHSPPP 368 PPS PPPP PPP Sbjct: 1700 SSMPPSQSPPPPLPPPP 1716 Score = 54.7 bits (130), Expect = 3e-06 Identities = 35/78 (44%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPP-PPPPAPPPQSPLLLPP 317 P +PPP P L P PT PS PP PPPP PPPQSP L P Sbjct: 2125 PPPTPPPSPP-----PLPPPPTPP--------------PSPPPLPPPPTPPPQSPPLPSP 2165 Query: 318 PRQKPPSHPP-PPHSPPP 368 P PP+ PP PP SP P Sbjct: 2166 PPPSPPTPPPLPPPSPSP 2183 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P P PPPP P+PPP P PPP PPS PPPP PPP P Sbjct: 1534 PSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPS-PPPPLPPPPVPPSP 1579 Score = 53.9 bits (128), Expect = 6e-06 Identities = 36/89 (40%), Positives = 37/89 (41%), Gaps = 7/89 (7%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 LP P SPPP P + SP P P PP PPP PPP Sbjct: 2136 LPPPPTPPPSPPPLPPPPTPPPQSP-------------PLPSPPPPSPPTPPPLPPPSPS 2182 Query: 303 LLLPPPRQKPPS---HPPP----PHSPPP 368 L PPP PPS HPPP P SPPP Sbjct: 2183 PLPPPPIPPPPSPPPHPPPQSPLPPSPPP 2211 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P P PPPP P+PPP P PPP PPS PPPP PPP Sbjct: 678 PSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPS-PPPPLPPPP 718 Score = 53.5 bits (127), Expect = 8e-06 Identities = 34/78 (43%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLL-LPP 317 P SPPP P + +P P P P PPPP P PPP SP LPP Sbjct: 795 PPPSPPPSPPPPTPPPPAPPP-------------PNPPPPSPPPPLPLPPPPSPPPPLPP 841 Query: 318 PRQKPPSHPPPPHSPPPT 371 P PP PPPP SPPP+ Sbjct: 842 PPLPPPPLPPPP-SPPPS 858 Score = 53.5 bits (127), Expect = 8e-06 Identities = 34/78 (43%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLL-LPP 317 P SPPP P + +P P P P PPPP P PPP SP LPP Sbjct: 1064 PPPSPPPSPPPPTPPPPAPPP-------------PNPPPPSPPPPLPLPPPPSPPPPLPP 1110 Query: 318 PRQKPPSHPPPPHSPPPT 371 P PP PPPP SPPP+ Sbjct: 1111 PPLPPPPLPPPP-SPPPS 1127 [51][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPC 386 P PPPPPP PPP P PPP PP PPPP PPP RPC Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPC 67 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/82 (42%), Positives = 35/82 (42%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P P P R PC P PPPPPP PPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPR-----------PCPPP--PPPPPPPPPP------PPP 83 Query: 321 RQKPPSHPPPPHSPPPTRHRPC 386 PP PPPP PPP RPC Sbjct: 84 PPPPPPPPPPPPPPPPPPPRPC 105 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/83 (42%), Positives = 35/83 (42%), Gaps = 1/83 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P P P R P P PPPPPP PPP P PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPP---PPP 91 Query: 321 RQKPPSHPPPPH-SPPPTRHRPC 386 PP PPPP PPP RPC Sbjct: 92 PPPPPPPPPPPRPCPPPPPARPC 114 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTC 395 PPPPPP PPP P PPP PP PPPP PPP P C Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPC 67 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/88 (36%), Positives = 32/88 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P R CP PPP P P P PPPPPP PPP P Sbjct: 63 PPRPCPPPPPPPPP-------------------------PPPPPPPPPPPPPPPPPPPPP 97 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCG 389 PPPR PP P P PP CG Sbjct: 98 PPPPPRPCPPPPPARPCPPPCPPKHECG 125 [52][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 62.4 bits (150), Expect = 2e-08 Identities = 35/86 (40%), Positives = 38/86 (44%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 PL P+ PPP P P P P SP PPPPPP PPP P Sbjct: 80 PLPPSPSPPPPPPPPVPPPPPPPPPPP------------PPPSPPPPPPPPPPPPPSPPP 127 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP PP+ PPPP PPP+ P Sbjct: 128 PPPPPPPPPPNPPPPPPPPPPSPSPP 153 Score = 60.1 bits (144), Expect = 8e-08 Identities = 37/87 (42%), Positives = 40/87 (45%), Gaps = 6/87 (6%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPP------QSP 302 P PPP P+ S SP P R +P SP P PPPPAPPP P Sbjct: 204 PPPRPPPSPNPPSPRPPSPSPPSPRPP-PRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPP 262 Query: 303 LLLPPPRQKPPSHPPPPHSPPPTRHRP 383 LPPP PP PPPP PPP+ P Sbjct: 263 PPLPPPPSPPPPLPPPPSPPPPSPPPP 289 Score = 59.7 bits (143), Expect = 1e-07 Identities = 37/101 (36%), Positives = 42/101 (41%) Frame = +3 Query: 81 RCPLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPS 260 R P++ E + P P + PP P SG P P + P Sbjct: 28 RSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSP 87 Query: 261 WPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPPPPP PPP P PPP PPS PPPP PPP P Sbjct: 88 PPPPPPPVPPPPPP---PPPPPPPPSPPPPPPPPPPPPPSP 125 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/78 (41%), Positives = 37/78 (47%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P + P P + R P PS PP PPP+PPP+ P PP Sbjct: 156 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPP 215 Query: 321 RQKPPSHPPPPHSPPPTR 374 +PPS PP PPP R Sbjct: 216 SPRPPSPSPPSPRPPPRR 233 Score = 58.2 bits (139), Expect = 3e-07 Identities = 47/118 (39%), Positives = 54/118 (45%), Gaps = 8/118 (6%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP-----PPQSPL 305 P S PPP P S SP P + R P +P P PPPP+P PP SP Sbjct: 278 PPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSP- 336 Query: 306 LLPPPRQKPPS-HP--PPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGP 470 PPPR PPS +P PPP SP P + P + R R+ RP RR PP P Sbjct: 337 --PPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPPRRPPRPPRR------PPTAP 386 Score = 57.8 bits (138), Expect = 4e-07 Identities = 43/115 (37%), Positives = 47/115 (40%), Gaps = 1/115 (0%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPS-WPPPPPPAPPPQSPLLLPP 317 P SP P PS S SP P+ + S P SP PPP PP PP SP PP Sbjct: 146 PPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPP 205 Query: 318 PRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PR P +PP P P P+ P RR P R PP P P S Sbjct: 206 PRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPS 260 Score = 56.6 bits (135), Expect = 9e-07 Identities = 43/115 (37%), Positives = 46/115 (40%), Gaps = 3/115 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP F SP P R R P SP P PPPP+PPP P PPP Sbjct: 225 PSPRPPPRRPPFPPP--SPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLP---PPP 279 Query: 321 RQKPPSHPPP---PHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPS PPP P SP P + P R P R PP P P Sbjct: 280 SPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPP 334 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/79 (41%), Positives = 37/79 (46%), Gaps = 3/79 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP-PPP--APPPQSPLLL 311 P SPPP P + +P R + R P P +PPP PPP PPP P Sbjct: 196 PPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPR 255 Query: 312 PPPRQKPPSHPPPPHSPPP 368 PPP PP PPPP PPP Sbjct: 256 PPPPSPPPPLPPPPSPPPP 274 Score = 55.8 bits (133), Expect = 2e-06 Identities = 32/77 (41%), Positives = 33/77 (42%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P S P P P SP PPPPPP PPP P PPP Sbjct: 98 PPPPPPPPPPPPSPPPPPPPPPP-----------PPPSPPPPPPPPPPPPPNPPPPPPPP 146 Query: 321 RQKPPSHPPPPHSPPPT 371 P P PP SPPP+ Sbjct: 147 PPSPSPPPSPPPSPPPS 163 Score = 55.1 bits (131), Expect = 3e-06 Identities = 32/77 (41%), Positives = 34/77 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P SP P P P+ PPPPPP PP SP PPP Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPP--------PPPPPNPPPPPPPPPPSPSPPPSPPP 158 Query: 321 RQKPPSHPPPPHSPPPT 371 P P PP SPPP+ Sbjct: 159 SPPPSPPPSPPPSPPPS 175 [53][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/85 (42%), Positives = 39/85 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP PS SP P SP P PPPP+PPP SP PPP Sbjct: 199 PSPPPPPPPSPPPPPPPSPPPP---------------SPPPPSPPPPSPPPPSP---PPP 240 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTC 395 PP PPPP PPP+ PC C Sbjct: 241 ---PPPSPPPPSPPPPSPPPPCKVC 262 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPS-HPPPPHSPPPTRHRP 383 PS PPPPPP+PPP SP PP PPS PPPP SPPP P Sbjct: 181 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 224 Score = 54.3 bits (129), Expect = 4e-06 Identities = 35/85 (41%), Positives = 38/85 (44%), Gaps = 3/85 (3%) Frame = +3 Query: 138 CPTS---SPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLL 308 CP + SPPP P SP P P SP P PPPP+PPP P Sbjct: 167 CPVTRGASPPPPPPP------SPPPP------------PPPSPPPPSPPPPSPPPPPPPS 208 Query: 309 LPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP PP PPPP PPP+ P Sbjct: 209 PPPP---PPPSPPPPSPPPPSPPPP 230 [54][TOP] >UniRef100_C1EFP7 Receptor-like cell wall protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EFP7_9CHLO Length = 1985 Score = 62.4 bits (150), Expect = 2e-08 Identities = 38/81 (46%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 1468 PPSPPPPSPPPPSPPPPSPPPPSP----------PPPSPPPPSPPPPSPPPPSP---PPP 1514 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPPP SPPP P Sbjct: 1515 LPPPPS-PPPPSSPPPMSPSP 1534 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPPPPP+PPP P PPP PP PPPP PPP+ P Sbjct: 1460 PPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 1499 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/78 (43%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P P PPPP P PP P L PPP Sbjct: 1473 PPSPPPPSPPPPSPPPPSPPP-------------PSPPPPSPPPPSPPPPSPPPPLPPPP 1519 Query: 321 RQKPPSHPPP--PHSPPP 368 PPS PPP P PPP Sbjct: 1520 SPPPPSSPPPMSPSPPPP 1537 Score = 55.5 bits (132), Expect = 2e-06 Identities = 34/79 (43%), Positives = 34/79 (43%), Gaps = 3/79 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP---PPPAPPPQSPLLL 311 P S PPP P S SP P P P PPP PPP PPP SP Sbjct: 1478 PPSPPPPSPPPPSPPPPSPPP-------------PSPPPPSPPPPSPPPPLPPPPSP--- 1521 Query: 312 PPPRQKPPSHPPPPHSPPP 368 PPP PP P PP PPP Sbjct: 1522 PPPSSPPPMSPSPPPPPPP 1540 Score = 53.9 bits (128), Expect = 6e-06 Identities = 27/44 (61%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +3 Query: 255 PSWPP-PPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PS PP PPPP+PPP SP PPP PPS PPPP PPP+ P Sbjct: 1465 PSPPPSPPPPSPPPPSP---PPPSPPPPS-PPPPSPPPPSPPPP 1504 [55][TOP] >UniRef100_B9FT55 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FT55_ORYSJ Length = 191 Score = 62.4 bits (150), Expect = 2e-08 Identities = 38/83 (45%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP PS SP PT A A RR C S PPPP P+PPP P P Sbjct: 111 PAPSPPPPPSPSPPPPTSPEPTTAAVARAVYRR--CRRAS-PPPPSPSPPPPDPSPQPSS 167 Query: 321 RQKPPSHPPPPHSPPPTR-HRPC 386 P PPPP SP PT +R C Sbjct: 168 SPDPSPSPPPPTSPEPTAVYRRC 190 [56][TOP] >UniRef100_A8J9H7 Mastigoneme-like flagellar protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J9H7_CHLRE Length = 1987 Score = 62.4 bits (150), Expect = 2e-08 Identities = 43/118 (36%), Positives = 50/118 (42%) Frame = +3 Query: 30 CSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTR 209 C+ + S R C+ ++ P R E S P P PPP P S SP P Sbjct: 1828 CTEDLGSQRCKPCSLLSK-PKTARTEQ--SPPPPSPSPPPPPPPSPRPPSPNPPSPRP-- 1882 Query: 210 AGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P +P P PPP +PPP P PPPR PP PPPP PPP R P Sbjct: 1883 -----------PSPAPPSPNPPPTSPPPSPPPSPPPPRPPPPP-PPPPSPPPPNRSPP 1928 [57][TOP] >UniRef100_A7RNZ0 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RNZ0_NEMVE Length = 370 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/73 (45%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = +3 Query: 153 PPPYPSHFSSGALSP*PTR-AGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQK 329 PPPYP+ + P P +G G PC P PPPP PAP P P P P Q Sbjct: 266 PPPYPNPYPQPPYPPPPAPCSGPG-------PCPYPGPPPPPYPAPTPYPPPPPPYPEQV 318 Query: 330 PPSHPPPPHSPPP 368 PP PPPP PPP Sbjct: 319 PPPPPPPPPPPPP 331 [58][TOP] >UniRef100_C1H633 Predicted protein n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1H633_PARBA Length = 680 Score = 62.4 bits (150), Expect = 2e-08 Identities = 46/133 (34%), Positives = 55/133 (41%), Gaps = 1/133 (0%) Frame = +3 Query: 87 PLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWP 266 P L + G+S P+ P SPPP P H S A+ P A + P +P Sbjct: 437 PTLPPKVPHGASGPV-SAPPPSPPPRP-HASPSAIPQPPPAPAPPPARQAPPPVSAPVPQ 494 Query: 267 PPPPPAPPPQSPLLLPPPRQKPP-SHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSA 443 PPPPP P P +PPP PP S PPP PPP+ P + P S Sbjct: 495 PPPPPPPGPAPSTAVPPPPPPPPASGLPPPPPPPPSGSVPPPPPPPASSASHSPPPPLSE 554 Query: 444 RGGGPPAGPEPLS 482 GPP P P S Sbjct: 555 PSSGPPPPPHPAS 567 [59][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 58.2 bits (139), Expect(2) = 2e-08 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRH 377 P PPPPPP PPP P PPP PP PPPP PPP H Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 58 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 2 PPPPPPPPPPPPPPPP 17 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 3 PPPPPPPPPPPPPPPP 18 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 4 PPPPPPPPPPPPPPPP 19 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 5 PPPPPPPPPPPPPPPP 20 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 6 PPPPPPPPPPPPPPPP 21 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 7 PPPPPPPPPPPPPPPP 22 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 8 PPPPPPPPPPPPPPPP 23 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 9 PPPPPPPPPPPPPPPP 24 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 10 PPPPPPPPPPPPPPPP 25 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [60][TOP] >UniRef100_B9FY87 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FY87_ORYSJ Length = 1589 Score = 58.9 bits (141), Expect(2) = 2e-08 Identities = 42/117 (35%), Positives = 49/117 (41%), Gaps = 5/117 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*P--TRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLP 314 P PPP +HF++ P P TR+GA P P P PPPP PPP + P Sbjct: 977 PPPPPPPPTTHFNAPPPPPPPPITRSGA--------PPSPPPPPSPPPPPPPPGARPGPP 1028 Query: 315 PPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCR---PLRRSARGGGPPAGPEP 476 PP P + P PP PPP RP + P S R G PP P P Sbjct: 1029 PPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPP 1085 Score = 23.1 bits (48), Expect(2) = 2e-08 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 127 RYAGVPPPPPLPT 165 R+ PPPPP PT Sbjct: 973 RFNAPPPPPPPPT 985 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 43/124 (34%), Positives = 48/124 (38%), Gaps = 16/124 (12%) Frame = +3 Query: 153 PPPYPSHFSSGALS--------P*PTRAGAG*ASRRRWPCWSPSWPPPPP------PAPP 290 PPP P S GA + P P +G A+R +P PPPPP P PP Sbjct: 939 PPPPPPLMSFGAQTRTFVPPPPPPPPPPRSGVAARFN----APPPPPPPPTTHFNAPPPP 994 Query: 291 PQSPLLL--PPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPA 464 P P+ PP PP PPPP PP R P P AR G PP Sbjct: 995 PPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPP-----------PPPPGARPGPPPP 1043 Query: 465 GPEP 476 P P Sbjct: 1044 PPPP 1047 Score = 22.3 bits (46), Expect(2) = 2e-06 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 133 AGVPPPPPLPTL 168 + +PPPPP P L Sbjct: 934 SSIPPPPPPPPL 945 [61][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 56.2 bits (134), Expect(2) = 2e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 25.8 bits (55), Expect(2) = 2e-08 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 124 CRYAGVPPPPPLPTLPTSPAVP 189 C PPPPP P P P P Sbjct: 848 CEEPTTPPPPPPPPPPPPPPPP 869 Score = 57.4 bits (137), Expect(2) = 2e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCG 389 P PPPPPP PPP P PPP PP PPPP PPP P G Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 963 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 899 PPPPPPPPPPPPPPPP 914 Score = 57.0 bits (136), Expect(2) = 3e-08 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP +PPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 24.3 bits (51), Expect(2) = 3e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 900 PPPPPPPPPPPPPPPP 915 Score = 56.6 bits (135), Expect(2) = 4e-08 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PPP P PPP PP PPPP PPP P Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAP 965 Score = 24.3 bits (51), Expect(2) = 4e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 901 PPPPPPPPPPPPPPPP 916 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 902 PPPPPPPPPPPPPPPP 917 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 903 PPPPPPPPPPPPPPPP 918 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 904 PPPPPPPPPPPPPPPP 919 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 905 PPPPPPPPPPPPPPPP 920 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 906 PPPPPPPPPPPPPPPP 921 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 907 PPPPPPPPPPPPPPPP 922 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 908 PPPPPPPPPPPPPPPP 923 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 909 PPPPPPPPPPPPPPPP 924 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 910 PPPPPPPPPPPPPPPP 925 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 911 PPPPPPPPPPPPPPPP 926 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +3 Query: 246 CWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 C P+ PPPPPP PPP P PPP PP PPPP PPP Sbjct: 848 CEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/76 (42%), Positives = 33/76 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 PT+ PPP P P P P P PPPPPP PPP P PPP Sbjct: 851 PTTPPPPPPPPPPPPPPPPPP-------------PPPPPPPPPPPPPPPPPPPPPPPPPP 897 Query: 321 RQKPPSHPPPPHSPPP 368 PP PPPP PPP Sbjct: 898 PPPPPPPPPPPPPPPP 913 Score = 53.9 bits (128), Expect(2) = 3e-07 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCG 389 P PPPPPP PPP P PPP PP PPP PPP P G Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPG 975 Score = 24.3 bits (51), Expect(2) = 3e-07 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 912 PPPPPPPPPPPPPPPP 927 Score = 53.5 bits (127), Expect(2) = 3e-07 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPP 966 Score = 24.3 bits (51), Expect(2) = 3e-07 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 913 PPPPPPPPPPPPPPPP 928 Score = 52.8 bits (125), Expect(2) = 6e-07 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPP-PPHSPPPTRHRPC 386 P PPPPPP PPP P PPP PP P PP +PPP PC Sbjct: 941 PPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPPALPC 985 Score = 24.3 bits (51), Expect(2) = 6e-07 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 914 PPPPPPPPPPPPPPPP 929 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 [62][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 57.8 bits (138), Expect(2) = 2e-08 Identities = 33/74 (44%), Positives = 37/74 (50%), Gaps = 10/74 (13%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCG----TCRR------R 404 P PPPPPP PPP P PPP PP PPPP PPP P G CR+ R Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVDCRQVWYLYIR 95 Query: 405 T*RQRCRPLRRSAR 446 T R + +R S+R Sbjct: 96 TPRAHNQYVRDSSR 109 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 2 PPPPPPPPPPPPPPPP 17 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 3 PPPPPPPPPPPPPPPP 18 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 4 PPPPPPPPPPPPPPPP 19 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 5 PPPPPPPPPPPPPPPP 20 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 6 PPPPPPPPPPPPPPPP 21 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 7 PPPPPPPPPPPPPPPP 22 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 8 PPPPPPPPPPPPPPPP 23 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 9 PPPPPPPPPPPPPPPP 24 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 10 PPPPPPPPPPPPPPPP 25 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 11 PPPPPPPPPPPPPPPP 26 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 12 PPPPPPPPPPPPPPPP 27 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 13 PPPPPPPPPPPPPPPP 28 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 14 PPPPPPPPPPPPPPPP 29 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 15 PPPPPPPPPPPPPPPP 30 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 16 PPPPPPPPPPPPPPPP 31 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 17 PPPPPPPPPPPPPPPP 32 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 18 PPPPPPPPPPPPPPPP 33 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 19 PPPPPPPPPPPPPPPP 34 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 20 PPPPPPPPPPPPPPPP 35 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 21 PPPPPPPPPPPPPPPP 36 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 22 PPPPPPPPPPPPPPPP 37 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 23 PPPPPPPPPPPPPPPP 38 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 24 PPPPPPPPPPPPPPPP 39 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 25 PPPPPPPPPPPPPPPP 40 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 26 PPPPPPPPPPPPPPPP 41 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 27 PPPPPPPPPPPPPPPP 42 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 28 PPPPPPPPPPPPPPPP 43 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [63][TOP] >UniRef100_Q1EPA3 Protein kinase family protein n=1 Tax=Musa acuminata RepID=Q1EPA3_MUSAC Length = 648 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 3/82 (3%) Frame = +3 Query: 147 SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQ 326 SSPPP PS P PT AS P +P+ PPP PP+PPP SP PPP Sbjct: 2 SSPPPSPSATPPSTSPPPPTSLSPPPASNSPPP--APNAPPPTPPSPPPASP---PPPTP 56 Query: 327 KPPSHPPPP---HSPPPTRHRP 383 PP+ PPP SPPP P Sbjct: 57 PPPADVPPPPVVTSPPPPAPPP 78 Score = 59.3 bits (142), Expect = 1e-07 Identities = 44/117 (37%), Positives = 50/117 (42%), Gaps = 4/117 (3%) Frame = +3 Query: 144 TSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPR 323 TS PPP P S +SP P AS P PS PPP APPP P PPP Sbjct: 69 TSPPPPAPPPPS---VSPPPPALSPPPASTPPRP---PSASPPPAAAPPPPPPSATPPPT 122 Query: 324 QKPP----SHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PP + PPP SPPP + P ++ GG PPA P+P S Sbjct: 123 NSPPPPPSATPPPTISPPPPGS-----------QSPPAPAPSNSTGGTPPAPPKPPS 168 [64][TOP] >UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum bicolor RepID=C5XPK9_SORBI Length = 613 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/76 (47%), Positives = 37/76 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 445 PPSPPPPSPPPPSPPPPSPPP-------------PSPSPPPPSPPPPSPPPPSP-SPPPP 490 Query: 321 RQKPPSHPPPPHSPPP 368 PPS PPP SPPP Sbjct: 491 SPPPPSPPPPSPSPPP 506 Score = 60.5 bits (145), Expect = 6e-08 Identities = 36/81 (44%), Positives = 37/81 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S P P P SP P PPPP+PPP SP PPP Sbjct: 428 PPSPPPPSPPPPSPSPPPPSP-------------PPPSPPPPSPPPPSPPPPSP-SPPPP 473 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPP SPPP P Sbjct: 474 SPPPPSPPPPSPSPPPPSPPP 494 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/81 (43%), Positives = 36/81 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP PS P P P P PPPP P+PPP SP PPP Sbjct: 433 PPSPPPPSPSPPPPSPPPPSPPP-----------PSPPPPSPPPPSPSPPPPSP---PPP 478 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPP SPPP P Sbjct: 479 SPPPPSPSPPPPSPPPPSPPP 499 Score = 59.3 bits (142), Expect = 1e-07 Identities = 42/102 (41%), Positives = 45/102 (44%), Gaps = 2/102 (1%) Frame = +3 Query: 84 CPLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSW 263 C K ++ S PL P S PPP P S P P S P PS Sbjct: 394 CDAFKCKKFVLPSPPLP--PPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPP---PSP 448 Query: 264 PPP--PPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP PPP+PPP SP PPP PP PPP SPPP P Sbjct: 449 PPPSPPPPSPPPPSP---PPPSPSPPPPSPPPPSPPPPSPSP 487 Score = 53.5 bits (127), Expect = 8e-06 Identities = 36/87 (41%), Positives = 38/87 (43%), Gaps = 11/87 (12%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P P PPPP P+PPP SP PPP Sbjct: 450 PPSPPPPSPPPPSPPPPSPSPPP-----------PSPPPPSPPPPSPSPPPPSP---PPP 495 Query: 321 RQKPPS-HPPPPH----------SPPP 368 PPS PPPP+ SPPP Sbjct: 496 SPPPPSPSPPPPYYEVSPEERYLSPPP 522 [65][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 57.4 bits (137), Expect(2) = 3e-08 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTC 395 P PPPPPP PPP P PPP PP PPPP PPP P C Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLC 85 Score = 24.3 bits (51), Expect(2) = 3e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 2 PPPPPPPPPPPPPPPP 17 Score = 57.0 bits (136), Expect(2) = 3e-08 Identities = 27/54 (50%), Positives = 28/54 (51%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQ 416 P PPPPPP PPP P PPP PP PPPP PPP P C R R+ Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLCCFGRKSRK 93 Score = 24.3 bits (51), Expect(2) = 3e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 3 PPPPPPPPPPPPPPPP 18 Score = 56.6 bits (135), Expect(2) = 4e-08 Identities = 27/58 (46%), Positives = 30/58 (51%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRP 428 P PPPPPP PPP P PPP PP PPPP PPP + G R+ + C P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLCCFGRKSRKLSIKYCVP 101 Score = 24.3 bits (51), Expect(2) = 4e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 4 PPPPPPPPPPPPPPPP 19 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 5 PPPPPPPPPPPPPPPP 20 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 6 PPPPPPPPPPPPPPPP 21 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 7 PPPPPPPPPPPPPPPP 22 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 8 PPPPPPPPPPPPPPPP 23 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 9 PPPPPPPPPPPPPPPP 24 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 10 PPPPPPPPPPPPPPPP 25 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 11 PPPPPPPPPPPPPPPP 26 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 12 PPPPPPPPPPPPPPPP 27 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 13 PPPPPPPPPPPPPPPP 28 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 14 PPPPPPPPPPPPPPPP 29 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 15 PPPPPPPPPPPPPPPP 30 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 16 PPPPPPPPPPPPPPPP 31 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 17 PPPPPPPPPPPPPPPP 32 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 18 PPPPPPPPPPPPPPPP 33 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 19 PPPPPPPPPPPPPPPP 34 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 20 PPPPPPPPPPPPPPPP 35 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 21 PPPPPPPPPPPPPPPP 36 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 22 PPPPPPPPPPPPPPPP 37 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 23 PPPPPPPPPPPPPPPP 38 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 24 PPPPPPPPPPPPPPPP 39 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 25 PPPPPPPPPPPPPPPP 40 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 26 PPPPPPPPPPPPPPPP 41 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 27 PPPPPPPPPPPPPPPP 42 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 28 PPPPPPPPPPPPPPPP 43 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 29 PPPPPPPPPPPPPPPP 44 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 30 PPPPPPPPPPPPPPPP 45 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 31 PPPPPPPPPPPPPPPP 46 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 [66][TOP] >UniRef100_B2HRW1 Conserved hypothetical proline-rich protein n=1 Tax=Mycobacterium marinum M RepID=B2HRW1_MYCMM Length = 367 Score = 61.6 bits (148), Expect = 3e-08 Identities = 38/86 (44%), Positives = 42/86 (48%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 PL P P P P+H L P P A AS+R P P PPP P PPPQ P Sbjct: 222 PLVPNPPQIPGPPPAHI----LRPPPPIAPPP-ASQRPRPPQQPQ-PPPQEPPPPPQEP- 274 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP+Q+PP PPPP PP P Sbjct: 275 --PPPQQEPPQEPPPPQQKPPQEPPP 298 [67][TOP] >UniRef100_C4B111 Intracellular motility protein A n=4 Tax=Burkholderia mallei RepID=C4B111_BURMA Length = 373 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/46 (56%), Positives = 26/46 (56%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGT 392 P PPPPPP PPP P PPP PP PPPP PPPT P T Sbjct: 95 PPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPPTTT 140 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/53 (50%), Positives = 28/53 (52%) Frame = +3 Query: 234 RRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGT 392 R P P PPPPPP PPP P PPP PP PPPP PPP+ P T Sbjct: 83 RTLPNKVPPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTT 135 Score = 56.6 bits (135), Expect = 9e-07 Identities = 32/96 (33%), Positives = 37/96 (38%) Frame = +3 Query: 96 KRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP 275 K + +G +LP + P PPP P P PPPP Sbjct: 76 KLKPVGDRTLPNKVPPPPPPPPPP-----------------------------PPPPPPP 106 Query: 276 PPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPP P PPP PP PPPP + PPT P Sbjct: 107 PSPPPPSPPPPSPPPPSPPPPSPPPPTTTPPTTTTP 142 [68][TOP] >UniRef100_Q6UDW6 Erythrocyte membrane protein 1 n=1 Tax=Plasmodium falciparum RepID=Q6UDW6_PLAFA Length = 2322 Score = 61.6 bits (148), Expect = 3e-08 Identities = 46/116 (39%), Positives = 48/116 (41%), Gaps = 1/116 (0%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P R P S PPP PS + P P+R PS PPPP PPP P Sbjct: 1664 PSRPPPPSRPPP-PSRPPPPSRPPPPSRPPP------------PSRPPPPSRPPPPSRPP 1710 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARG-GGPPAGP 470 PP R PPS PPPP PPP P R R RS RG GP GP Sbjct: 1711 --PPSRPPPPSRPPPPPPPPPAPRPPAEPARDSGPDHRA----RSERGEDGPLPGP 1760 [69][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPPPPP PPP P PPP PP PPPP PPP R RP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRRP 117 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 21/37 (56%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPP--PPHSPPP 368 PPPPPP PPP SP PP P + PP PP PPP Sbjct: 155 PPPPPPPPPPPSPPSPQPPPAPPAAPPPAAPPARPPP 191 Score = 26.2 bits (56), Expect(2) = 6e-06 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVPCRHDPHARVRDERRGGGG 243 PPPPP P P P P P R R G G Sbjct: 91 PPPPPPPPPPPPPPPPPPPPPPPRRRPRPYYGHG 124 [70][TOP] >UniRef100_B6H3W8 Pc13g11020 protein n=1 Tax=Penicillium chrysogenum Wisconsin 54-1255 RepID=B6H3W8_PENCW Length = 406 Score = 61.6 bits (148), Expect = 3e-08 Identities = 49/140 (35%), Positives = 58/140 (41%), Gaps = 9/140 (6%) Frame = +3 Query: 102 RELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAG---AG*ASRRRWPCWSPSWPPP 272 R+ G P P + PP P S P P+ A A A+R SPS PPP Sbjct: 228 RKPSGPPPPPPSAPATRAPPPPPAASRSTPPPPPSAAPPSIAAQAARSALGHSSPSAPPP 287 Query: 273 PPP-----APPPQSPLLLP-PPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLR 434 PPP APPP P LP P +PPS PPP S P H P + P Sbjct: 288 PPPSAAPGAPPPPPPTSLPAAPPSEPPSRPPPV-SSRPVSHEPIAS---------LDPSA 337 Query: 435 RSARGGGPPAGPEPLSSTRG 494 + GG PA + ST+G Sbjct: 338 YTLSNGGSPAPSSRIPSTQG 357 Score = 53.5 bits (127), Expect = 8e-06 Identities = 35/92 (38%), Positives = 42/92 (45%), Gaps = 2/92 (2%) Frame = +3 Query: 114 GSSLPLRGCPTSSPPPYP-SHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPP 290 G+ P R T SPP P + +G P P A ++ +P PPP P PP Sbjct: 156 GTRPPPRPSSTDSPPAPPVNSLVAGLKKPPPRPASRPSSAVPASATKAPEVPPPRAPPPP 215 Query: 291 PQSPLLLPPP-RQKPPSHPPPPHSPPPTRHRP 383 P L PPP +KP PPPP S P TR P Sbjct: 216 PAPGKLPPPPTSRKPSGPPPPPPSAPATRAPP 247 [71][TOP] >UniRef100_UPI000194C22E PREDICTED: similar to formin 2 n=1 Tax=Taeniopygia guttata RepID=UPI000194C22E Length = 1673 Score = 54.3 bits (129), Expect(2) = 3e-08 Identities = 36/88 (40%), Positives = 38/88 (43%), Gaps = 15/88 (17%) Frame = +3 Query: 150 SPPPYPSHFSSGALSP*PTRA-------------GAG*ASRRRWPCWSPSWPPPPPPAPP 290 SP P P HF SG ++ P GAG P P W PPPP PP Sbjct: 1041 SPLPPPPHFPSGEITTLPPAPLLPCPGFPPQPLPGAG------VPAALPGWGIPPPPPPP 1094 Query: 291 PQSPLLLPPPRQKPPSH--PPPPHSPPP 368 P PL LPPP P PPPP PPP Sbjct: 1095 P--PLRLPPPPPPLPGGGIPPPPPPPPP 1120 Score = 26.9 bits (58), Expect(2) = 3e-08 Identities = 20/54 (37%), Positives = 24/54 (44%) Frame = +1 Query: 1 PQRPTSPTYLVHLLWPRGGQAAAPGRRAVPC*RGVNLVAHPCRYAGVPPPPPLP 162 P P PT + P QAA +P G + V P AG+P PPPLP Sbjct: 969 PSLPPEPTCSIPPSLPLTEQAAP-----LPGTHGHSFVT-PMSVAGLPLPPPLP 1016 [72][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 61.2 bits (147), Expect = 4e-08 Identities = 35/90 (38%), Positives = 38/90 (42%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQ 296 S+ P + CP PPP P P P P PPPPPP+PPP Sbjct: 350 SANPCQPCPPPPPPPPP---------PPP-----------------PPPPPPPPPSPPPP 383 Query: 297 SPLLLPPPRQKPPSHPPPPHSPPPTRHRPC 386 P PPP PP PPPP PPP PC Sbjct: 384 PP---PPPPPPPPPPPPPPPPPPPPPPPPC 410 Score = 58.9 bits (141), Expect = 2e-07 Identities = 39/97 (40%), Positives = 41/97 (42%), Gaps = 11/97 (11%) Frame = +3 Query: 111 GGSSLPLRG---CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWS--------P 257 GGSS P PT + P + S A P P A PC P Sbjct: 316 GGSSPPTEAKLDTPTEAKPEMQTG-SPNACCPPPPSAN---------PCQPCPPPPPPPP 365 Query: 258 SWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 PPPPPP PPP SP PPP PP PPPP PPP Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 [73][TOP] >UniRef100_UPI00017B3BB9 UPI00017B3BB9 related cluster n=1 Tax=Tetraodon nigroviridis RepID=UPI00017B3BB9 Length = 662 Score = 61.2 bits (147), Expect = 4e-08 Identities = 43/111 (38%), Positives = 49/111 (44%), Gaps = 1/111 (0%) Frame = +3 Query: 147 SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQ 326 S P +PS + +P T +GA WPC P PPP P P P S L R Sbjct: 541 SPPTSWPSSHHAPPPAPPKTFSGA-------WPCLPPPRPPPSPQLPRPWSSRLSTSSRV 593 Query: 327 KPPSHP-PPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PP P PPP P + RP T RRT +R RP R R P GP P Sbjct: 594 TPPPAPCPPPPPRPRSSLRPPRTALRRTSPRRPRP-RPPPRRAPPSRGPPP 643 [74][TOP] >UniRef100_UPI00017B3BB8 UPI00017B3BB8 related cluster n=1 Tax=Tetraodon nigroviridis RepID=UPI00017B3BB8 Length = 669 Score = 61.2 bits (147), Expect = 4e-08 Identities = 43/111 (38%), Positives = 49/111 (44%), Gaps = 1/111 (0%) Frame = +3 Query: 147 SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQ 326 S P +PS + +P T +GA WPC P PPP P P P S L R Sbjct: 548 SPPTSWPSSHHAPPPAPPKTFSGA-------WPCLPPPRPPPSPQLPRPWSSRLSTSSRV 600 Query: 327 KPPSHP-PPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PP P PPP P + RP T RRT +R RP R R P GP P Sbjct: 601 TPPPAPCPPPPPRPRSSLRPPRTALRRTSPRRPRP-RPPPRRAPPSRGPPP 650 [75][TOP] >UniRef100_Q00X46 Chromosome 13 contig 1, DNA sequence n=1 Tax=Ostreococcus tauri RepID=Q00X46_OSTTA Length = 1990 Score = 61.2 bits (147), Expect = 4e-08 Identities = 37/92 (40%), Positives = 39/92 (42%) Frame = +3 Query: 108 LGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP 287 LG S P P +PPP PS P PT P PPPP P P Sbjct: 775 LGCVSSPPPSPPPPNPPPLPSPPPPSPPPPSPT----------------PPLPPPPSPFP 818 Query: 288 PPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PP SP PPP PP PPPP PPP+ P Sbjct: 819 PP-SPSPSPPPPSPPPPSPPPPSPPPPSPFPP 849 [76][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 61.2 bits (147), Expect = 4e-08 Identities = 33/76 (43%), Positives = 34/76 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPP PS P PT + P P PPPPPP PPP PL PP Sbjct: 1176 PERSPPRAPSEPGR----PPPTAPSPPPPGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPS 1231 Query: 321 RQKPPSHPPPPHSPPP 368 PP PPPP PPP Sbjct: 1232 PPPPPPSPPPPSPPPP 1247 Score = 56.6 bits (135), Expect = 9e-07 Identities = 35/83 (42%), Positives = 36/83 (43%) Frame = +3 Query: 120 SLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQS 299 S P R PT+ PP P A P PS PPPPPP PPP Sbjct: 1185 SEPGRPPPTAPSPPPPGQPPRPAPPP-------------------PSPPPPPPPPPPP-- 1223 Query: 300 PLLLPPPRQKPPSHPPPPHSPPP 368 P L PPP PP PPP SPPP Sbjct: 1224 PPLPPPPSPPPPPPSPPPPSPPP 1246 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Frame = +3 Query: 237 RWPCWSPSWPPP---PPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 R P +PS PPP P PAPPP SP PPP PP PPPP PPP P Sbjct: 1189 RPPPTAPSPPPPGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPP 1240 Score = 53.5 bits (127), Expect = 8e-06 Identities = 42/110 (38%), Positives = 45/110 (40%), Gaps = 29/110 (26%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPA--------PPPQ 296 P SSPPP P H A S TRA R P +SPS PPPPPPA PPP Sbjct: 49 PPSSPPP-PPHALDRAPSTAWTRARI---DRGLAPLFSPSPPPPPPPAPREPPAPSPPPH 104 Query: 297 S--------------------PLLLPPPRQKPPSHP-PPPHSPPPTRHRP 383 + PL P P PP P PPH+PPP P Sbjct: 105 ALDAPRGARFDALERIRLGLDPLFAPSPPPPPPPPPRRPPHAPPPRPSAP 154 [77][TOP] >UniRef100_C1FJL3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FJL3_9CHLO Length = 513 Score = 61.2 bits (147), Expect = 4e-08 Identities = 40/89 (44%), Positives = 45/89 (50%), Gaps = 6/89 (6%) Frame = +3 Query: 135 GCPTSSP--PPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPS-WPPPPPPAPPPQSPL 305 G P SP P PS +GAL+P A A A+ P +PS PPPP P+PPP SP Sbjct: 179 GTPPFSPLSAPGPSSSPTGALAPAAAPAAAPSAAPTPTPTPTPSPSPPPPSPSPPPPSPS 238 Query: 306 LLPPPRQKPP---SHPPPPHSPPPTRHRP 383 PP PP S PPP SPPP P Sbjct: 239 PPPPSPSPPPPSPSPPPPSPSPPPPSPSP 267 [78][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 61.2 bits (147), Expect = 4e-08 Identities = 36/83 (43%), Positives = 41/83 (49%), Gaps = 1/83 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPP-PPPPAPPPQSPLLLPP 317 P SPPP P +S P P P +SP PP PPPP+PPP P+ PP Sbjct: 287 PVYSPPPPPPVYSPPPPPPSPPPPPP--------PVYSPPPPPSPPPPSPPP--PVYSPP 336 Query: 318 PRQKPPSHPPPPHSPPPTRHRPC 386 P PP PPPP PPP+ PC Sbjct: 337 P---PPPSPPPPSPPPPSPLPPC 356 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/81 (40%), Positives = 35/81 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S P P +SP PPP PP PPP PPP Sbjct: 277 PVYSPPPPPPPVYSPPPPP---------------PVYSPPPPPPSPPPPPPPVYSPPPPP 321 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPP +SPPP P Sbjct: 322 SPPPPSPPPPVYSPPPPPPSP 342 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/76 (46%), Positives = 37/76 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P +SPPP P FS P PT P + S PPP PP PP P PPP Sbjct: 364 PPNSPPPPPPLFSP----PPPT------------PYYYSSPPPPSPPHSPPPPPHS-PPP 406 Query: 321 RQKPPSHPPPPHSPPP 368 P S PPPPHSPPP Sbjct: 407 PSPPHSPPPPPHSPPP 422 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/76 (42%), Positives = 37/76 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP P + SP P P +SP PPP PP P P P LPP Sbjct: 305 PSPPPPPPPVYSPPPPPSPPPPSPPP--------PVYSPPPPPPSPPPPSPPPPSPLPPC 356 Query: 321 RQKPPSHPPPPHSPPP 368 + PP PPPP+SPPP Sbjct: 357 VRPPP--PPPPNSPPP 370 Score = 57.4 bits (137), Expect = 5e-07 Identities = 36/90 (40%), Positives = 38/90 (42%), Gaps = 13/90 (14%) Frame = +3 Query: 153 PPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP-------------APPP 293 PPP P S SP P R P P+ PPPPPP +PPP Sbjct: 338 PPPSPPPPSPPPPSPLPPCV-------RPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPP 390 Query: 294 QSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 SP PPP P P PPHSPPP H P Sbjct: 391 PSPPHSPPPPPHSPPPPSPPHSPPPPPHSP 420 Score = 55.1 bits (131), Expect = 3e-06 Identities = 35/83 (42%), Positives = 40/83 (48%), Gaps = 4/83 (4%) Frame = +3 Query: 147 SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP--APPPQSPLLLPPP 320 S PPP P ++SS P P+ + P SP PPPPP PPP P L PPP Sbjct: 376 SPPPPTPYYYSS---PPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPP 432 Query: 321 RQKPPSHPPPP--HSPPPTRHRP 383 P PPPP +SPPP P Sbjct: 433 PPHPVYSPPPPPVYSPPPPPSPP 455 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 6/49 (12%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPP------SHPPPPHSPPPTRHRP 383 P+ PPP PP P P P+ LPPP PP S PPPP SPPP + P Sbjct: 233 PAPPPPSPPMPVPSPPVYLPPPVYSPPPPPPVYSPPPPPPSPPPPVYSP 281 [79][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 61.2 bits (147), Expect = 4e-08 Identities = 48/141 (34%), Positives = 51/141 (36%), Gaps = 8/141 (5%) Frame = +3 Query: 78 TRCPLL-KRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWS 254 T C LL + + G S P P S PPP+P Sbjct: 19 TFCALLVESQSQNGPSPP--SPPPSPPPPFPP---------------------------P 49 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPP-------HSPPPTRHRPCGTCRRRT*R 413 PS PPPPPP PPP SP PPP PPS PPP PPP R R G RR Sbjct: 50 PSPPPPPPPLPPPPSPPPPPPPPPPPPSKSPPPPPRKKLQPPPPPPRDRSTGNVMRR--- 106 Query: 414 QRCRPLRRSARGGGPPAGPEP 476 R PP P P Sbjct: 107 ----------RSHPPPPPPPP 117 [80][TOP] >UniRef100_B6KLS9 Voltage gated chloride channel domain-containing protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KLS9_TOXGO Length = 1779 Score = 61.2 bits (147), Expect = 4e-08 Identities = 46/126 (36%), Positives = 53/126 (42%), Gaps = 3/126 (2%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPP---PPPPAP 287 SS P P SS PP S SS + P + S P SPS PP PP P+P Sbjct: 268 SSPPPSSSPPSSSPPSSSSPSSSSPPPSSSPPPPSPPSSSTSP--SPSSPPSSSPPSPSP 325 Query: 288 PPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAG 467 PP SP PP PPS PP P SPPP+ + + P S PP+ Sbjct: 326 PPSSPPSSSPPSSSPPS-PPSPSSPPPSSPPSSSSPSSSSPPPSSSPPPPSPPSSSPPSS 384 Query: 468 PEPLSS 485 P SS Sbjct: 385 SSPSSS 390 Score = 56.2 bits (134), Expect = 1e-06 Identities = 39/118 (33%), Positives = 50/118 (42%), Gaps = 3/118 (2%) Frame = +3 Query: 144 TSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPP---PPPPAPPPQSPLLLP 314 +SSP PS +S + S P+ + + SPS PP PP P+PPP SP Sbjct: 183 SSSPSSSPSSSTSPSPSSPPSSSPPSSSPPSSSTSPSPSSPPSSSPPSPSPPPSSPPSSS 242 Query: 315 PPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSST 488 PP PPS PP S PP+ P + P S PP+ P SS+ Sbjct: 243 PPSSSPPSPSSPPPSSPPSSSSPSSS---------SPPPSSSPPSSSPPSSSSPSSSS 291 [81][TOP] >UniRef100_A7SGL4 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SGL4_NEMVE Length = 620 Score = 61.2 bits (147), Expect = 4e-08 Identities = 36/93 (38%), Positives = 42/93 (45%), Gaps = 3/93 (3%) Frame = +3 Query: 117 SSLPLRGCPTSSPPP---YPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP 287 S +P P PPP YP+ ++ + P P PC PPPPPP P Sbjct: 392 SPVPYPPPPAPYPPPSAPYPAPYTPPSPPPPPCPV----------PC-----PPPPPPPP 436 Query: 288 PPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPC 386 PP P+ PPP PP PPPP PPP PC Sbjct: 437 PPPCPVPCPPPPPPPPPSPPPP--PPPPCPIPC 467 [82][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 57.0 bits (136), Expect(2) = 4e-08 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHR 380 P PPPPPP PPP P PPP PP PPPP PPP R Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFR 59 Score = 24.3 bits (51), Expect(2) = 4e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 2 PPPPPPPPPPPPPPPP 17 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 3 PPPPPPPPPPPPPPPP 18 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 4 PPPPPPPPPPPPPPPP 19 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 5 PPPPPPPPPPPPPPPP 20 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 6 PPPPPPPPPPPPPPPP 21 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 7 PPPPPPPPPPPPPPPP 22 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 8 PPPPPPPPPPPPPPPP 23 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 9 PPPPPPPPPPPPPPPP 24 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 10 PPPPPPPPPPPPPPPP 25 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [83][TOP] >UniRef100_A5VB72 Filamentous haemagglutinin family outer membrane protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5VB72_SPHWW Length = 1531 Score = 54.3 bits (129), Expect(2) = 4e-08 Identities = 26/50 (52%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +3 Query: 243 PCWSPSWPPPPPPA---PPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P SP PPPPPP PPP P + PPP P S PPPP PPP P Sbjct: 1272 PPVSPPPPPPPPPVSPPPPPPPPPVSPPPPPPPVSPPPPPPPPPPVIEDP 1321 Score = 26.6 bits (57), Expect(2) = 4e-08 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P SP P Sbjct: 1264 PPPPPPPPPPVSPPPP 1279 [84][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 60.8 bits (146), Expect = 5e-08 Identities = 27/51 (52%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +3 Query: 243 PCWSPS---WPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPC 386 PC P+ PPPPPP PPP P PPP PP PPPP PPP PC Sbjct: 237 PCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPC 287 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/83 (40%), Positives = 34/83 (40%) Frame = +3 Query: 138 CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP 317 CP PPP P P P PC P PPPPPP PPP P P Sbjct: 257 CPPPCPPPPPPPPPPPPPPPPPPPP----------PC-PPPCPPPPPPCPPPPPPPPPCP 305 Query: 318 PRQKPPSHPPPPHSPPPTRHRPC 386 P PP PPPP PPP PC Sbjct: 306 PPPPPPPPPPPPCPPPPPPPPPC 328 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 PC P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 256 PCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPP 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 34/84 (40%), Positives = 34/84 (40%), Gaps = 2/84 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P P P PC P PPPPPP PPP P PPP Sbjct: 272 PPPPPPPPPPPCPPPCPPPPP-------------PCPPP--PPPPPPCPPPPPPPPPPPP 316 Query: 321 RQKPPSHPPPPHSP--PPTRHRPC 386 PP PPPP P PP PC Sbjct: 317 PCPPPPPPPPPCPPPCPPPCPPPC 340 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/76 (40%), Positives = 31/76 (40%) Frame = +3 Query: 138 CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP 317 CP PPP P P P PC P PP PPP PPP P PP Sbjct: 304 CPPPPPPPPPPPPPCPPPPPPPP------------PCPPPCPPPCPPPCPPPPPPCP-PP 350 Query: 318 PRQKPPSHPPPPHSPP 365 P PP PPPP PP Sbjct: 351 PCPPPPCPPPPPPCPP 366 Score = 53.9 bits (128), Expect = 6e-06 Identities = 37/99 (37%), Positives = 38/99 (38%), Gaps = 6/99 (6%) Frame = +3 Query: 108 LGGSSLPLRG-CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPA 284 LG S P C +PPP P P P PC P PP PPP Sbjct: 227 LGDSCCPSAAPCHPPAPPPCPP--------PPP-------------PCPPPCPPPCPPPP 265 Query: 285 PPPQSPLLLPPPRQKPP-----SHPPPPHSPPPTRHRPC 386 PPP P PPP PP PPPP PPP PC Sbjct: 266 PPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPC 304 Score = 53.9 bits (128), Expect = 6e-06 Identities = 33/90 (36%), Positives = 33/90 (36%), Gaps = 7/90 (7%) Frame = +3 Query: 138 CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP-------PPQ 296 CP PPP P P PC P PPPPPP P PP Sbjct: 283 CPPPCPPPPPPCPPPPPPPP---------------PCPPPPPPPPPPPPPCPPPPPPPPP 327 Query: 297 SPLLLPPPRQKPPSHPPPPHSPPPTRHRPC 386 P PPP P PPPP PPP PC Sbjct: 328 CPPPCPPPCPPPCPPPPPPCPPPPCPPPPC 357 [85][TOP] >UniRef100_A9TLH5 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TLH5_PHYPA Length = 234 Score = 60.8 bits (146), Expect = 5e-08 Identities = 47/120 (39%), Positives = 51/120 (42%), Gaps = 29/120 (24%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSH---------FSSGALSP*PTR----AGAG*ASRRRWP----CWS 254 PL PTS PPP PS S P P R + A +SR P + Sbjct: 85 PLHQSPTSGPPPPPSWPPLTAPPIPLLSNVPGPRPPRYTPTSPATPSSRICPPDLPAAPA 144 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHP----PPPHSPP--------PTRHRPCGTCR 398 P PPPPPP PPP P PPP PS+P P P SPP PTR PC T R Sbjct: 145 PPLPPPPPPPPPPPPPGPRPPPSSPTPSYPSSLSPSPSSPPPRVPDVPAPTRPTPCPTPR 204 [86][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 60.8 bits (146), Expect = 5e-08 Identities = 37/101 (36%), Positives = 41/101 (40%), Gaps = 26/101 (25%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHR---------------PCG 389 P PPPPPP PPP P PPP PP PPPP PPP+ H+ G Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLIEEAQSSPALG 551 Query: 390 TCRRRT*RQRC-----RPLRRSARGG------GPPAGPEPL 479 CRR RP+ + GG GP P PL Sbjct: 552 GCRRPVMTVSITSHIPRPIPEHSSGGEGCSHKGPSPSPPPL 592 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 SP PPPPPP PPP P PPP PP PPPP PPP Sbjct: 487 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGT 392 PPPPPP PPP P PPP PP PPPP PPP P T Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPST 531 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 [87][TOP] >UniRef100_B9RLU7 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RLU7_RICCO Length = 1550 Score = 60.5 bits (145), Expect = 6e-08 Identities = 46/130 (35%), Positives = 47/130 (36%), Gaps = 13/130 (10%) Frame = +3 Query: 126 PLRGCPTSSPPPY-------PSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP- 281 P RG P PPP+ P GA P P G G A P PPPPPP Sbjct: 960 PFRGAPPPPPPPFYGAPPPPPPPPGRGAPPPPPPPPGRG-APPPPPPPPGRGAPPPPPPP 1018 Query: 282 -----APPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSAR 446 PPP P PPP PP PP PPP R P P Sbjct: 1019 PGRGAPPPPPPPGRGPPPPPPPPGRGAPPPLPPPGRGAP--------------PPPPPPG 1064 Query: 447 GGGPPAGPEP 476 GGGPP P P Sbjct: 1065 GGGPPPPPPP 1074 Score = 59.3 bits (142), Expect = 1e-07 Identities = 45/127 (35%), Positives = 50/127 (39%), Gaps = 1/127 (0%) Frame = +3 Query: 108 LGGSSLPLRGCPTSSPPPYPSHFS-SGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPA 284 +GG+ LP R P PPP P + G SP P + P S PPPP A Sbjct: 833 MGGTMLPPRPPPPPPPPPPPPSYPYQGVHSPPPPPPFSSGIPPPTTPSSSARGTPPPPRA 892 Query: 285 PPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPA 464 PP P PP P PPPP PPP R P + P RG PP Sbjct: 893 APPPPPSRAAPP----PPPPPPPPPPPPLRATPPPPLQG---SPPPPPPPPQLRGAPPPP 945 Query: 465 GPEPLSS 485 P LSS Sbjct: 946 PPPHLSS 952 Score = 54.3 bits (129), Expect = 4e-06 Identities = 46/123 (37%), Positives = 47/123 (38%), Gaps = 6/123 (4%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P RG P PPP GA P P G G P PPPPPP P +P Sbjct: 995 PGRGAPPPPPPPP----GRGAPPPPPPPPGRGAPPPPPPP---GRGPPPPPPPPGRGAPP 1047 Query: 306 LLPPP-RQKPPSHPP-----PPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAG 467 LPPP R PP PP PP PPP R P P R GPPA Sbjct: 1048 PLPPPGRGAPPPPPPPGGGGPPPPPPPGRGGP------------PPPPPPGGRVPGPPAP 1095 Query: 468 PEP 476 P P Sbjct: 1096 PRP 1098 [88][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 ++R P P PPPPPP PPP P PPP PP PPPP PPP PC +R Sbjct: 12 STRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQR 71 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 AS R P P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 11 ASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 [89][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/49 (55%), Positives = 28/49 (57%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRR 401 P PPPPPP PPP P PPP PP PPPP PPP HR + RR Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRR 49 Score = 56.6 bits (135), Expect = 9e-07 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 PPPPPP PPP P PPP PP PPPP PPP RRR Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRR 49 [90][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 60.5 bits (145), Expect = 6e-08 Identities = 39/88 (44%), Positives = 42/88 (47%), Gaps = 2/88 (2%) Frame = +3 Query: 126 PLRGCPTSSP-PPYPSHF-SSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQS 299 P+ P +SP PP P SS SP P+ P SPS PPPPPP PPP Sbjct: 219 PIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSP------PPPSPSPPPPPPPPPPPPP 272 Query: 300 PLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPP PP PPPP PPP P Sbjct: 273 P---PPPSPPPPPPPPPPPPPPPPPPSP 297 Score = 59.7 bits (143), Expect = 1e-07 Identities = 40/94 (42%), Positives = 41/94 (43%), Gaps = 5/94 (5%) Frame = +3 Query: 117 SSLPLRGCPTSS-----PPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP 281 S LP PT+S PPP P S SP P P PPPPPP Sbjct: 227 SPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPP---------------PPPPPPPPPP 271 Query: 282 APPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP SP PPP PP PPPP SP P R P Sbjct: 272 PPPPPSP-PPPPPPPPPPPPPPPPPSPSPPRKPP 304 [91][TOP] >UniRef100_UPI00019829A2 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019829A2 Length = 726 Score = 60.1 bits (144), Expect = 8e-08 Identities = 42/118 (35%), Positives = 48/118 (40%) Frame = +3 Query: 129 LRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLL 308 L P+S PPP P S A P P S P PS P PPP PPP SP Sbjct: 85 LANSPSSPPPPSPPPPSPNAPPPTPP------PSPPIAPVPPPSNPSPPPLTPPPTSPPP 138 Query: 309 LPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPP P S PPPP + PP P + + P PP+ P P+S Sbjct: 139 PPPPTNPPRSPPPPPPTEPPVTSPPPPSSNPP--KSSPPPSEPPKTSPPPPSKPPPVS 194 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/83 (40%), Positives = 41/83 (49%), Gaps = 6/83 (7%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*--PTRAGAG*ASRR--RWPCWSPSWPPPPPPAPPPQSPLL 308 P SSPPP P + + P P AG S + P P+ PPP P PPP +P L Sbjct: 26 PLSSPPPPPESSTPPSSQPNADPPDGAAGSTSSPPPQSPPAVPAAPPPASPPPPPPTPSL 85 Query: 309 LPPPRQKPPSHPPP--PHSPPPT 371 P PP PPP P++PPPT Sbjct: 86 ANSPSSPPPPSPPPPSPNAPPPT 108 [92][TOP] >UniRef100_C1N0Z7 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N0Z7_9CHLO Length = 1128 Score = 60.1 bits (144), Expect = 8e-08 Identities = 44/136 (32%), Positives = 55/136 (40%), Gaps = 7/136 (5%) Frame = +3 Query: 108 LGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSP--SWPPPPPP 281 +G ++ P P++ PP P G +P P +G A R P + PPPPPP Sbjct: 377 VGAAAPPATARPSTPPPAPPPPPRGGLGNPQPPPSGG--AKRPPPPPLGALANPPPPPPP 434 Query: 282 APPPQSPLLLPPPRQKPP-----SHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSAR 446 PPP S L PPP PP + PPPP PPP R Sbjct: 435 PPPPPSGLARPPPPPPPPPPGGLAKPPPPPPPPPPPSR--------------------LG 474 Query: 447 GGGPPAGPEPLSSTRG 494 G PP P+P S +G Sbjct: 475 GAPPPPPPKPRSPMKG 490 [93][TOP] >UniRef100_B9RYC5 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RYC5_RICCO Length = 510 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 6/46 (13%) Frame = +3 Query: 249 WSPSWP------PPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 WSP P PPPPP PPP P LPPP PP HPPPP P P Sbjct: 65 WSPPSPVCPPPLPPPPPPPPPICPTPLPPPSPPPPKHPPPPPPPSP 110 [94][TOP] >UniRef100_A8JFD4 Glyoxal or galactose oxidase (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8JFD4_CHLRE Length = 898 Score = 60.1 bits (144), Expect = 8e-08 Identities = 39/89 (43%), Positives = 41/89 (46%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQ 296 S P P S PP PS S SP P S SP P PPPP+PPP Sbjct: 210 SPSPPSPSPPSPSPPSPSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPSPPPPSPPPP 269 Query: 297 SPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 SP PPP PPS PPPP PPP+ P Sbjct: 270 SP---PPPSPPPPS-PPPPSPPPPSPSPP 294 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/76 (43%), Positives = 33/76 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PP PS S SP P R P P PPPP P PP P PPP Sbjct: 233 PPSPRPPSPSPPSPSPPSPRPPSP--------RPPSPPPPSPPPPSPPPPSPPPPSPPPP 284 Query: 321 RQKPPSHPPPPHSPPP 368 PPS PP SPPP Sbjct: 285 SPPPPSPSPPTPSPPP 300 Score = 54.3 bits (129), Expect = 4e-06 Identities = 36/88 (40%), Positives = 38/88 (43%), Gaps = 7/88 (7%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P SP P PPPP+P P +P PPP Sbjct: 258 PPSPPPPSPPPPSPPPPSPPPP---------------SPPPPSPPPPSPSPPTPSPPPPP 302 Query: 321 R------QKPPSHPPP-PHSPPPTRHRP 383 PPS PPP P SPPP R P Sbjct: 303 STVLTSPSPPPSPPPPRPPSPPPPRPPP 330 [95][TOP] >UniRef100_A1KR25 Cell wall glycoprotein GP2 (Fragment) n=2 Tax=Chlamydomonas reinhardtii RepID=A1KR25_CHLRE Length = 1226 Score = 60.1 bits (144), Expect = 8e-08 Identities = 38/85 (44%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = +3 Query: 138 CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP 317 CP PP P+ S SP P P SP P PPPPAPPP SP PP Sbjct: 948 CPLPPSPPPPTPPSPPPPSPPPPVLS---------PPPSPPPPSPPPPAPPPPSP---PP 995 Query: 318 PRQKPPSHP---PPPHSPPPTRHRP 383 P PPS P PPP SPPP P Sbjct: 996 PVPPPPSPPPPSPPPPSPPPAAASP 1020 Score = 54.7 bits (130), Expect = 3e-06 Identities = 43/120 (35%), Positives = 46/120 (38%) Frame = +3 Query: 24 VPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*P 203 VP +PAVA CPL P P S PPP P LSP P Sbjct: 935 VPTNPAVA-------VLDLCCPL--------PPSPPPPTPPSPPPPSPP---PPVLSPPP 976 Query: 204 TRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 + P P PPPP P PP P PPP PPS PP SPPP+ P Sbjct: 977 SPPP---------PSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPP 1027 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/81 (39%), Positives = 35/81 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S +P P SP P PPPP+PPP SP PPP Sbjct: 970 PVLSPPPSPPPPSPPPPAPPPP---------------SPPPPVPPPPSPPPPSP---PPP 1011 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 P + PPP PPP P Sbjct: 1012 SPPPAAASPPPSPPPPPPPSP 1032 [96][TOP] >UniRef100_Q95JC9 Parotid hormone n=1 Tax=Sus scrofa RepID=PRP_PIG Length = 676 Score = 60.1 bits (144), Expect = 8e-08 Identities = 42/112 (37%), Positives = 43/112 (38%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP G SP P GA R P P PPPP PAPP P PPP Sbjct: 437 PKKKPPPPAGPPPPGPPSPGPAPPGA-----RPPPGPPPPGPPPPGPAPPGARPPPGPPP 491 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PP P PP + PP P G RP G PP GP P Sbjct: 492 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 543 Score = 59.7 bits (143), Expect = 1e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 168 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 227 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 228 PGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 284 Score = 59.7 bits (143), Expect = 1e-07 Identities = 41/117 (35%), Positives = 44/117 (37%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P+ P P + G P P G R P P PPPP PAPP P Sbjct: 448 PPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 507 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 508 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 564 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 84 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 143 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 144 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 200 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 126 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 185 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 186 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 242 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 252 PPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 311 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 312 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 368 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 294 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 353 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 354 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 410 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 490 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 549 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 550 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 606 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 532 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 591 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 592 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 648 Score = 58.5 bits (140), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 210 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPP 269 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 270 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 326 Score = 57.8 bits (138), Expect = 4e-07 Identities = 42/112 (37%), Positives = 44/112 (39%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P + PPP P G P P GA R P P PPPP PAPP P PPP Sbjct: 75 PGARPPPGPP--PPGPPPPGPAPPGA-----RPPPGPPPPGPPPPGPAPPGARPPPGPPP 127 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PP P PP + PP P G RP G PP GP P Sbjct: 128 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 179 Score = 56.2 bits (134), Expect = 1e-06 Identities = 40/118 (33%), Positives = 47/118 (39%), Gaps = 1/118 (0%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 336 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 395 Query: 306 LLPPPRQKPPSHPPPPHS-PPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PPP P ++ +P ++ PPAGP P Sbjct: 396 PGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPP----PPAGPPP 449 Score = 53.5 bits (127), Expect = 8e-06 Identities = 32/81 (39%), Positives = 33/81 (40%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 595 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 654 Query: 306 LLPPPRQKPPSHPPPPHSPPP 368 PPP PS P PP PPP Sbjct: 655 PGPPPPPPGPSPPRPPPGPPP 675 [97][TOP] >UniRef100_Q9FLQ7 Formin-like protein 20 n=1 Tax=Arabidopsis thaliana RepID=FH20_ARATH Length = 1615 Score = 60.1 bits (144), Expect = 8e-08 Identities = 46/128 (35%), Positives = 51/128 (39%), Gaps = 4/128 (3%) Frame = +3 Query: 111 GGSSLPLRGCPTSSPPPYPSHFSSG--ALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPA 284 G SS P T+ PPP P FS+ LSP P PS+ PPPP Sbjct: 905 GISSAPSPPVKTAPPPPPPPPFSNAHSVLSPPP-----------------PSYGSPPPPP 947 Query: 285 PPPQSPLLLPPPRQKPPSH--PPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGP 458 PPP S PPP PPS+ PPPP PPP P P + G P Sbjct: 948 PPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPP-----------PPPPPSYGSPP 996 Query: 459 PAGPEPLS 482 P P P S Sbjct: 997 PPPPPPFS 1004 Score = 59.3 bits (142), Expect = 1e-07 Identities = 45/121 (37%), Positives = 49/121 (40%), Gaps = 4/121 (3%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P PPP PS+ S P P G S P PS+ PPPP PPP S + Sbjct: 951 PSYGSPPPPPPPPPSYGSP----PPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHV 1006 Query: 306 -LLPPPRQKPPSH---PPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPE 473 +PPP PP H PPPP PPP H P GG PP P Sbjct: 1007 SSIPPPPPPPPMHGGAPPPP--PPPPMHGGAPP----------PPPPPPMHGGAPPPPPP 1054 Query: 474 P 476 P Sbjct: 1055 P 1055 Score = 55.5 bits (132), Expect = 2e-06 Identities = 44/128 (34%), Positives = 48/128 (37%), Gaps = 10/128 (7%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP-----PAPP 290 P G P PPP SH SS P P G +P PPPPP P PP Sbjct: 990 PSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGG----------APPPPPPPPMHGGAPPPP 1039 Query: 291 PQSPLL--LPPPRQKPPSH---PPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGG 455 P P+ PPP PP H PPPP P +P P RGG Sbjct: 1040 PPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQP--------------PPPPPMRGGA 1085 Query: 456 PPAGPEPL 479 PP P P+ Sbjct: 1086 PPPPPPPM 1093 [98][TOP] >UniRef100_C1FJL2 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FJL2_9CHLO Length = 3062 Score = 55.8 bits (133), Expect(2) = 9e-08 Identities = 27/52 (51%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Frame = +3 Query: 243 PCWSPSWPPPPP----PAPPPQSPL-LLPPPRQKPPSHPPPPHSPPPTRHRP 383 P + P PPPPP PAPPP P PPP PP HP PP SPPP P Sbjct: 62 PSYVPRQPPPPPEPPLPAPPPLPPAPPPPPPNPSPPPHPSPPPSPPPPPEPP 113 Score = 23.9 bits (50), Expect(2) = 9e-08 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 142 PPPPPLPTLPT 174 PPPPP PT P+ Sbjct: 53 PPPPPGPTAPS 63 [99][TOP] >UniRef100_UPI00001F1779 serine/arginine repetitive matrix 1 isoform 1 n=1 Tax=Mus musculus RepID=UPI00001F1779 Length = 923 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/87 (44%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 A RRR P SP+ PPPPPP PP + PPPR++ PS PP SP P R+ P +RR Sbjct: 567 ARRRRSP--SPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSP--PIQRR 622 Query: 405 T*RQRCRPLRRSARGGGPP---AGPEP 476 P RR+A PP A P P Sbjct: 623 Y-SPSPPPKRRTASPPPPPKRRASPSP 648 [100][TOP] >UniRef100_UPI00015DF2EA serine/arginine repetitive matrix 1 n=1 Tax=Mus musculus RepID=UPI00015DF2EA Length = 568 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/87 (44%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 A RRR P SP+ PPPPPP PP + PPPR++ PS PP SP P R+ P +RR Sbjct: 238 ARRRRSP--SPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSP--PIQRR 293 Query: 405 T*RQRCRPLRRSARGGGPP---AGPEP 476 P RR+A PP A P P Sbjct: 294 Y-SPSPPPKRRTASPPPPPKRRASPSP 319 [101][TOP] >UniRef100_UPI00015DF2E9 serine/arginine repetitive matrix 1 n=1 Tax=Mus musculus RepID=UPI00015DF2E9 Length = 897 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/87 (44%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 A RRR P SP+ PPPPPP PP + PPPR++ PS PP SP P R+ P +RR Sbjct: 567 ARRRRSP--SPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSP--PIQRR 622 Query: 405 T*RQRCRPLRRSARGGGPP---AGPEP 476 P RR+A PP A P P Sbjct: 623 Y-SPSPPPKRRTASPPPPPKRRASPSP 648 [102][TOP] >UniRef100_UPI00015DF2E8 serine/arginine repetitive matrix 1 n=1 Tax=Mus musculus RepID=UPI00015DF2E8 Length = 946 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/87 (44%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 A RRR P SP+ PPPPPP PP + PPPR++ PS PP SP P R+ P +RR Sbjct: 567 ARRRRSP--SPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSP--PIQRR 622 Query: 405 T*RQRCRPLRRSARGGGPP---AGPEP 476 P RR+A PP A P P Sbjct: 623 Y-SPSPPPKRRTASPPPPPKRRASPSP 648 [103][TOP] >UniRef100_Q4A263 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A263_EHV86 Length = 403 Score = 59.7 bits (143), Expect = 1e-07 Identities = 42/94 (44%), Positives = 46/94 (48%), Gaps = 5/94 (5%) Frame = +3 Query: 117 SSLPLRGCPTSSPP-PYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPP 293 SS P P SSPP P PS S SP P+ + P PS PP PPP+PPP Sbjct: 147 SSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSP------PSPPPSSPPSPPPSPPP 200 Query: 294 QSPLLLPP--PRQKPPSHPP--PPHSPPPTRHRP 383 SP PP P PPS PP PP SPP +P Sbjct: 201 SSPPSSPPSSPPSSPPSSPPSSPPSSPPSPPLQP 234 Score = 57.8 bits (138), Expect = 4e-07 Identities = 36/79 (45%), Positives = 37/79 (46%), Gaps = 4/79 (5%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP- 317 P SSPPP P SS P P PS PP PPP+PPP SP PP Sbjct: 145 PPSSPPPSPPPPSSPPSPP---------------PSSPPSSPPSPPPSPPPSSPPSPPPS 189 Query: 318 -PRQKPPSHPP--PPHSPP 365 P PPS PP PP SPP Sbjct: 190 SPPSPPPSPPPSSPPSSPP 208 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = +3 Query: 246 CWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPP--PPHSPP 365 C +P PPPPPP PPP SP PPP PPS PP PP SPP Sbjct: 133 CLTP--PPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPP 172 [104][TOP] >UniRef100_A2A8W1 Serine/arginine repetitive matrix 1 (Fragment) n=1 Tax=Mus musculus RepID=A2A8W1_MOUSE Length = 317 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/87 (44%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 A RRR P SP+ PPPPPP PP + PPPR++ PS PP SP P R+ P +RR Sbjct: 12 ARRRRSP--SPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSP--PIQRR 67 Query: 405 T*RQRCRPLRRSARGGGPP---AGPEP 476 P RR+A PP A P P Sbjct: 68 Y-SPSPPPKRRTASPPPPPKRRASPSP 93 [105][TOP] >UniRef100_A2A8V9 Serine/arginine repetitive matrix 1 n=1 Tax=Mus musculus RepID=A2A8V9_MOUSE Length = 918 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/87 (44%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 A RRR P SP+ PPPPPP PP + PPPR++ PS PP SP P R+ P +RR Sbjct: 562 ARRRRSP--SPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSP--PIQRR 617 Query: 405 T*RQRCRPLRRSARGGGPP---AGPEP 476 P RR+A PP A P P Sbjct: 618 Y-SPSPPPKRRTASPPPPPKRRASPSP 643 [106][TOP] >UniRef100_A2A8V8 Serine/arginine repetitive matrix 1 n=1 Tax=Mus musculus RepID=A2A8V8_MOUSE Length = 909 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/87 (44%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 A RRR P SP+ PPPPPP PP + PPPR++ PS PP SP P R+ P +RR Sbjct: 553 ARRRRSP--SPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSP--PIQRR 608 Query: 405 T*RQRCRPLRRSARGGGPP---AGPEP 476 P RR+A PP A P P Sbjct: 609 Y-SPSPPPKRRTASPPPPPKRRASPSP 634 [107][TOP] >UniRef100_B9LBU3 Putative uncharacterized protein n=1 Tax=Chloroflexus sp. Y-400-fl RepID=B9LBU3_CHLSY Length = 340 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/83 (39%), Positives = 39/83 (46%) Frame = +3 Query: 120 SLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQS 299 S P T +P P S +S SP + + AS SP+ PPPPPP PPP Sbjct: 236 STPSPTVVTVTPSPTTSPTASPTASPTASPTASPTASPTASATASPTEPPPPPPPPPPPP 295 Query: 300 PLLLPPPRQKPPSHPPPPHSPPP 368 + PPP P PPPP PPP Sbjct: 296 TVAPPPPPTVAPPPPPPPPPPPP 318 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/79 (43%), Positives = 40/79 (50%), Gaps = 3/79 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP---PPQSPLLL 311 PT+SP P+ +S SP + + AS P P PPPPPP P PP P + Sbjct: 249 PTTSPTASPT--ASPTASPTASPTASPTASATASPTEPPPPPPPPPPPPTVAPPPPPTVA 306 Query: 312 PPPRQKPPSHPPPPHSPPP 368 PPP PP PPPP PPP Sbjct: 307 PPPPPPPP--PPPPPPPPP 323 [108][TOP] >UniRef100_A9WHI6 Putative uncharacterized protein n=1 Tax=Chloroflexus aurantiacus J-10-fl RepID=A9WHI6_CHLAA Length = 344 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/76 (42%), Positives = 39/76 (51%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 PT+SP P+ +S SP + + AS SP+ PPPPPP PPP + PPP Sbjct: 249 PTTSPTASPT--ASPTASPTASPTASPTASPTASATASPTEPPPPPPPPPPPPTVAPPPP 306 Query: 321 RQKPPSHPPPPHSPPP 368 P PPPP PPP Sbjct: 307 PTVAPPPPPPPPPPPP 322 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/79 (43%), Positives = 40/79 (50%), Gaps = 3/79 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP---PPQSPLLL 311 PT+SP P+ +S SP + + AS P P PPPPPP P PP P + Sbjct: 253 PTASPTASPT--ASPTASPTASPTASPTASATASPTEPPPPPPPPPPPPTVAPPPPPTVA 310 Query: 312 PPPRQKPPSHPPPPHSPPP 368 PPP PP PPPP PPP Sbjct: 311 PPPPPPPP--PPPPPPPPP 327 [109][TOP] >UniRef100_A8ZKH4 Putative uncharacterized protein n=1 Tax=Acaryochloris marina MBIC11017 RepID=A8ZKH4_ACAM1 Length = 509 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/77 (40%), Positives = 41/77 (53%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+S+P P P+ + A +P P A P +P + PPP PAP P +P +PPP Sbjct: 432 PSSAPAPAPAPAPAPAPAPAPAPAPVYVPPPAPAPAPAPVYVPPPAPAPAP-APAYVPPP 490 Query: 321 RQKPPSHPPPPHSPPPT 371 P PPPP +PPPT Sbjct: 491 APAPAPAPPPPMAPPPT 507 [110][TOP] >UniRef100_C1MSQ5 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MSQ5_9CHLO Length = 1516 Score = 59.7 bits (143), Expect = 1e-07 Identities = 35/88 (39%), Positives = 37/88 (42%) Frame = +3 Query: 132 RGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLL 311 R P+S PPP P SP P P SP PPPPPP PP SP Sbjct: 1041 RAAPSSPPPPPPPPPPPSPPSPPP-------------PNGSPQPPPPPPPPPPLPSPPPS 1087 Query: 312 PPPRQKPPSHPPPPHSPPPTRHRPCGTC 395 PPP PS PPPP PT +C Sbjct: 1088 PPPPSPSPSPPPPPPYALPTSPADSSSC 1115 [111][TOP] >UniRef100_Q2U304 Predicted protein n=1 Tax=Aspergillus oryzae RepID=Q2U304_ASPOR Length = 463 Score = 59.7 bits (143), Expect = 1e-07 Identities = 48/134 (35%), Positives = 59/134 (44%), Gaps = 14/134 (10%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCW-----SPSWPPPPPPA-P 287 P R P PPP P ++ A P A A A + + +PS PPPPPPA Sbjct: 285 PARSTPPPPPPPPPP--AASAPQPPNGTAAASIAVQAARNAFGHSQQTPSAPPPPPPASS 342 Query: 288 PPQSPLLLPPPRQKPPSHPP--PPHSPP------PTRHRPCGTCRRRT*RQRCRPLRRSA 443 P +P PPP PPS PP PP +PP P H P + + R P + Sbjct: 343 APSAP--PPPPPSAPPSAPPSAPPSAPPSQPPSRPLSHEPLAS--QLPDRSTLDPSAYTL 398 Query: 444 RGGGPPAGPEPLSS 485 GGP +G PLSS Sbjct: 399 SNGGPSSGSSPLSS 412 [112][TOP] >UniRef100_C5JPP7 Predicted protein n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JPP7_AJEDS Length = 260 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/87 (37%), Positives = 39/87 (44%), Gaps = 6/87 (6%) Frame = +3 Query: 144 TSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPR 323 TSSPP P+ ++ A P P PPPP PPP P +PPP Sbjct: 97 TSSPPSPPAPITTKASEPPP---------------------PPPPAIPPPPPPPAVPPPS 135 Query: 324 QKPPSHPPPPHSPPP------TRHRPC 386 PP+ PPPP + PP T HRPC Sbjct: 136 PPPPATPPPPPTFPPPPGGICTEHRPC 162 [113][TOP] >UniRef100_B8NIL1 Proline-rich, actin-associated protein Vrp1, putative n=1 Tax=Aspergillus flavus NRRL3357 RepID=B8NIL1_ASPFN Length = 463 Score = 59.7 bits (143), Expect = 1e-07 Identities = 48/134 (35%), Positives = 59/134 (44%), Gaps = 14/134 (10%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCW-----SPSWPPPPPPA-P 287 P R P PPP P ++ A P A A A + + +PS PPPPPPA Sbjct: 285 PARSTPPPPPPPPPP--AASAPQPPNGTAAASIAVQAARNAFGHSQQTPSAPPPPPPASS 342 Query: 288 PPQSPLLLPPPRQKPPSHPP--PPHSPP------PTRHRPCGTCRRRT*RQRCRPLRRSA 443 P +P PPP PPS PP PP +PP P H P + + R P + Sbjct: 343 APSAP--PPPPPSAPPSAPPSAPPSAPPSQPPSRPLSHEPLAS--QLPDRSTLDPSAYTL 398 Query: 444 RGGGPPAGPEPLSS 485 GGP +G PLSS Sbjct: 399 SNGGPSSGSSPLSS 412 [114][TOP] >UniRef100_Q52KI8-2 Isoform 2 of Serine/arginine repetitive matrix protein 1 n=1 Tax=Mus musculus RepID=Q52KI8-2 Length = 897 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/87 (44%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 A RRR P SP+ PPPPPP PP + PPPR++ PS PP SP P R+ P +RR Sbjct: 567 ARRRRSP--SPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSP--PIQRR 622 Query: 405 T*RQRCRPLRRSARGGGPP---AGPEP 476 P RR+A PP A P P Sbjct: 623 Y-SPSPPPKRRTASPPPPPKRRASPSP 648 [115][TOP] >UniRef100_Q52KI8 Serine/arginine repetitive matrix protein 1 n=1 Tax=Mus musculus RepID=SRRM1_MOUSE Length = 946 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/87 (44%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 A RRR P SP+ PPPPPP PP + PPPR++ PS PP SP P R+ P +RR Sbjct: 567 ARRRRSP--SPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSP--PIQRR 622 Query: 405 T*RQRCRPLRRSARGGGPP---AGPEP 476 P RR+A PP A P P Sbjct: 623 Y-SPSPPPKRRTASPPPPPKRRASPSP 648 [116][TOP] >UniRef100_A0E3T6 Chromosome undetermined scaffold_77, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0E3T6_PARTE Length = 1215 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 31/83 (37%), Positives = 35/83 (42%), Gaps = 4/83 (4%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSH----PPPPHSPPPTRHRPCGTCRRRT*RQRC 422 P PPPPPP PPP PPP PPS PPPP PPP+ + Sbjct: 656 PPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPS-------------KTGA 702 Query: 423 RPLRRSARGGGPPAGPEPLSSTR 491 P R GG P P PL + + Sbjct: 703 PPPPPPPRIGGAPPPPPPLGNNQ 725 Score = 25.8 bits (55), Expect(2) = 1e-07 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 139 VPPPPPLPTLPTSPAVP 189 +PPPPP P LP + P Sbjct: 641 LPPPPPPPPLPNTQVPP 657 [117][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 30/76 (39%), Positives = 36/76 (47%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P+ ++ G P P S P + P PPPPPPA P P PP Sbjct: 271 PPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPP-PPPPPPAYAPPPPPAYGPP 329 Query: 321 RQKPPSHPPPPHSPPP 368 PP PPP ++PPP Sbjct: 330 APPPPPPPPPAYAPPP 345 Score = 22.3 bits (46), Expect(2) = 1e-07 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 121 PCRYAGVPPPPPLP 162 P Y+ PPPPP P Sbjct: 241 PPAYSPPPPPPPPP 254 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/77 (40%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSW-PPPPPPAPPPQSPLLLPP 317 P PPP P++ P P A G P P++ PPPPPP PPP + P Sbjct: 234 PPPPPPPPPAYSPPPPPPPPPPPAAYG-------PPPPPAYGPPPPPPPPPPPAAYAYGP 286 Query: 318 PRQKPPSHPPPPHSPPP 368 P PP PPP +SPPP Sbjct: 287 PPPPPPPPPPPAYSPPP 303 Score = 55.8 bits (133), Expect(2) = 3e-07 Identities = 32/76 (42%), Positives = 38/76 (50%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P++ G P P A A P + P PPPPPP PP +P PPP Sbjct: 297 PAYSPPPPPAY---GPPPPPPPPAYAPPPP----PAYGPPAPPPPPPPPPAYAP--PPPP 347 Query: 321 RQKPPSHPPPPHSPPP 368 P PPP ++PPP Sbjct: 348 PAYAPPPPPPAYAPPP 363 Score = 21.9 bits (45), Expect(2) = 3e-07 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 121 PCRYAGVPPPPPLP 162 P Y PPPPP P Sbjct: 264 PPAYGPPPPPPPPP 277 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/76 (39%), Positives = 37/76 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P +PPP P++ P P G P P++ PPPPP PPP P PPP Sbjct: 104 PAYAPPPPPAYAPPPPPPPPPPPPSYG-------PPPPPAYGPPPPPPPPPPPPAYGPPP 156 Query: 321 RQKPPSHPPPPHSPPP 368 PP++ PPP PPP Sbjct: 157 ---PPAYGPPPPPPPP 169 Score = 57.0 bits (136), Expect = 7e-07 Identities = 30/76 (39%), Positives = 37/76 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP P++ P P G P P++ PPPPP PPP P PPP Sbjct: 127 PSYGPPPPPAYGPPPPPPPPPPPPAYG-------PPPPPAYGPPPPPPPPPPPPAYGPPP 179 Query: 321 RQKPPSHPPPPHSPPP 368 PP++ PPP PPP Sbjct: 180 ---PPAYGPPPPPPPP 192 Score = 57.0 bits (136), Expect = 7e-07 Identities = 32/84 (38%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P++ P P G P P++ PPPPP PPP P PPP Sbjct: 173 PAYGPPPPPAYGPPPPPPPPPPPPAYG-------PPPPPAYGPPPPPPPPPPPPAYGPPP 225 Query: 321 RQKPPSH---PPPPHSPPPTRHRP 383 PP++ PPPP PPP + P Sbjct: 226 ---PPAYGPPPPPPPPPPPPAYSP 246 Score = 55.8 bits (133), Expect = 2e-06 Identities = 32/84 (38%), Positives = 38/84 (45%), Gaps = 3/84 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P++ P P G P P++ PPPPP PPP P PPP Sbjct: 196 PAYGPPPPPAYGPPPPPPPPPPPPAYG-------PPPPPAYGPPPPPPPPPPPPAYSPPP 248 Query: 321 RQKPPSHPPPPHS---PPPTRHRP 383 PP PPPP + PPP + P Sbjct: 249 ---PPPPPPPPAAYGPPPPPAYGP 269 Score = 55.1 bits (131), Expect = 3e-06 Identities = 31/76 (40%), Positives = 38/76 (50%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P +PPP P ++ P P A A P P++ PPPPP PPP P PPP Sbjct: 86 PVYAPPPPPPAYAP----PPPPPAYA--------PPPPPAYAPPPPPPPPPPPPSYGPPP 133 Query: 321 RQKPPSHPPPPHSPPP 368 PP++ PPP PPP Sbjct: 134 ---PPAYGPPPPPPPP 146 Score = 53.5 bits (127), Expect = 8e-06 Identities = 31/79 (39%), Positives = 36/79 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P++ P P P +SP PPPPPP PPP + PPP Sbjct: 219 PAYGPPPPPAYGPPPPPPPPPPP-----------PAYSP--PPPPPPPPPPAAYGPPPPP 265 Query: 321 RQKPPSHPPPPHSPPPTRH 377 PP PPPP PPP + Sbjct: 266 AYGPP--PPPPPPPPPAAY 282 [118][TOP] >UniRef100_UPI000179680F PREDICTED: similar to WW domain-binding protein 7 (WBP-7) (Myeloid/lymphoid or mixed-lineage leukemia protein 4) (Trithorax homolog 2) (Lysine N-methyltransferase 2D) n=1 Tax=Equus caballus RepID=UPI000179680F Length = 2617 Score = 59.3 bits (142), Expect = 1e-07 Identities = 42/101 (41%), Positives = 46/101 (45%), Gaps = 17/101 (16%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPP----PQSPLLLPPP---RQKPPSHPPPP------HSPPPTRHRP 383 P +P PPPPPP PP P SPL PPP PPS PPPP SPPP Sbjct: 419 PPLTPPAPPPPPPLPPASTSPPSPLCPPPPPVSPPPPPSPPPPPAPEEQEESPPPVVPAT 478 Query: 384 CGTCRRR---T*RQRC-RPLRRSARGGGPPAGPEPLSSTRG 494 C R R T QR R R+ G P P P ++T G Sbjct: 479 CSRKRGRPPLTPSQRAEREAARAGPEGTSPPTPAPSTTTTG 519 [119][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/80 (41%), Positives = 36/80 (45%) Frame = +3 Query: 144 TSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPR 323 TS PPP P SP P P P + PPPPP PPP P+ PPP Sbjct: 424 TSPPPPSPP---PPVYSPPPPP-----------PPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Query: 324 QKPPSHPPPPHSPPPTRHRP 383 PP PPP +SPPP P Sbjct: 470 PPPPPPPPPVYSPPPPSPPP 489 Score = 59.3 bits (142), Expect = 1e-07 Identities = 37/81 (45%), Positives = 39/81 (48%), Gaps = 5/81 (6%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGAL-SP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLL-- 311 P SPPP P + S SP PT R P P PPPP +PPP P Sbjct: 508 PVYSPPPPPVYSSPPPPPSPAPTPVYC-----TRPPPPPPHSPPPPQFSPPPPEPYYYSS 562 Query: 312 -PPPRQKPPSH-PPPPHSPPP 368 PPP PP H PPPPHSPPP Sbjct: 563 PPPPHSSPPPHSPPPPHSPPP 583 Score = 58.2 bits (139), Expect = 3e-07 Identities = 35/87 (40%), Positives = 39/87 (44%), Gaps = 6/87 (6%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP------APPPQSP 302 P PPP P +S P P P +SP PPPPPP +PPP SP Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPP----------PVYSPPPPPPPPPPPPPVYSPPPPSP 487 Query: 303 LLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP PP PPPP PPP + P Sbjct: 488 PPPPPPVYSPP--PPPPPPPPPPVYSP 512 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/76 (39%), Positives = 34/76 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P +S P P P P + PPPP PPP P+ PPP Sbjct: 453 PPPPPPPPPPVYSPPPPPPPP-------------PPPPPVYSPPPPSPPPPPPPVYSPPP 499 Query: 321 RQKPPSHPPPPHSPPP 368 PP PPP +SPPP Sbjct: 500 -PPPPPPPPPVYSPPP 514 Score = 53.5 bits (127), Expect = 8e-06 Identities = 39/106 (36%), Positives = 42/106 (39%), Gaps = 25/106 (23%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSP------SWPPPPP-------- 278 P S PPP P +S P P P +SP S PPPPP Sbjct: 484 PPSPPPPPPPVYSPPPPPPPPPPP----------PVYSPPPPPVYSSPPPPPSPAPTPVY 533 Query: 279 ----PAPPPQSPLLLPPPRQKPP-------SHPPPPHSPPPTRHRP 383 P PPP SP PPP+ PP S PPPPHS PP P Sbjct: 534 CTRPPPPPPHSP---PPPQFSPPPPEPYYYSSPPPPHSSPPPHSPP 576 [120][TOP] >UniRef100_Q7XHB6 Transposon protein, putative, CACTA, En/Spm sub-class n=2 Tax=Oryza sativa RepID=Q7XHB6_ORYSJ Length = 773 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 243 PCWSPSWPPPPPPAP-PPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 P SP PPPPPPAP PP P PPP PP+ PPPP PPP P T R+ Sbjct: 423 PAPSPPAPPPPPPAPSPPAPPPPPPPPAPSPPAPPPPPPPPPPCPPAPPKTRSRQ 477 [121][TOP] >UniRef100_Q58NA5 Plus agglutinin (Fragment) n=1 Tax=Chlamydomonas incerta RepID=Q58NA5_CHLIN Length = 2371 Score = 59.3 bits (142), Expect = 1e-07 Identities = 42/120 (35%), Positives = 47/120 (39%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P S PPP P S SP P P +P PPPP P PP +P Sbjct: 1012 PPSPAPPSPPPPSPEPPSPAPPSPPPPSPEP--------PSPAPPSPPPPSPEPPSPAPP 1063 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSS 485 PPP +PPS P P SPPP P P + PP+ PEP SS Sbjct: 1064 SPPPPSPEPPS--PAPPSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSAPPS-PEPQSS 1120 Score = 58.9 bits (141), Expect = 2e-07 Identities = 42/119 (35%), Positives = 48/119 (40%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P + PP P+ S SP PT AS PS PP PP+P P SP Sbjct: 1221 PPSPAPPAPQPPSPAPPSPNPPSPAPTTP----ASPEPPSPQPPSPSPPVPPSPAPPSPA 1276 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 LPPP PPS PP +PPP+ P P PP+ PEP S Sbjct: 1277 PLPPPSPDPPSPVPPSPAPPPSPPAP--------------PSPEPIPPAPPPSPPEPPS 1321 Score = 58.5 bits (140), Expect = 2e-07 Identities = 42/122 (34%), Positives = 46/122 (37%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQ 296 S P P S PPP P S SP P P +P PPPP P PP Sbjct: 724 SPQPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEP--------PSPAPPSPPPPSPEPPSP 775 Query: 297 SPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 +P PPP +PPS P PP PPP+ P A PP PEP Sbjct: 776 APPSPPPPSPEPPS-PAPPSPPPPSPEPP-----------------SPAPPSPPPPSPEP 817 Query: 477 LS 482 S Sbjct: 818 PS 819 Score = 58.2 bits (139), Expect = 3e-07 Identities = 41/119 (34%), Positives = 45/119 (37%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P S PPP P S SP P P +P PPPP P PP +P Sbjct: 757 PPSPAPPSPPPPSPEPPSPAPPSPPPPSPEP--------PSPAPPSPPPPSPEPPSPAPP 808 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPP +PPS P PP PPP+ P A PP PEP S Sbjct: 809 SPPPPSPEPPS-PAPPSPPPPSPEPP-----------------SPAPPSPPPPSPEPPS 849 Score = 58.2 bits (139), Expect = 3e-07 Identities = 42/119 (35%), Positives = 48/119 (40%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P S PPP P S SP P+ + P +P PPPP PAPP +P Sbjct: 847 PPSPAPPSPPPPSPEPPSPAPPSP-PSPSPEP-------PSPAPPSPPPPSPAPPSPAPP 898 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPP +PPS P PP PPP+ P A PP PEP S Sbjct: 899 SPPPPSPEPPS-PAPPSPPPPSPEPP-----------------SPASPSPPPPSPEPPS 939 Score = 58.2 bits (139), Expect = 3e-07 Identities = 41/119 (34%), Positives = 45/119 (37%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P S PPP P S SP P P +P PPPP P PP +P Sbjct: 982 PPSPAPPSPPPPSPEPPSPAPPSPTPPSPEP--------PSPAPPSPPPPSPEPPSPAPP 1033 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPP +PPS P PP PPP+ P A PP PEP S Sbjct: 1034 SPPPPSPEPPS-PAPPSPPPPSPEPP-----------------SPAPPSPPPPSPEPPS 1074 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/86 (39%), Positives = 38/86 (44%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P S PPP P S SP P P +P PPPP P PP +P Sbjct: 787 PPSPAPPSPPPPSPEPPSPAPPSPPPPSPEP--------PSPAPPSPPPPSPEPPSPAPP 838 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP +PPS P PP PPP+ P Sbjct: 839 SPPPPSPEPPS-PAPPSPPPPSPEPP 863 Score = 57.4 bits (137), Expect = 5e-07 Identities = 38/97 (39%), Positives = 40/97 (41%), Gaps = 8/97 (8%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQ 296 S P P S PPP P S SP P + P SP P P PP+PPP Sbjct: 889 SPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPP 948 Query: 297 SPLLLPPPRQKPPSHPPP--------PHSPPPTRHRP 383 SP PP PPS PPP P SPPP P Sbjct: 949 SP---EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEP 982 Score = 55.5 bits (132), Expect = 2e-06 Identities = 42/121 (34%), Positives = 47/121 (38%), Gaps = 2/121 (1%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P S PPP P+ S SP P SP+ P PPPP+P P SP Sbjct: 877 PPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPP----------SPAPPSPPPPSPEPPSPA 926 Query: 306 --LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPL 479 PPP +PPS P PP PPP+ P A PP PEP Sbjct: 927 SPSPPPPSPEPPS-PAPPSPPPPSPEPP-----------------SPAPPSPPPPSPEPP 968 Query: 480 S 482 S Sbjct: 969 S 969 Score = 55.1 bits (131), Expect = 3e-06 Identities = 41/119 (34%), Positives = 45/119 (37%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P S PPP P S SP P P +P PPPP P PP +P Sbjct: 802 PPSPAPPSPPPPSPEPPSPAPPSPPPPSPEP--------PSPAPPSPPPPSPEPPSPAPP 853 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPP +PPS P PP P P+ P P A PP PEP S Sbjct: 854 SPPPPSPEPPS-PAPPSPPSPSPEPPSPAPPSPPPPSPAPP--SPAPPSPPPPSPEPPS 909 Score = 55.1 bits (131), Expect = 3e-06 Identities = 40/119 (33%), Positives = 44/119 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P S PPP P S SP P P +P PPPP P PP +P Sbjct: 937 PPSPAPPSPPPPSPEPPSPAPPSPPPPSPEP--------PSPAPPSPPPPSPEPPSPAPP 988 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPP +PPS P PP PP+ P A PP PEP S Sbjct: 989 SPPPPSPEPPS-PAPPSPTPPSPEPP-----------------SPAPPSPPPPSPEPPS 1029 Score = 54.7 bits (130), Expect = 3e-06 Identities = 42/129 (32%), Positives = 49/129 (37%), Gaps = 7/129 (5%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PT-------RAGAG*ASRRRWPCWSPSWPPPP 275 S P P S PPP P+ S SP P + + P +P PPPP Sbjct: 679 SPTPPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPP 738 Query: 276 PPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGG 455 P PP +P PPP +PPS P PP PPP+ P A Sbjct: 739 SPEPPSPAPPSPPPPSPEPPS-PAPPSPPPPSPEPP-----------------SPAPPSP 780 Query: 456 PPAGPEPLS 482 PP PEP S Sbjct: 781 PPPSPEPPS 789 [122][TOP] >UniRef100_C5XS10 Putative uncharacterized protein Sb04g033190 n=1 Tax=Sorghum bicolor RepID=C5XS10_SORBI Length = 160 Score = 59.3 bits (142), Expect = 1e-07 Identities = 40/113 (35%), Positives = 47/113 (41%), Gaps = 2/113 (1%) Frame = +3 Query: 36 PAVASWRAGSCARQTRCPLLKRRELGG--SSLPLRGCPTSSPPPYPSHFSSGALSP*PTR 209 P V + SCA Q P S+ P + P +PPP P +G P PT Sbjct: 7 PLVLALLIASCAAQQSPPAQPPPTPNAPPSNSPPQAPPAGNPPPAPQAPPAGNPPPAPT- 65 Query: 210 AGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 A A P P+ PPP P PPP P PP PPS PP P +P P Sbjct: 66 ATPPPAPTSTPPPAPPTTPPPAPTTPPPAPPTTPPPAPTTPPSSPPSPKAPSP 118 [123][TOP] >UniRef100_A8HYC3 Hydroxyproline-rich glycoprotein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HYC3_CHLRE Length = 612 Score = 59.3 bits (142), Expect = 1e-07 Identities = 37/86 (43%), Positives = 39/86 (45%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P CP+ PPP L P P P SP P PPPP+PPP SP Sbjct: 499 PALCCPSPPPPP--------PLPPSP-------------PPPSPPPPSPPPPSPPPPSP- 536 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP PPS PPPP PPP R P Sbjct: 537 --PPPAPPPPS-PPPPRPPPPPRLPP 559 Score = 54.3 bits (129), Expect = 4e-06 Identities = 33/88 (37%), Positives = 39/88 (44%), Gaps = 5/88 (5%) Frame = +3 Query: 240 WPCWSPS-WPPPPPPAPPPQSPLLLPPPRQKPPSHPP----PPHSPPPTRHRPCGTCRRR 404 WP PS PP PPP+P P SP PP +PPS PP PP SPPP Sbjct: 344 WPSPPPSPMPPSPPPSPAPPSPPSPRPPSPRPPSPPPALPSPPASPPPPTFLQIRITGAN 403 Query: 405 T*RQRCRPLRRSARGGGPPAGPEPLSST 488 + C L + +G +PLS T Sbjct: 404 MLKMNCTALAGATTLSILTSGLQPLSDT 431 [124][TOP] >UniRef100_A7Z068 LMOD2 protein n=1 Tax=Bos taurus RepID=A7Z068_BOVIN Length = 553 Score = 59.3 bits (142), Expect = 1e-07 Identities = 43/103 (41%), Positives = 49/103 (47%), Gaps = 6/103 (5%) Frame = +3 Query: 72 RQTRCPLLKRREL--GGSSLPL----RGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASR 233 RQ R K++E GG++L RG P SSP P H S SP + SR Sbjct: 356 RQKRMQEQKQQEGYDGGANLRTKVWQRGTPGSSPYASPKH--SPWSSPKLPKKVQTVRSR 413 Query: 234 RRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSP 362 P P PPPPPP PPP P L P R PP PPPP +P Sbjct: 414 PPSPAAPPPPPPPPPPPPPPPPPPPLAPQRLPPPPPPPPPPAP 456 [125][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/63 (50%), Positives = 33/63 (52%), Gaps = 8/63 (12%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP----TRHRPCG----TCRRRT* 410 P PPPPPP PPP P PPP PP PPPP PPP TR+ P CR R Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLSGVLCRDRKH 68 Query: 411 RQR 419 RQR Sbjct: 69 RQR 71 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/70 (44%), Positives = 32/70 (45%), Gaps = 3/70 (4%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCR---RRT*RQRCR 425 P PPPPPP PPP P PPP PP PPPP PPP P R RR CR Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLSGVLCR 64 Query: 426 PLRRSARGGG 455 + R G Sbjct: 65 DRKHRQRSAG 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 PPPPPP PPP P PPP PP PPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 PPPPPP PPP P PPP PP PPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 [126][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/43 (60%), Positives = 27/43 (62%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PS PPP PP+PPP SP PPP PPS PPP SPPP P Sbjct: 159 PSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASP 201 Score = 57.4 bits (137), Expect = 5e-07 Identities = 36/77 (46%), Positives = 38/77 (49%) Frame = +3 Query: 138 CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP 317 C SPPP P S SP P+ PS PPPPPP+PPP SP PP Sbjct: 147 CKLPSPPPPPPPPSPPPPSP-PSPP-------------PPSPPPPPPPSPPPPSP---PP 189 Query: 318 PRQKPPSHPPPPHSPPP 368 P PS PPPP SPPP Sbjct: 190 P---SPSPPPPPASPPP 203 Score = 57.0 bits (136), Expect = 7e-07 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHP-PPPHSPPPTRHRP 383 PPPPPP+PPP SP PPP PP P PPP SPPP P Sbjct: 154 PPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSP 194 [127][TOP] >UniRef100_Q4RSI9 Chromosome 13 SCAF15000, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4RSI9_TETNG Length = 307 Score = 51.2 bits (121), Expect(3) = 2e-07 Identities = 24/41 (58%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPS--HPPPPHSPPPT 371 P +PPPPPP PPP P PPP PPS PPP SPPP+ Sbjct: 186 PLFPPPPPPPPPP--PFSPPPPPSPPPSLFSPPPFFSPPPS 224 Score = 23.5 bits (49), Expect(3) = 2e-07 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 142 PPPPPLPTLP 171 PPPPPLP P Sbjct: 172 PPPPPLPPPP 181 Score = 23.5 bits (49), Expect(3) = 2e-07 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 145 PPPPLPTLPTSPAVP 189 PPPP P P P P Sbjct: 178 PPPPFPLFPLFPPPP 192 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/52 (51%), Positives = 29/52 (55%), Gaps = 5/52 (9%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLL-----LPPPRQKPPSHPPPPHSPPPTRHRP 383 P SP + PPPPP PPP PL PPP PP PPPP SPPP+ P Sbjct: 164 PPLSPPYFPPPPPLPPPPFPLFPLFPPPPPPPPPPPFSPPPPPSPPPSLFSP 215 [128][TOP] >UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019841A9 Length = 525 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/73 (43%), Positives = 36/73 (49%) Frame = +3 Query: 150 SPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQK 329 SPPP P + SP P + P SPS PPPP +PPP P+ PPP Sbjct: 420 SPPPTPVYSPPPVFSPPPPVLSSPPPPSPPPP--SPSPPPPPVYSPPPPPPVYSPPPPPP 477 Query: 330 PPSHPPPPHSPPP 368 PP PPP SPPP Sbjct: 478 PPPPPPPVXSPPP 490 [129][TOP] >UniRef100_UPI0001982977 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982977 Length = 1622 Score = 58.9 bits (141), Expect = 2e-07 Identities = 44/119 (36%), Positives = 48/119 (40%), Gaps = 1/119 (0%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 PL P PPP+PS L P P AG P PPPP PPP P Sbjct: 1228 PLSPSPPPPPPPFPSQLPP--LPPPP--AGP-----------PPPTGPPPPAGPPP--PT 1270 Query: 306 LLPPPRQKPPSH-PPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPL 479 + PPP PPS PPPP PPP+ P P+ G PP GP PL Sbjct: 1271 VHPPPMGPPPSTGPPPPMGPPPSTGPP-------------PPMGPPPPMGPPPRGPPPL 1316 Score = 57.4 bits (137), Expect = 5e-07 Identities = 43/114 (37%), Positives = 46/114 (40%), Gaps = 2/114 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P L P P P SPS PPPPPP P PL PP Sbjct: 1207 PIDSPPPPPP------LPPSPPPPPP--------PPLSPSPPPPPPPFPSQLPPLPPPPA 1252 Query: 321 RQKPPSHPPPPHS-PPPTRHRPCGTCRRRT*RQRCRPL-RRSARGGGPPAGPEP 476 PP+ PPPP PPPT H P P+ + G PP GP P Sbjct: 1253 GPPPPTGPPPPAGPPPPTVHPP--------------PMGPPPSTGPPPPMGPPP 1292 [130][TOP] >UniRef100_UPI0000E12BCF Os07g0596300 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E12BCF Length = 754 Score = 58.9 bits (141), Expect = 2e-07 Identities = 42/117 (35%), Positives = 49/117 (41%), Gaps = 5/117 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*P--TRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLP 314 P PPP +HF++ P P TR+GA P P P PPPP PPP + P Sbjct: 142 PPPPPPPPTTHFNAPPPPPPPPITRSGA--------PPSPPPPPSPPPPPPPPGARPGPP 193 Query: 315 PPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCR---PLRRSARGGGPPAGPEP 476 PP P + P PP PPP RP + P S R G PP P P Sbjct: 194 PPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPP 250 Score = 54.3 bits (129), Expect = 4e-06 Identities = 50/160 (31%), Positives = 58/160 (36%), Gaps = 32/160 (20%) Frame = +3 Query: 99 RRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP 278 R +GG++ P +PPP P + A+SP P PC P PPPPP Sbjct: 35 RSGVGGNTPP-------APPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPP 87 Query: 279 PAP--------------PPQSPLL--LPPPRQKPP-SHP---------------PPPHSP 362 P P PP PLL +PPP PP SH PPP P Sbjct: 88 PPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPPPPP 147 Query: 363 PPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPT H P R G PP+ P P S Sbjct: 148 PPTTHFNA---------PPPPPPPPITRSGAPPSPPPPPS 178 Score = 54.3 bits (129), Expect = 4e-06 Identities = 43/124 (34%), Positives = 48/124 (38%), Gaps = 8/124 (6%) Frame = +3 Query: 129 LRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP------PAPP 290 LR P PPP SH ++ P P A+R +P PPPPP P PP Sbjct: 111 LRSVPPPPPPPPISHSNAPPPPPLP-------AARFN----APPPPPPPPTTHFNAPPPP 159 Query: 291 PQSPLLL--PPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPA 464 P P+ PP PP PPPP PP R P P AR G PP Sbjct: 160 PPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPP-----------PPPPGARPGPPPP 208 Query: 465 GPEP 476 P P Sbjct: 209 PPPP 212 [131][TOP] >UniRef100_UPI0000DA1CBA PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA1CBA Length = 200 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -3 Query: 367 GGGECGGGGCDGGF*RGGGSRSGDCGGGAGGGGGGHDGDQHG 242 GGG GGGGCDGG GGG G GGG GGGGGG DG + G Sbjct: 76 GGGGGGGGGCDGGGGGGGGGDGGGGGGGGGGGGGGGDGGRGG 117 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -3 Query: 367 GGGECGGGGCDGGF*RGGGSRSGDCGGGAGGGGGGHDGDQHG 242 GGG GGGGCDGG GGG GD GGG GGGGGG DG G Sbjct: 54 GGGGGGGGGCDGG---GGGGGGGD-GGGGGGGGGGCDGGGGG 91 [132][TOP] >UniRef100_UPI00005DC1BB PERK10 (PROLINE-RICH EXTENSIN-LIKE RECEPTOR KINASE 10); ATP binding / protein kinase/ protein serine/threonine kinase/ protein tyrosine kinase n=1 Tax=Arabidopsis thaliana RepID=UPI00005DC1BB Length = 762 Score = 58.9 bits (141), Expect = 2e-07 Identities = 47/125 (37%), Positives = 48/125 (38%), Gaps = 16/125 (12%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWP--PPPPPAPPPQSPL--- 305 P SSPPP S P PT A P SPS P PPPPP PP P Sbjct: 114 PVSSPPP-----ESSPPPPPPTEAPP------TTPITSPSPPTNPPPPPESPPSLPAPDP 162 Query: 306 ---LLPPPRQKPPSHPPPPH--------SPPPTRHRPCGTCRRRT*RQRCRPLRRSARGG 452 LPPP+ PPSH PP H PPP RH P R P S Sbjct: 163 PSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERP----STPPSDSEHPS 218 Query: 453 GPPAG 467 PP G Sbjct: 219 PPPPG 223 Score = 53.5 bits (127), Expect = 8e-06 Identities = 34/101 (33%), Positives = 40/101 (39%), Gaps = 13/101 (12%) Frame = +3 Query: 120 SLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP-------- 275 S P P SSPPP PS S P PT P P+ PPP Sbjct: 60 SSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPP 119 Query: 276 -----PPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PP PP ++P P PP++PPPP PP+ P Sbjct: 120 PESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAP 160 [133][TOP] >UniRef100_Q9C660 Pto kinase interactor, putative n=1 Tax=Arabidopsis thaliana RepID=Q9C660_ARATH Length = 760 Score = 58.9 bits (141), Expect = 2e-07 Identities = 47/125 (37%), Positives = 48/125 (38%), Gaps = 16/125 (12%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWP--PPPPPAPPPQSPL--- 305 P SSPPP S P PT A P SPS P PPPPP PP P Sbjct: 114 PVSSPPP-----ESSPPPPPPTEAPP------TTPITSPSPPTNPPPPPESPPSLPAPDP 162 Query: 306 ---LLPPPRQKPPSHPPPPH--------SPPPTRHRPCGTCRRRT*RQRCRPLRRSARGG 452 LPPP+ PPSH PP H PPP RH P R P S Sbjct: 163 PSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERP----STPPSDSEHPS 218 Query: 453 GPPAG 467 PP G Sbjct: 219 PPPPG 223 Score = 53.5 bits (127), Expect = 8e-06 Identities = 34/101 (33%), Positives = 40/101 (39%), Gaps = 13/101 (12%) Frame = +3 Query: 120 SLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP-------- 275 S P P SSPPP PS S P PT P P+ PPP Sbjct: 60 SSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPP 119 Query: 276 -----PPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PP PP ++P P PP++PPPP PP+ P Sbjct: 120 PESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAP 160 [134][TOP] >UniRef100_Q6ZD62 Os08g0108300 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ZD62_ORYSJ Length = 342 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/82 (41%), Positives = 37/82 (45%), Gaps = 6/82 (7%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP------PPQSP 302 P+ PPP P +P P RR P SP PPPPP P PP P Sbjct: 106 PSMPPPPPPRRAPPPPATPPPP-------PRRAPPPPSPPIRPPPPPTPRPYAPPPPSHP 158 Query: 303 LLLPPPRQKPPSHPPPPHSPPP 368 L PPP PP+ PPP SPPP Sbjct: 159 LAPPPPHISPPAPVPPPPSPPP 180 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/84 (40%), Positives = 38/84 (45%), Gaps = 3/84 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP---APPPQSPLLL 311 P+ +PPP AL P P R PS PPPPPP PPP +P Sbjct: 78 PSQAPPPPRRAPPPPALPPPPPRRAPP----------PPSMPPPPPPRRAPPPPATP--P 125 Query: 312 PPPRQKPPSHPPPPHSPPPTRHRP 383 PPPR+ PP PP PPP RP Sbjct: 126 PPPRRAPPPPSPPIRPPPPPTPRP 149 [135][TOP] >UniRef100_Q5VR46 Os01g0180000 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5VR46_ORYSJ Length = 520 Score = 58.9 bits (141), Expect = 2e-07 Identities = 38/92 (41%), Positives = 41/92 (44%), Gaps = 9/92 (9%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP +P+ PP Sbjct: 381 PPSPPPPSPPPPSPPPPSPPPPSTSP--------PPPSPPPPSPPPPSPPPPAPIFHPP- 431 Query: 321 RQKPPSHPPP---PH------SPPPTRHRPCG 389 Q PP PPP PH PPP PCG Sbjct: 432 -QPPPPPPPPAPQPHPPCPELPPPPPPPPPCG 462 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 255 PSWPPP--PPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P+ PPP PPP+PPP SP PPP PPS PPP SPPP P Sbjct: 377 PALPPPSPPPPSPPPPSP---PPPSPPPPSTSPPPPSPPPPSPPP 418 [136][TOP] >UniRef100_C5XEJ9 Putative uncharacterized protein Sb03g029150 n=1 Tax=Sorghum bicolor RepID=C5XEJ9_SORBI Length = 736 Score = 58.9 bits (141), Expect = 2e-07 Identities = 47/162 (29%), Positives = 62/162 (38%), Gaps = 7/162 (4%) Frame = +3 Query: 9 SYLSHVPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGA 188 S H+ SPA G A + + P K P + +S PPP PS Sbjct: 52 SSTEHLATSPA-----GGPPAPKAQAPPPKASSSSPPPPPPKASSSSPPPPTPSPPQHSP 106 Query: 189 LSP*PTRAGAG*ASRRRWPCW----SPSWPPPPPPAPPPQSPLLLPPP---RQKPPSHPP 347 P ++ A + P SP+ PPPP +PPP S PPP PPS PP Sbjct: 107 PPPPSKQSPPPPAPSSKTPATPPQKSPTASPPPPASPPPSSKSSPPPPPSPSSTPPSSPP 166 Query: 348 PPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPE 473 P SPPP T + + P ++ PP+ E Sbjct: 167 PRSSPPPPPAASTSTSTPPSSTSQKSPPKQELTKSPPPSSSE 208 Score = 57.8 bits (138), Expect = 4e-07 Identities = 45/134 (33%), Positives = 57/134 (42%), Gaps = 9/134 (6%) Frame = +3 Query: 111 GGSSLPLRGCP-----TSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPP-- 269 GG P P +SSPPP P SS + P PT + P SP PP Sbjct: 63 GGPPAPKAQAPPPKASSSSPPPPPPKASSSSPPP-PTPSP---------PQHSPPPPPSK 112 Query: 270 --PPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSA 443 PPPPAP ++P PP++ P + PPPP SPPP+ + P + Sbjct: 113 QSPPPPAPSSKTPAT--PPQKSPTASPPPPASPPPS--------------SKSSPPPPPS 156 Query: 444 RGGGPPAGPEPLSS 485 PP+ P P SS Sbjct: 157 PSSTPPSSPPPRSS 170 [137][TOP] >UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9EXV1_ORYSJ Length = 532 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/81 (41%), Positives = 35/81 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S P P P PPPP P+PPP SP PPP Sbjct: 366 PPSPPPPSPPPPSPSPPPPSPP----------------PPSPPPPSPSPPPPSP---PPP 406 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPP SPPP P Sbjct: 407 SPPPPSPSPPPPSPPPPSPPP 427 Score = 57.4 bits (137), Expect = 5e-07 Identities = 36/78 (46%), Positives = 37/78 (47%) Frame = +3 Query: 150 SPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQK 329 SPPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 361 SPPPPPP--SPPPPSPPP-------------PSPSPPPPSPPPPSPPPPSP-SPPPPSPP 404 Query: 330 PPSHPPPPHSPPPTRHRP 383 PPS PPP SPPP P Sbjct: 405 PPSPPPPSPSPPPPSPPP 422 Score = 56.6 bits (135), Expect = 9e-07 Identities = 37/83 (44%), Positives = 38/83 (45%), Gaps = 7/83 (8%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP--PPPAPPPQSPLLLP 314 P S PPP PS P P P SPS PPP PPP+PPP SP P Sbjct: 371 PPSPPPPSPSPPPPSPPPPSP-------------PPPSPSPPPPSPPPPSPPPPSP--SP 415 Query: 315 PPRQKPPSHPPPP-----HSPPP 368 PP PP PPPP SPPP Sbjct: 416 PPPSPPPPSPPPPSPVYYSSPPP 438 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P P P PPPP+PPP SP PPP PPS PPP SPPP P Sbjct: 360 PSPPPPPPSPPPPSPPPPSP-SPPPPSPPPPSPPPPSPSPPPPSPPP 405 [138][TOP] >UniRef100_B8ADK4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8ADK4_ORYSI Length = 520 Score = 58.9 bits (141), Expect = 2e-07 Identities = 38/92 (41%), Positives = 41/92 (44%), Gaps = 9/92 (9%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P P SP P PPPP+PPP +P+ PP Sbjct: 381 PPSPPPPSPPPPSPPPPSPPPPSTSP--------PPPSPPPPSPPPPSPPPPAPIFHPP- 431 Query: 321 RQKPPSHPPP---PH------SPPPTRHRPCG 389 Q PP PPP PH PPP PCG Sbjct: 432 -QPPPPPPPPAPQPHPPCPELPPPPPPPPPCG 462 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 255 PSWPPP--PPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P+ PPP PPP+PPP SP PPP PPS PPP SPPP P Sbjct: 377 PALPPPSPPPPSPPPPSP---PPPSPPPPSTSPPPPSPPPPSPPP 418 [139][TOP] >UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa RepID=Q8L3T8_ORYSJ Length = 570 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/81 (41%), Positives = 35/81 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S P P P PPPP P+PPP SP PPP Sbjct: 404 PPSPPPPSPPPPSPSPPPPSPP----------------PPSPPPPSPSPPPPSP---PPP 444 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PPS PPP SPPP P Sbjct: 445 SPPPPSPSPPPPSPPPPSPPP 465 Score = 57.4 bits (137), Expect = 5e-07 Identities = 36/78 (46%), Positives = 37/78 (47%) Frame = +3 Query: 150 SPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQK 329 SPPP P S SP P P SP P PPPP+PPP SP PPP Sbjct: 399 SPPPPPP--SPPPPSPPP-------------PSPSPPPPSPPPPSPPPPSP-SPPPPSPP 442 Query: 330 PPSHPPPPHSPPPTRHRP 383 PPS PPP SPPP P Sbjct: 443 PPSPPPPSPSPPPPSPPP 460 Score = 56.6 bits (135), Expect = 9e-07 Identities = 37/83 (44%), Positives = 38/83 (45%), Gaps = 7/83 (8%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP--PPPAPPPQSPLLLP 314 P S PPP PS P P P SPS PPP PPP+PPP SP P Sbjct: 409 PPSPPPPSPSPPPPSPPPPSP-------------PPPSPSPPPPSPPPPSPPPPSP--SP 453 Query: 315 PPRQKPPSHPPPP-----HSPPP 368 PP PP PPPP SPPP Sbjct: 454 PPPSPPPPSPPPPSPVYYSSPPP 476 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P P P PPPP+PPP SP PPP PPS PPP SPPP P Sbjct: 398 PSPPPPPPSPPPPSPPPPSP-SPPPPSPPPPSPPPPSPSPPPPSPPP 443 [140][TOP] >UniRef100_A4S1A8 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S1A8_OSTLU Length = 388 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/81 (44%), Positives = 40/81 (49%), Gaps = 3/81 (3%) Frame = +3 Query: 138 CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP 317 CP+ P P PS S SP P+ P PS PP PPP+PPP P PP Sbjct: 87 CPSPPPSPPPSPPPSPPPSPPPSPP----------PSPPPSPPPSPPPSPPPSPPPSPPP 136 Query: 318 --PRQKPPSHPP-PPHSPPPT 371 P PPS PP PP SPPP+ Sbjct: 137 SPPPNPPPSPPPSPPPSPPPS 157 [141][TOP] >UniRef100_A0DA74 Chromosome undetermined scaffold_43, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0DA74_PARTE Length = 1401 Score = 58.9 bits (141), Expect = 2e-07 Identities = 44/125 (35%), Positives = 48/125 (38%), Gaps = 3/125 (2%) Frame = +3 Query: 111 GGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSP---SWPPPPPP 281 GGS R P PPP P S+ P P G A P P + PPPPPP Sbjct: 816 GGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPP 875 Query: 282 APPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPP 461 PPP + PP PP P PP PPP P PL R PP Sbjct: 876 PPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAP--------------PLPPGPR---PP 918 Query: 462 AGPEP 476 GP+P Sbjct: 919 GGPDP 923 [142][TOP] >UniRef100_Q95JC9-2 Isoform 2 of Basic proline-rich protein n=1 Tax=Sus scrofa RepID=Q95JC9-2 Length = 511 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 242 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 301 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 302 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 358 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 284 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 343 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 344 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 400 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 326 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 385 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 386 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 442 Score = 58.2 bits (139), Expect = 3e-07 Identities = 40/124 (32%), Positives = 48/124 (38%), Gaps = 1/124 (0%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 368 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 427 Query: 306 LLPPPRQKPPSHPPPPHS-PPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPP PP P PP + PPP P ++ +P ++ GPP P P Sbjct: 428 PGPPPPGPPPPGPAPPGARPPPGPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPPPPPP 487 Query: 483 STRG 494 +G Sbjct: 488 GIQG 491 Score = 57.8 bits (138), Expect = 4e-07 Identities = 40/117 (34%), Positives = 48/117 (41%), Gaps = 5/117 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSS-----GALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P PP P++ S A P A +G +++ P P+ PPPPPP PP P Sbjct: 192 PPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPP--PPAGPPPPPPPPPGPPPP 249 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PP +PP PPPP PPP P RP G PP GP P Sbjct: 250 GPAPPGARPPPGPPPPGPPPPGPAPP-----------GARPPPGPPPPGPPPPGPAP 295 Score = 55.1 bits (131), Expect = 3e-06 Identities = 41/120 (34%), Positives = 50/120 (41%), Gaps = 3/120 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P + PPP P G P P GA R P P PPPP PAPP P PPP Sbjct: 75 PGARPPPGPP--PPGPPPPGPAPPGA-----RPPPGPPPPGPPPPGPAPPGARPPPGPPP 127 Query: 321 RQKPPSHPPPPHS-PPPTRHRPCGTCRRRT*RQRCRPLRR--SARGGGPPAGPEPLSSTR 491 PP P PP + PPP P G ++ P ++ G PP P P + ++ Sbjct: 128 PGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPPANESQ 187 [143][TOP] >UniRef100_Q95JC9-3 Isoform 3 of Basic proline-rich protein n=1 Tax=Sus scrofa RepID=Q95JC9-3 Length = 566 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 242 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 301 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 302 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 358 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 284 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 343 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 344 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 400 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/117 (35%), Positives = 43/117 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 326 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 385 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PP P G RP G PP GP P Sbjct: 386 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 442 Score = 58.9 bits (141), Expect = 2e-07 Identities = 40/112 (35%), Positives = 47/112 (41%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P + PPP P A P A +G +++ P P+ PPPPPP PP P PP Sbjct: 443 PGARPPPGPP---PPADEPQQGPAPSGDKPKKKPP--PPAGPPPPPPPPPGPPPPGPAPP 497 Query: 321 RQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 +PP PPPP PPP P RP G PP GP P Sbjct: 498 GARPPPGPPPPGPPPPGPAPP-----------GARPPPGPPPPGPPPPGPAP 538 Score = 57.8 bits (138), Expect = 4e-07 Identities = 40/117 (34%), Positives = 48/117 (41%), Gaps = 5/117 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSS-----GALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P PP P++ S A P A +G +++ P P+ PPPPPP PP P Sbjct: 192 PPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPP--PPAGPPPPPPPPPGPPPP 249 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PP +PP PPPP PPP P RP G PP GP P Sbjct: 250 GPAPPGARPPPGPPPPGPPPPGPAPP-----------GARPPPGPPPPGPPPPGPAP 295 Score = 57.4 bits (137), Expect = 5e-07 Identities = 39/118 (33%), Positives = 46/118 (38%), Gaps = 1/118 (0%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 368 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 427 Query: 306 LLPPPRQKPPSHPPPPHS-PPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PP P PP + PPP P ++ +P ++ GPP P P Sbjct: 428 PGPPPPGPPPPGPAPPGARPPPGPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPPPP 485 Score = 55.1 bits (131), Expect = 3e-06 Identities = 41/120 (34%), Positives = 50/120 (41%), Gaps = 3/120 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P + PPP P G P P GA R P P PPPP PAPP P PPP Sbjct: 75 PGARPPPGPP--PPGPPPPGPAPPGA-----RPPPGPPPPGPPPPGPAPPGARPPPGPPP 127 Query: 321 RQKPPSHPPPPHS-PPPTRHRPCGTCRRRT*RQRCRPLRR--SARGGGPPAGPEPLSSTR 491 PP P PP + PPP P G ++ P ++ G PP P P + ++ Sbjct: 128 PGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPPANESQ 187 Score = 53.5 bits (127), Expect = 8e-06 Identities = 32/81 (39%), Positives = 33/81 (40%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P P P + G P P G R P P PPPP PAPP P Sbjct: 485 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 544 Query: 306 LLPPPRQKPPSHPPPPHSPPP 368 PPP PS P PP PPP Sbjct: 545 PGPPPPPPGPSPPRPPPGPPP 565 [144][TOP] >UniRef100_Q84ZL0-2 Isoform 2 of Formin-like protein 5 n=1 Tax=Oryza sativa Japonica Group RepID=Q84ZL0-2 Length = 1627 Score = 58.9 bits (141), Expect = 2e-07 Identities = 42/117 (35%), Positives = 49/117 (41%), Gaps = 5/117 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*P--TRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLP 314 P PPP +HF++ P P TR+GA P P P PPPP PPP + P Sbjct: 1015 PPPPPPPPTTHFNAPPPPPPPPITRSGA--------PPSPPPPPSPPPPPPPPGARPGPP 1066 Query: 315 PPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCR---PLRRSARGGGPPAGPEP 476 PP P + P PP PPP RP + P S R G PP P P Sbjct: 1067 PPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPP 1123 Score = 54.3 bits (129), Expect = 4e-06 Identities = 50/160 (31%), Positives = 58/160 (36%), Gaps = 32/160 (20%) Frame = +3 Query: 99 RRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP 278 R +GG++ P +PPP P + A+SP P PC P PPPPP Sbjct: 908 RSGVGGNTPP-------APPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPP 960 Query: 279 PAP--------------PPQSPLL--LPPPRQKPP-SHP---------------PPPHSP 362 P P PP PLL +PPP PP SH PPP P Sbjct: 961 PPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPPPPP 1020 Query: 363 PPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPT H P R G PP+ P P S Sbjct: 1021 PPTTHFNA---------PPPPPPPPITRSGAPPSPPPPPS 1051 Score = 54.3 bits (129), Expect = 4e-06 Identities = 43/124 (34%), Positives = 48/124 (38%), Gaps = 8/124 (6%) Frame = +3 Query: 129 LRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP------PAPP 290 LR P PPP SH ++ P P A+R +P PPPPP P PP Sbjct: 984 LRSVPPPPPPPPISHSNAPPPPPLP-------AARFN----APPPPPPPPTTHFNAPPPP 1032 Query: 291 PQSPLLL--PPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPA 464 P P+ PP PP PPPP PP R P P AR G PP Sbjct: 1033 PPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPP-----------PPPPGARPGPPPP 1081 Query: 465 GPEP 476 P P Sbjct: 1082 PPPP 1085 [145][TOP] >UniRef100_Q84ZL0 Formin-like protein 5 n=1 Tax=Oryza sativa Japonica Group RepID=FH5_ORYSJ Length = 1627 Score = 58.9 bits (141), Expect = 2e-07 Identities = 42/117 (35%), Positives = 49/117 (41%), Gaps = 5/117 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*P--TRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLP 314 P PPP +HF++ P P TR+GA P P P PPPP PPP + P Sbjct: 1015 PPPPPPPPTTHFNAPPPPPPPPITRSGA--------PPSPPPPPSPPPPPPPPGARPGPP 1066 Query: 315 PPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCR---PLRRSARGGGPPAGPEP 476 PP P + P PP PPP RP + P S R G PP P P Sbjct: 1067 PPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPP 1123 Score = 54.3 bits (129), Expect = 4e-06 Identities = 50/160 (31%), Positives = 58/160 (36%), Gaps = 32/160 (20%) Frame = +3 Query: 99 RRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP 278 R +GG++ P +PPP P + A+SP P PC P PPPPP Sbjct: 908 RSGVGGNTPP-------APPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPP 960 Query: 279 PAP--------------PPQSPLL--LPPPRQKPP-SHP---------------PPPHSP 362 P P PP PLL +PPP PP SH PPP P Sbjct: 961 PPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPPPPP 1020 Query: 363 PPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPT H P R G PP+ P P S Sbjct: 1021 PPTTHFNA---------PPPPPPPPITRSGAPPSPPPPPS 1051 Score = 54.3 bits (129), Expect = 4e-06 Identities = 43/124 (34%), Positives = 48/124 (38%), Gaps = 8/124 (6%) Frame = +3 Query: 129 LRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP------PAPP 290 LR P PPP SH ++ P P A+R +P PPPPP P PP Sbjct: 984 LRSVPPPPPPPPISHSNAPPPPPLP-------AARFN----APPPPPPPPTTHFNAPPPP 1032 Query: 291 PQSPLLL--PPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPA 464 P P+ PP PP PPPP PP R P P AR G PP Sbjct: 1033 PPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPP-----------PPPPGARPGPPPP 1081 Query: 465 GPEP 476 P P Sbjct: 1082 PPPP 1085 [146][TOP] >UniRef100_C7J246 Os05g0551350 protein n=1 Tax=Oryza sativa Japonica Group RepID=C7J246_ORYSJ Length = 268 Score = 49.7 bits (117), Expect(2) = 2e-07 Identities = 39/102 (38%), Positives = 43/102 (42%), Gaps = 13/102 (12%) Frame = +3 Query: 225 ASRRRWPCWSPSWPPPPPPAPPPQSPLLLP----------PPRQKPPSHPPPPHSPPPTR 374 A R R P PS PPPPPP PPP + P P + PP PPPP P + Sbjct: 107 ADRLRVP--QPSPPPPPPPPPPPPTTTTKPESLPAEADSEPELKAPPPPPPPPPLLPMAQ 164 Query: 375 HRPCGTCRRRT*RQRCRPLRRSARG---GGPPAGPEPLSSTR 491 + G R RQR R RR A A P P SS R Sbjct: 165 PQADGAARPWNLRQRTR--RRPAASMSWAAAAAVPVPSSSRR 204 Score = 28.9 bits (63), Expect(2) = 2e-07 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 10/46 (21%) Frame = +1 Query: 142 PPPPPLPTLPTSP------AVPCRHDPHARVR----DERRGGGGHA 249 PPPPP P P A+P D R R RRGGGG A Sbjct: 27 PPPPPTPAHRLPPTVLPVVALPAGGDAATRDRRRSSSHRRGGGGGA 72 [147][TOP] >UniRef100_UPI00019261C6 PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI00019261C6 Length = 241 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 33/90 (36%), Positives = 36/90 (40%), Gaps = 6/90 (6%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLP------PPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQ 416 P PPPPPP PPP +P+ P PP PP PPP PPP +R C Sbjct: 163 PPPPPPPPPPPPPCAPMPYPFPCYASPPPPPPPCPPPPAPCPPPVVYRLC--------PP 214 Query: 417 RCRPLRRSARGGGPPAGPEPLSSTRGCCGC 506 C P R PP P P C C Sbjct: 215 PCPPPRPP-----PPPPPPPCMCAAPPCYC 239 Score = 24.3 bits (51), Expect(2) = 2e-07 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +1 Query: 46 PRGGQAAAPGRRAVPC*RGVNLVAHPCRYAGVPPPPPLPTLPTSPAVP-CRH 198 P GG PG P G+ P G P PP LP P P P C H Sbjct: 86 PPGGPGF-PGSVGPPGPPGMPGCTGPPGPPGPPGPPGLPAPPAPPPPPICIH 136 [148][TOP] >UniRef100_B6INW7 R body protein, putative n=1 Tax=Rhodospirillum centenum SW RepID=B6INW7_RHOCS Length = 157 Score = 53.1 bits (126), Expect(2) = 2e-07 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPP PPAPPP P PP PP PPPP PPP Sbjct: 117 PPAPPPAPPAPPPPPPPAPPPAPPAPPPPPPPPPPPPP 154 Score = 25.4 bits (54), Expect(2) = 2e-07 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTSPAVP 189 N++ +P PP PP P P P P Sbjct: 93 NVILNPTTPQPPPPAPPPPPAPPPPPAP 120 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/42 (54%), Positives = 23/42 (54%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P P PPPPPAPPP P PPP PP PP P PPP Sbjct: 106 PAPPPPPAPPPPPAPPPAPPAPPPPPPPAPPPAPPAPPPPPP 147 [149][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 23/39 (58%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPP-PPHSPPP 368 P PPPPPP PP P LPPP PP PP PP PPP Sbjct: 92 PPLPPPPPPPPPLPPPPPLPPPPPPPPLPPPLPPPLPPP 130 Score = 28.1 bits (61), Expect(2) = 2e-07 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 139 VPPPPPLPTLPTSPAVP 189 VPPPPPLP P P P Sbjct: 76 VPPPPPLPPPPPLPPPP 92 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = +3 Query: 225 ASRRRWPCWS-----PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 AS W C S P PP PPP P P P L PPP PP PPPP PPP Sbjct: 62 ASTESWQCSSTLGSVPPPPPLPPPPPLPPPPPLPPPPPPPPPLPPPPPLPPPP 114 [150][TOP] >UniRef100_UPI0001B58635 hypothetical protein StAA4_25414 n=1 Tax=Streptomyces sp. AA4 RepID=UPI0001B58635 Length = 326 Score = 58.5 bits (140), Expect = 2e-07 Identities = 37/104 (35%), Positives = 45/104 (43%) Frame = +3 Query: 171 HFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPP 350 H +SG +P PT G +P PPPPPP PPP +P PPP PP PPP Sbjct: 217 HVNSGTTTPPPTPGGGD--------SNTPKPPPPPPPPPPPPTPPPPPPPVTAPP--PPP 266 Query: 351 PHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPP +P P+ GGG A P P++ Sbjct: 267 VSPPPPPVTQP-------------PPVSSPPGGGGNGAPPPPVN 297 [151][TOP] >UniRef100_UPI00015B4CAB PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B4CAB Length = 972 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/86 (38%), Positives = 40/86 (46%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P+ P + PPP P+ S+ PTR +R PPPPPP PP P Sbjct: 662 PVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVTR----------PPPPPPTRPPPPPP 711 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRP 383 PP Q P + PPPP + PPTR P Sbjct: 712 TRPPVTQTPYTRPPPPPTRPPTRPPP 737 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/81 (39%), Positives = 38/81 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P + PPP P+ S+ PTR +R PPPPPP PP P PP Sbjct: 553 PPTRPPPPPTQPSTYLPPAPPTRPPQPPVTR----------PPPPPPTRPPPPPPTRPPV 602 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 Q P + PPPP + PPTR P Sbjct: 603 TQTPYTRPPPPPTRPPTRPPP 623 Score = 57.0 bits (136), Expect = 7e-07 Identities = 35/86 (40%), Positives = 40/86 (46%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P R PT PPP P+ S+ PTR +R PPPPPP PP P Sbjct: 485 PTRPPPTRPPPP-PTAPSTYLPPAPPTRPPQPPVTR----------PPPPPPTRPPPPPP 533 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRP 383 PP Q P + PPPP + PPTR P Sbjct: 534 TRPPVTQTPYTRPPPPPTRPPTRPPP 559 Score = 56.6 bits (135), Expect = 9e-07 Identities = 34/77 (44%), Positives = 39/77 (50%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P + PPP PS + A PTR +R P P+ PPPPPP PP P PP Sbjct: 820 PPTRPPPQPSTYLPPAP---PTRPPQPPVTRPPPP--PPTRPPPPPPTRPPPPPPTRPPV 874 Query: 321 RQKPPSHPPPPHSPPPT 371 QKP + PPP PPPT Sbjct: 875 TQKPYTRPPP---PPPT 888 Score = 55.5 bits (132), Expect = 2e-06 Identities = 42/120 (35%), Positives = 47/120 (39%), Gaps = 4/120 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALS----P*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLL 308 P + PPP PS + A P PTR R P + PPPPPP PP P Sbjct: 731 PPTRPPPQPSTYLPPAPPTRPPPPPTRPPT------RPPQPPVTRPPPPPPTRPPPPPPT 784 Query: 309 LPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSST 488 PP Q P + PPPP + PP P RP R PP P P ST Sbjct: 785 RPPVTQTPYTRPPPPPTRPPVTQTP-----------YTRPPPPPTR---PPTRPPPQPST 830 [152][TOP] >UniRef100_Q5RGR6 Wiskott-Aldrich syndrome, like n=1 Tax=Danio rerio RepID=Q5RGR6_DANRE Length = 518 Score = 58.5 bits (140), Expect = 2e-07 Identities = 35/87 (40%), Positives = 39/87 (44%), Gaps = 6/87 (6%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP------PPAP 287 P R ++ PPP PS GA P P + R P +P PPPP PPAP Sbjct: 328 PSRAPTSAPPPPPPSRPGMGAPPPPPPPS--------RGPTQAPPPPPPPHSASISPPAP 379 Query: 288 PPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPP PP PPPP PPP Sbjct: 380 PSIGGAPPPPPPPPPPPGPPPPGPPPP 406 [153][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP SP PPP PP PPPP PPP Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP+PPP P PPP PP PPPP PPP Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 SP PPPPPP PPP P PPP PPS PPPP PPP Sbjct: 485 SPPPPPPPPPPPPPPPPPPSPPP-PPPPSPPPPPPPPPP 522 Score = 53.9 bits (128), Expect = 6e-06 Identities = 33/80 (41%), Positives = 34/80 (42%), Gaps = 1/80 (1%) Frame = +3 Query: 132 RGCPTSSPPPYPSHF-SSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLL 308 RG T P F SG +SP P P P PPPPPP PP P Sbjct: 464 RGGLTEDPDNDDDWFLRSGGVSPPPP------------PPPPPPPPPPPPPPSPPPPPPP 511 Query: 309 LPPPRQKPPSHPPPPHSPPP 368 PPP PP PPPP PPP Sbjct: 512 SPPPPPPPPPPPPPPPPPPP 531 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPP PPP P PPP PP PPPP PPP P Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 [154][TOP] >UniRef100_A5E8N9 Putative uncharacterized protein n=1 Tax=Bradyrhizobium sp. BTAi1 RepID=A5E8N9_BRASB Length = 727 Score = 58.5 bits (140), Expect = 2e-07 Identities = 44/132 (33%), Positives = 56/132 (42%), Gaps = 5/132 (3%) Frame = +3 Query: 96 KRRELGGSSLPLRGCPT---SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWP 266 K++ G P G P ++PPP P+ + A P P A+ R P +P P Sbjct: 19 KQQPQGQPQRPGPGAPPPHQAAPPPPPAPPPAAAPRPAPPPPAPPPAAAPR-PAPAPPPP 77 Query: 267 PPPPPAPPPQS--PLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRS 440 PPPP A PP+ P PPPR +PP PP PPP R P P R+ Sbjct: 78 PPPPRAEPPRPAPPPPPPPPRAEPPRPAAPPPPPPPPRAEP---------PHAAPPPSRA 128 Query: 441 ARGGGPPAGPEP 476 PP+ P P Sbjct: 129 EPPAPPPSRPAP 140 [155][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/76 (42%), Positives = 32/76 (42%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P P P P PS PPPPPP PPP P PPP Sbjct: 214 PPSPPPPPPPPPPPSPPPPPP-------------PPPPPSPPPPPPPPPPPSPPPPPPPP 260 Query: 321 RQKPPSHPPPPHSPPP 368 PP PP P PPP Sbjct: 261 SPSPPPPPPSPSPPPP 276 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/43 (60%), Positives = 26/43 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PPP SP PPP PPS PPPP PPP P Sbjct: 214 PPSPPPPPPPPPPPSP-PPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPPPPP PPP SP PPP PPS PPPP PPP P Sbjct: 205 PPPPPPPPPPPSP-PPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/76 (42%), Positives = 33/76 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP PS P P+ P P PP PPP PPP SP PPP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPP----------PPPPPPPPPSPPPPPPPPSPSPPPPP 268 Query: 321 RQKPPSHPPPPHSPPP 368 P PPPP SPPP Sbjct: 269 PSPSPPPPPPPPSPPP 284 Score = 55.8 bits (133), Expect = 2e-06 Identities = 33/81 (40%), Positives = 33/81 (40%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P S P P P SP PPPPPP P P P PPP Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPP------------PPPSPPPPPPPPPPPSPPPPPPPPPP 250 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PPP SPPP P Sbjct: 251 PSPPPPPPPPSPSPPPPPPSP 271 Score = 55.8 bits (133), Expect = 2e-06 Identities = 31/77 (40%), Positives = 34/77 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ PPP P S P P P P PPPPPP+PPP P P P Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPP----------PSPPPPPPPPPPPSPPPPPPPPSPSP 264 Query: 321 RQKPPSHPPPPHSPPPT 371 PPS PPP PPP+ Sbjct: 265 PPPPPSPSPPPPPPPPS 281 [156][TOP] >UniRef100_Q6SSE8 Minus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE8_CHLRE Length = 3889 Score = 58.5 bits (140), Expect = 2e-07 Identities = 40/119 (33%), Positives = 43/119 (36%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P S PPP P S P P SP+ P PPPP+P P SP Sbjct: 942 PPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPP----------SPAPPSPPPPSPEPPSPA 991 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 LPPP P P PP PPP+ P A PP PEP S Sbjct: 992 PLPPPPSPEPPSPAPPSPPPPSPEPP-----------------SPAPPSPPPPSPEPPS 1033 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/81 (39%), Positives = 35/81 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P S SP P SP+ P PPPP+P P SP PPP Sbjct: 1111 PPSPPPPSPEPPSPAPPSPPPPSLEPP----------SPAPPSPPPPSPEPPSPAPSPPP 1160 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 P P PP PPP+ P Sbjct: 1161 PSPEPPSPVPPSPPPPSPEPP 1181 Score = 56.6 bits (135), Expect = 9e-07 Identities = 34/90 (37%), Positives = 39/90 (43%), Gaps = 4/90 (4%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P S PPP P S L P P+ P +P PPPP P PP +P Sbjct: 972 PPSPAPPSPPPPSPEPPSPAPLPPPPSPEP---------PSPAPPSPPPPSPEPPSPAPP 1022 Query: 306 LLPPPRQKPPS----HPPPPHSPPPTRHRP 383 PPP +PPS PPPP PP+ P Sbjct: 1023 SPPPPSPEPPSPAPPSPPPPSPEPPSPAPP 1052 Score = 55.1 bits (131), Expect = 3e-06 Identities = 33/76 (43%), Positives = 37/76 (48%), Gaps = 1/76 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQ-SPLLLPP 317 P PPP P ++P P R P P PPPP P+PPP+ SP PP Sbjct: 699 PRPPPPPLPPSPPLPPVTPSPPP---------RPP--PPKSPPPPKPSPPPRPSPPPRPP 747 Query: 318 PRQKPPSHPPPPHSPP 365 PR PPS PPPP PP Sbjct: 748 PRPLPPSPPPPPPLPP 763 Score = 54.7 bits (130), Expect = 3e-06 Identities = 43/122 (35%), Positives = 48/122 (39%) Frame = +3 Query: 18 SHVPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP 197 S VP SP AS S A + P S P P S PP P+ S SP Sbjct: 840 SPVPPSPPPASPEPTSPAPPSPPPPSPEPP---SPAPPSPPPPSPEPPSPAPPSPPLPSP 896 Query: 198 *PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRH 377 P SP+ P PPPP+P P SP PPP P P PP PPP+ Sbjct: 897 EPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPAPPSPPPPSPE 956 Query: 378 RP 383 P Sbjct: 957 PP 958 Score = 53.9 bits (128), Expect = 6e-06 Identities = 35/93 (37%), Positives = 40/93 (43%), Gaps = 15/93 (16%) Frame = +3 Query: 150 SPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPC-WSPSWP-----------PPPPPAPP- 290 +PPP P + L+P A WP W +WP PPPPP PP Sbjct: 653 APPPQPPIPPASPLTP---AAPPRPPLPPTWPGKWEGAWPFRPPIPPRPPRPPPPPLPPS 709 Query: 291 -PQSPLL-LPPPRQKPPSHPPPPHSPPPTRHRP 383 P P+ PPPR PP PPPP PP R P Sbjct: 710 PPLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSP 742 Score = 53.5 bits (127), Expect = 8e-06 Identities = 41/119 (34%), Positives = 45/119 (37%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P P PPP P S SP P P +PS PPPP P PP +P Sbjct: 898 PPSPAPPLPPPPSPEPPSPAPPSPPPPSPEP--------PSPAPS-PPPPSPEPPSPAPP 948 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 PPP +PPS P PP PPP+ P A PP PEP S Sbjct: 949 SPPPPSPEPPS-PAPPLPPPPSPEPP-----------------SPAPPSPPPPSPEPPS 989 [157][TOP] >UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4IYP5_MAIZE Length = 441 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/51 (52%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +3 Query: 237 RWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPH--SPPPTRHRP 383 R P PS PPP PP P P PL+ PPP PP PPPP PPP H P Sbjct: 251 RLPSPPPSPPPPSPPPPSPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSP 301 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/81 (41%), Positives = 35/81 (43%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P SP P + P S PPPPPP P P SP PPP Sbjct: 290 PLLPPPPQPHSPPPPLSSPPPPPP----LPQPHSPPPPLSSPPPPPPLPQPHSP---PPP 342 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PP PHSPPP P Sbjct: 343 LSSPPPPPPLPHSPPPPSPAP 363 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/83 (40%), Positives = 35/83 (42%), Gaps = 2/83 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P +SP P P P PPPPP PPP P PPP Sbjct: 261 PPSPPPPSPP---PPLMSPPP-------------PSPPPPSPPPPPLLPPPPQPHSPPPP 304 Query: 321 RQKPPSHP--PPPHSPPPTRHRP 383 PP P P PHSPPP P Sbjct: 305 LSSPPPPPPLPQPHSPPPPLSSP 327 [158][TOP] >UniRef100_C1EC31 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EC31_9CHLO Length = 939 Score = 58.5 bits (140), Expect = 2e-07 Identities = 40/94 (42%), Positives = 42/94 (44%) Frame = +3 Query: 102 RELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP 281 R G P P PPP PS + SP P+ SPS PPPPPP Sbjct: 449 RFAGSIPTPPSPPPPPQPPPLPSPPPPSSPSPPPS---------------SPSPPPPPPP 493 Query: 282 APPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P P SP PPP PPS PPP SPPP RP Sbjct: 494 -PSPPSP---PPPPSPPPSSPPP--SPPPFPPRP 521 [159][TOP] >UniRef100_A4S1Y9 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S1Y9_OSTLU Length = 1065 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/79 (45%), Positives = 40/79 (50%), Gaps = 2/79 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP- 317 PT +P P PS S SP P+ P PS PP PPP+PPP P PP Sbjct: 471 PTPTPTPTPSPPPSPPPSPPPSPP----------PSPPPSPPPSPPPSPPPSPPPSPPPS 520 Query: 318 PRQKPPSHPP-PPHSPPPT 371 P PPS PP PP SPPP+ Sbjct: 521 PPSPPPSPPPSPPPSPPPS 539 Score = 57.8 bits (138), Expect = 4e-07 Identities = 36/83 (43%), Positives = 39/83 (46%), Gaps = 6/83 (7%) Frame = +3 Query: 141 PTSSPPPYP------SHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 PT SPPP P S S SP P+ + S P SP PPP PP PP SP Sbjct: 477 PTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSP 536 Query: 303 LLLPPPRQKPPSHPPPPHSPPPT 371 PPP P P PP SPPP+ Sbjct: 537 PPSPPPSPPPSPPPSPPPSPPPS 559 Score = 56.6 bits (135), Expect = 9e-07 Identities = 34/77 (44%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP- 317 P S PP PS S SP P+ P PS PP PPP+PPP P PP Sbjct: 514 PPSPPPSPPSPPPSPPPSPPPSPP----------PSPPPSPPPSPPPSPPPSPPPSPPPS 563 Query: 318 -PRQKPPSHPPPPHSPP 365 P PPS PPPPH P Sbjct: 564 PPPSPPPSPPPPPHFAP 580 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/79 (41%), Positives = 35/79 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S SP P+ + P P PPP PP PP SP PPP Sbjct: 501 PPPSPPPSPP--PSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 558 Query: 321 RQKPPSHPPPPHSPPPTRH 377 P P PP SPPP H Sbjct: 559 SPPPSPPPSPPPSPPPPPH 577 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/83 (40%), Positives = 39/83 (46%), Gaps = 2/83 (2%) Frame = +3 Query: 129 LRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLL 308 L PT +P P P+ SP P+ P PS PP PPP+PPP P Sbjct: 465 LAAAPTPTPTPTPTP------SPPPSPP----------PSPPPSPPPSPPPSPPPSPPPS 508 Query: 309 LP--PPRQKPPSHPPPPHSPPPT 371 P PP PPS P PP SPPP+ Sbjct: 509 PPPSPPPSPPPSPPSPPPSPPPS 531 Score = 55.1 bits (131), Expect = 3e-06 Identities = 33/81 (40%), Positives = 37/81 (45%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SPPP P S SP P+ + + P P PPP PP PP SP PPP Sbjct: 497 PPPSPPPSPP--PSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 554 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 P P PP SPPP+ P Sbjct: 555 SPPPSPPPSPPPSPPPSPPPP 575 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/73 (42%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = +3 Query: 174 FSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLP--PPRQKPPSHPP 347 + + L+P A A + P +PS PP PPP+PPP P P PP PPS PP Sbjct: 452 YHNAVLAPNAAAALAAAPTPTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 511 Query: 348 -PPHSPPPTRHRP 383 PP SPPP+ P Sbjct: 512 SPPPSPPPSPPSP 524 [160][TOP] >UniRef100_Q9VAY4 CG5514, isoform A n=1 Tax=Drosophila melanogaster RepID=Q9VAY4_DROME Length = 1109 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/85 (40%), Positives = 39/85 (45%), Gaps = 4/85 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP----PAPPPQSPLL 308 P +PPP P S P P G + P SP + PPPP P PPP P L Sbjct: 353 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPA-SPRFDPPPPHTIEPPPPPAPPTL 411 Query: 309 LPPPRQKPPSHPPPPHSPPPTRHRP 383 +PPP PP+ PPP PPT P Sbjct: 412 VPPPPPAPPTIKPPPPPAPPTVEPP 436 [161][TOP] >UniRef100_Q8MRP6 GH07623p n=1 Tax=Drosophila melanogaster RepID=Q8MRP6_DROME Length = 846 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/85 (40%), Positives = 39/85 (45%), Gaps = 4/85 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP----PAPPPQSPLL 308 P +PPP P S P P G + P SP + PPPP P PPP P L Sbjct: 90 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPA-SPRFDPPPPHTIEPPPPPAPPTL 148 Query: 309 LPPPRQKPPSHPPPPHSPPPTRHRP 383 +PPP PP+ PPP PPT P Sbjct: 149 VPPPPPAPPTIKPPPPPAPPTVEPP 173 [162][TOP] >UniRef100_Q8IMM6 CG5514, isoform B n=1 Tax=Drosophila melanogaster RepID=Q8IMM6_DROME Length = 1150 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/85 (40%), Positives = 39/85 (45%), Gaps = 4/85 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP----PAPPPQSPLL 308 P +PPP P S P P G + P SP + PPPP P PPP P L Sbjct: 353 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPA-SPRFDPPPPHTIEPPPPPAPPTL 411 Query: 309 LPPPRQKPPSHPPPPHSPPPTRHRP 383 +PPP PP+ PPP PPT P Sbjct: 412 VPPPPPAPPTIKPPPPPAPPTVEPP 436 [163][TOP] >UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA Length = 688 Score = 58.5 bits (140), Expect = 2e-07 Identities = 38/116 (32%), Positives = 47/116 (40%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 +P P PPP P + P P A + + P P P PPPP PPP P Sbjct: 192 VPFEHFPFVPPPPPPPPAPAPTPPPPPPPA-----PKPKPPPPPPPKPKPPPPPPPPPPP 246 Query: 303 LLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGP 470 P P PP+ PPPP +PPP P + + +R G PP GP Sbjct: 247 APKPSPPTPPPTTPPPPTAPPPPPSVPIPS-------GQDSGIRPPQLGWSPPYGP 295 [164][TOP] >UniRef100_A7EMY0 Putative uncharacterized protein n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7EMY0_SCLS1 Length = 436 Score = 58.5 bits (140), Expect = 2e-07 Identities = 48/144 (33%), Positives = 60/144 (41%), Gaps = 6/144 (4%) Frame = +3 Query: 72 RQTRCPLLKRRELGGSSLPLRGCPT---SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRW 242 R+T P + R SS L+G P PPP P ALS P + Sbjct: 207 RKTAGPSISRP---ASSTSLKGPPPPIGKKPPPPPGTRKPSALSAPPPPSSFAPPP---- 259 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP---CGTCRRRT*R 413 PS PPPP APPP P P +PPS+PP H+PPP P G + + Sbjct: 260 ----PSSAPPPPAAPPPP-----PSPAPRPPSNPPRAHAPPPPPTSPPSANGGGQSLAMQ 310 Query: 414 QRCRPLRRSARGGGPPAGPEPLSS 485 R +++ G PP P P SS Sbjct: 311 AAIRAAGQASPMGAPPPPPPPPSS 334 [165][TOP] >UniRef100_C9JI13 Putative uncharacterized protein CCNK n=1 Tax=Homo sapiens RepID=C9JI13_HUMAN Length = 600 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 517 PAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 556 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S PA+P Sbjct: 490 HLPYHPHVYPPNPPPPPVPPPPASFPPPAIP 520 [166][TOP] >UniRef100_O75909-4 Isoform 4 of Cyclin-K n=1 Tax=Homo sapiens RepID=O75909-4 Length = 600 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 517 PAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 556 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S PA+P Sbjct: 490 HLPYHPHVYPPNPPPPPVPPPPASFPPPAIP 520 [167][TOP] >UniRef100_B5FW37 Cyclin K isoform 1 (Predicted) n=1 Tax=Otolemur garnettii RepID=B5FW37_OTOGA Length = 587 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 504 PAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 543 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S PA+P Sbjct: 477 HLPYHPHVYPPNPPPPPVPPPPASFPPPAIP 507 [168][TOP] >UniRef100_UPI000179D978 UPI000179D978 related cluster n=1 Tax=Bos taurus RepID=UPI000179D978 Length = 584 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 501 PAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 540 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S PA+P Sbjct: 474 HLPYHPHVYPPNPPPPPVPPPPASFPPPAIP 504 [169][TOP] >UniRef100_UPI00017F0BD6 PREDICTED: similar to cyclin K n=1 Tax=Sus scrofa RepID=UPI00017F0BD6 Length = 582 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 499 PAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 538 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S PA+P Sbjct: 472 HLPYHPHVYPPNPPPPPVPPPPASFPPPAIP 502 [170][TOP] >UniRef100_UPI00017C39ED PREDICTED: similar to cyclin K n=1 Tax=Bos taurus RepID=UPI00017C39ED Length = 582 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 499 PAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 538 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S PA+P Sbjct: 472 HLPYHPHVYPPNPPPPPVPPPPASFPPPAIP 502 [171][TOP] >UniRef100_O75909 Cyclin-K n=1 Tax=Homo sapiens RepID=CCNK_HUMAN Length = 580 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 497 PAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 536 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S PA+P Sbjct: 470 HLPYHPHVYPPNPPPPPVPPPPASFPPPAIP 500 [172][TOP] >UniRef100_UPI0000E23AD2 PREDICTED: similar to cyclin K n=1 Tax=Pan troglodytes RepID=UPI0000E23AD2 Length = 539 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 456 PAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 495 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S PA+P Sbjct: 429 HLPYHPHVYPPNPPPPPVPPPPASFPPPAIP 459 [173][TOP] >UniRef100_UPI00005A198E PREDICTED: similar to cyclin K n=1 Tax=Canis lupus familiaris RepID=UPI00005A198E Length = 524 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 391 PAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 430 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S PA+P Sbjct: 364 HLPYHPHVYPPNPPPPPVPPPPASFPPPAIP 394 [174][TOP] >UniRef100_UPI0000D9BD9F PREDICTED: similar to cyclin K n=1 Tax=Macaca mulatta RepID=UPI0000D9BD9F Length = 364 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 281 PAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 320 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S PA+P Sbjct: 254 HLPYHPHVYPPNPPPPPVPPPPASFPPPAIP 284 [175][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/76 (42%), Positives = 34/76 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P+ GA P P P + PPPPPP PP P PPP Sbjct: 708 PPPPPPPPPAPKPPGAPPPPPPPPPT------TKPLGAHPPPPPPPPPPPAPKPPGAPPP 761 Query: 321 RQKPPSHPPPPHSPPP 368 KPPS PPPP PP Sbjct: 762 PPKPPSAPPPPPPKPP 777 Score = 57.4 bits (137), Expect = 5e-07 Identities = 43/123 (34%), Positives = 49/123 (39%), Gaps = 8/123 (6%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP--------APPPQ 296 P PP P SS + S + G P PPPPPP APPP Sbjct: 663 PPPPAPPLPMFSSSSSTSRSSSSHGV-----------PPPHPPPPPPSLAPKPPSAPPPP 711 Query: 297 SPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 P PPP KPP PPPP PPPT +P G P + G PP P+P Sbjct: 712 PP---PPPAPKPPGAPPPPPPPPPTT-KPLGAHPPPPPPPPPPPAPKPP--GAPPPPPKP 765 Query: 477 LSS 485 S+ Sbjct: 766 PSA 768 Score = 54.7 bits (130), Expect = 3e-06 Identities = 38/111 (34%), Positives = 44/111 (39%), Gaps = 10/111 (9%) Frame = +3 Query: 87 PLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWP 266 P+ S G P PPP P + S P A + P +P P Sbjct: 671 PMFSSSSSTSRSSSSHGVPPPHPPPPPPSLAPKPPSAPPPPPPPPPAPK---PPGAPPPP 727 Query: 267 PPPPP------APPPQSPLLLPPPRQKPPSHPP----PPHSPPPTRHRPCG 389 PPPPP A PP P PPP KPP PP PP +PPP +P G Sbjct: 728 PPPPPTTKPLGAHPPPPPPPPPPPAPKPPGAPPPPPKPPSAPPPPPPKPPG 778 Score = 53.9 bits (128), Expect = 6e-06 Identities = 34/94 (36%), Positives = 38/94 (40%), Gaps = 15/94 (15%) Frame = +3 Query: 135 GCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAP--------P 290 G P PPP P+ GA P P PPPPPPAP P Sbjct: 722 GAPPPPPPPPPTTKPLGAHPPPPP-------------------PPPPPPAPKPPGAPPPP 762 Query: 291 PQSPLLLPPPRQKPPSHPPPP-------HSPPPT 371 P+ P PPP KPP PPPP +PPP+ Sbjct: 763 PKPPSAPPPPPPKPPGAPPPPPPKLPGAPAPPPS 796 Score = 53.5 bits (127), Expect = 8e-06 Identities = 42/123 (34%), Positives = 46/123 (37%), Gaps = 11/123 (8%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWP--CWSPSWPPPPPPAPPPQSPLLLP 314 P PPP P+ + L P PT A G P PS PPPPPP PP P Sbjct: 581 PPPPPPPLPNVSNGNPLMP-PTPASRGPPPPPPPPPPLPGPSPPPPPPPPPPTSISSKGP 639 Query: 315 PPRQKPPSHP---------PPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAG 467 PP PP PPP PPP P + T R S+ G PP Sbjct: 640 PPPPPPPDFSSSSSNKPTLPPPPPPPPAPPLPMFSSSSST-------SRSSSSHGVPPPH 692 Query: 468 PEP 476 P P Sbjct: 693 PPP 695 [176][TOP] >UniRef100_UPI0001554901 PREDICTED: similar to dipeptidyl peptidase 8 n=1 Tax=Ornithorhynchus anatinus RepID=UPI0001554901 Length = 551 Score = 58.2 bits (139), Expect = 3e-07 Identities = 41/88 (46%), Positives = 46/88 (52%), Gaps = 6/88 (6%) Frame = +3 Query: 132 RGCPTSSP--PPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 RG P SSP P PS +SS L P +A R P SP+ PPPPPP PPP +P Sbjct: 387 RGTPGSSPYASPRPSPWSSPKL---PKKAQPA----RSRPA-SPAPPPPPPPPPPPPAPQ 438 Query: 306 L----LPPPRQKPPSHPPPPHSPPPTRH 377 L PPP PP PPPP PTR+ Sbjct: 439 LPHPSTPPP---PPPPPPPPEKKLPTRN 463 [177][TOP] >UniRef100_UPI0000F2E064 PREDICTED: similar to Ubiquitin specific peptidase 13 (isopeptidase T-3) n=1 Tax=Monodelphis domestica RepID=UPI0000F2E064 Length = 1080 Score = 58.2 bits (139), Expect = 3e-07 Identities = 53/152 (34%), Positives = 68/152 (44%), Gaps = 3/152 (1%) Frame = +3 Query: 24 VPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*P 203 +P PAVA+ A + A + R + S +PL P +PP L P P Sbjct: 87 IPAPPAVAAAAAAAAAAAAAGDAI-RHWIKNSLVPLPALPRPAPP---------GLWP-P 135 Query: 204 TRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP---TR 374 A ++R PC SP+ PPP PAP +P P Q PPS PP P PPP +R Sbjct: 136 RAARLPPSARPPGPC-SPAALPPPLPAP-------VPVPPQPPPSSPPRPRRPPPAPGSR 187 Query: 375 HRPCGTCRRRT*RQRCRPLRRSARGGGPPAGP 470 RP R R R ++R+A G P GP Sbjct: 188 ARPPLPPSLRPSRAR-GSMQRAALFGSPGGGP 218 [178][TOP] >UniRef100_UPI0000D9B773 PREDICTED: similar to CG5514-PB, isoform B n=1 Tax=Macaca mulatta RepID=UPI0000D9B773 Length = 283 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = +3 Query: 243 PCWSPSWP--PPPPPAPPPQSPLLLPPPRQKPPSHPP--PPHSPPPT 371 P S SWP PPPPP PPP SP PPP PP PP PP SPPP+ Sbjct: 26 PLLSQSWPSPPPPPPPPPPPSPPPPPPPPPSPPPLPPWGPPPSPPPS 72 [179][TOP] >UniRef100_UPI0001A2BBDD hypothetical protein LOC100009637 n=1 Tax=Danio rerio RepID=UPI0001A2BBDD Length = 502 Score = 58.2 bits (139), Expect = 3e-07 Identities = 36/82 (43%), Positives = 41/82 (50%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P R ++ PPP PS S GA P P G P +P+ PPPPP PPP S Sbjct: 315 PSRAPTSAPPPPPPSRPSMGAPPPPPPSRG-----HPPPPPPAPASMPPPPP-PPPMSGG 368 Query: 306 LLPPPRQKPPSHPPPPHSPPPT 371 PPP PP PPPP PPP+ Sbjct: 369 AAPPP---PPPPPPPPGPPPPS 387 Score = 56.6 bits (135), Expect = 9e-07 Identities = 38/99 (38%), Positives = 45/99 (45%), Gaps = 18/99 (18%) Frame = +3 Query: 126 PLRGCP-------TSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSW--PPPPP 278 P RG P TS PPP P P P + A ++ P PS PPPPP Sbjct: 281 PSRGGPPPPPPPHTSGPPPPPPPVRGRGAPPPPPPSRAPTSAPPPPPPSRPSMGAPPPPP 340 Query: 279 PA-----PPPQSPLLLPPPRQKPP----SHPPPPHSPPP 368 P+ PPP +P +PPP PP + PPPP PPP Sbjct: 341 PSRGHPPPPPPAPASMPPPPPPPPMSGGAAPPPPPPPPP 379 [180][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 1933 PPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPP 1970 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 SP PPPPPP PPP P PPP PP PPPP PPP Sbjct: 1928 SPETPPPPPPPPPPPPP--PPPPTPAPPPTPPPPPPPPP 1964 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 +P PPPPPP PPP P PP PP PPPP PPP Sbjct: 1931 TPPPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPP 1969 [181][TOP] >UniRef100_A2RUY4 Zgc:158395 protein n=1 Tax=Danio rerio RepID=A2RUY4_DANRE Length = 502 Score = 58.2 bits (139), Expect = 3e-07 Identities = 36/82 (43%), Positives = 41/82 (50%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P R ++ PPP PS S GA P P G P +P+ PPPPP PPP S Sbjct: 315 PSRAPTSAPPPPPPSRPSMGAPPPPPPSRG-----HPPPPPPAPASMPPPPP-PPPMSGG 368 Query: 306 LLPPPRQKPPSHPPPPHSPPPT 371 PPP PP PPPP PPP+ Sbjct: 369 AAPPP---PPPPPPPPGPPPPS 387 Score = 56.6 bits (135), Expect = 9e-07 Identities = 38/99 (38%), Positives = 45/99 (45%), Gaps = 18/99 (18%) Frame = +3 Query: 126 PLRGCP-------TSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSW--PPPPP 278 P RG P TS PPP P P P + A ++ P PS PPPPP Sbjct: 281 PSRGGPPPPPPPHTSGPPPPPPPVRGRGAPPPPPPSRAPTSAPPPPPPSRPSMGAPPPPP 340 Query: 279 PA-----PPPQSPLLLPPPRQKPP----SHPPPPHSPPP 368 P+ PPP +P +PPP PP + PPPP PPP Sbjct: 341 PSRGHPPPPPPAPASMPPPPPPPPMSGGAAPPPPPPPPP 379 [182][TOP] >UniRef100_Q4A373 Putative lectin protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A373_EHV86 Length = 1994 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = +3 Query: 240 WPCWSPSWPPP-PPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 + C P PPP PPP+PPP SP PPP PP PPP SPPP+ + P Sbjct: 1222 YTCSPPPPPPPSPPPSPPPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPP 1270 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/41 (58%), Positives = 26/41 (63%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P PS PP PPP+PPP P PPP PP PPPP+SPP Sbjct: 1443 PSPPPSPPPSPPPSPPPLQPPPSPPPPLLPPPFPPPPNSPP 1483 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSP--PPTRHRPCGT 392 P PPPP+PPP SP PPP PP PPPP P PP + P T Sbjct: 690 PSPPPPSPPPPSPPSPPPPSPPPPPSPPPPSLPPSPPPPYAPLQT 734 Score = 53.9 bits (128), Expect = 6e-06 Identities = 36/92 (39%), Positives = 39/92 (42%), Gaps = 1/92 (1%) Frame = +3 Query: 111 GGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPP 290 G S+ + T SPPP P SP P SP P PPP PP Sbjct: 1212 GSSTYVMHALYTCSPPPPPPP------SPPP----------------SPPPPSPPPTPPP 1249 Query: 291 PQSPL-LLPPPRQKPPSHPPPPHSPPPTRHRP 383 P SP LPPP PPS PPP PPP+ P Sbjct: 1250 PLSPPPSLPPPSSPPPSPNPPPAPPPPSPPPP 1281 [183][TOP] >UniRef100_Q1HH32 Putative uncharacterized protein n=1 Tax=Antheraea pernyi nucleopolyhedrovirus RepID=Q1HH32_NPVAP Length = 211 Score = 58.2 bits (139), Expect = 3e-07 Identities = 35/87 (40%), Positives = 38/87 (43%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 LP PT +PPP P S P PT + S P P PP P PPP SP Sbjct: 34 LPTPTPPTPTPPPSPPP-SPTPTPPTPTPPPSPPPSPTPTPPTPTPSPTPPTPTPPPPSP 92 Query: 303 LLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPP P P PP SPPP+ P Sbjct: 93 TPTPPPPSPTPPTPTPPPSPPPSPPPP 119 [184][TOP] >UniRef100_Q6ND96 Possible OmpA family member n=1 Tax=Rhodopseudomonas palustris RepID=Q6ND96_RHOPA Length = 689 Score = 58.2 bits (139), Expect = 3e-07 Identities = 42/128 (32%), Positives = 51/128 (39%), Gaps = 11/128 (8%) Frame = +3 Query: 126 PLRGCPTSSPPP---YPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQ 296 P + P++ PPP P H + P P RA PPPPP A P Sbjct: 66 PPKAAPSAPPPPPAAAPPHVAPPPPPPAPPRAAP---------------PPPPPAAAPAP 110 Query: 297 SPLLLPPPRQKPPSH----PPPPHS--PPPTRHRPCGTCRRRT*RQRCRPLRRSA--RGG 452 +P PP PPSH PPPPH+ PPP +P + P +A R Sbjct: 111 APKRAEPPPPPPPSHSAPPPPPPHAAPPPPPAPKPSAPPTAAPAERPAAPPPAAAPVRPP 170 Query: 453 GPPAGPEP 476 PPAG P Sbjct: 171 APPAGEAP 178 [185][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/49 (55%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSP---LLLPPPRQKPPSHPPPPHSPPPTRHRPCGT 392 P PPPPPP+PPP SP PPP PP PPPP PPPT P T Sbjct: 94 PPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPPSPPPPTTTPPTTT 142 Score = 57.0 bits (136), Expect = 7e-07 Identities = 34/96 (35%), Positives = 40/96 (41%) Frame = +3 Query: 96 KRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP 275 K + +G +LP + P PPP P P SP P PP Sbjct: 76 KLKPVGDRTLPNKVPPPPPPPPPP-------------------------PPPSPPPPSPP 110 Query: 276 PPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PP+PPP P PPP PP PPPP + PPT P Sbjct: 111 PPSPPPPPP--PPPPPSPPPPSPPPPTTTPPTTTTP 144 [186][TOP] >UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis thaliana RepID=Q9XIL9_ARATH Length = 727 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/79 (43%), Positives = 37/79 (46%) Frame = +3 Query: 147 SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQ 326 S PPP P H SP P P +SP PPPP +PPP P+ PPP Sbjct: 500 SPPPPSPIH------SPPPP------------PVYSPP-PPPPVYSPPPPPPVYSPPPPP 540 Query: 327 KPPSHPPPPHSPPPTRHRP 383 S PPP HSPPP H P Sbjct: 541 PVHSPPPPVHSPPPPVHSP 559 Score = 57.4 bits (137), Expect = 5e-07 Identities = 38/88 (43%), Positives = 40/88 (45%), Gaps = 7/88 (7%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP---PPPAPPPQSPLLL 311 P SPPP P + SP P P +SP PPP PPP PP SP Sbjct: 506 PIHSPPPPPVY------SPPPPP-----------PVYSPPPPPPVYSPPPPPPVHSP--- 545 Query: 312 PPPRQKPP----SHPPPPHSPPPTRHRP 383 PPP PP S PPP HSPPP H P Sbjct: 546 PPPVHSPPPPVHSPPPPVHSPPPPVHSP 573 [187][TOP] >UniRef100_Q9FXA1 AT1G49750 protein n=1 Tax=Arabidopsis thaliana RepID=Q9FXA1_ARATH Length = 494 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPPPPP PPP SP PPP PPS PPPP PPP + P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPS-PPPPQLPPPPQLPP 102 Score = 56.6 bits (135), Expect = 9e-07 Identities = 32/79 (40%), Positives = 36/79 (45%) Frame = +3 Query: 147 SSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQ 326 ++PPP PS P P A P P P PPPP+PPP P PPP Sbjct: 44 NNPPPSPSP------EPEPEPADC--------PPPPPPPPCPPPPSPPPCPPPPSPPPSP 89 Query: 327 KPPSHPPPPHSPPPTRHRP 383 PP PPPP PPP +P Sbjct: 90 PPPQLPPPPQLPPPAPPKP 108 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/84 (40%), Positives = 36/84 (42%), Gaps = 3/84 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP--PPPAPPPQSPL-LL 311 P+ SP P P P P PC P PPP PPP+PPP P L Sbjct: 48 PSPSPEPEPEPADCPPPPPPP-------------PCPPPPSPPPCPPPPSPPPSPPPPQL 94 Query: 312 PPPRQKPPSHPPPPHSPPPTRHRP 383 PPP Q PP PP P PPT P Sbjct: 95 PPPPQLPPPAPPKPQPSPPTPDLP 118 [188][TOP] >UniRef100_B9RS81 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RS81_RICCO Length = 516 Score = 58.2 bits (139), Expect = 3e-07 Identities = 39/98 (39%), Positives = 43/98 (43%), Gaps = 17/98 (17%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SSPPP P SP P + P SP PPPPPP PP SPL PPP Sbjct: 411 PLSSPPPPP-------FSPPPPPS----------PPLSPPPPPPPPPPPPSPSPLPPPPP 453 Query: 321 ------------RQKPPS-----HPPPPHSPPPTRHRP 383 + PPS +PPPP SPPP +P Sbjct: 454 PPFYSPPPPPTYQSPPPSPPPCVNPPPPPSPPPCLEQP 491 [189][TOP] >UniRef100_B8B832 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B832_ORYSI Length = 1521 Score = 58.2 bits (139), Expect = 3e-07 Identities = 42/117 (35%), Positives = 49/117 (41%), Gaps = 5/117 (4%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*P--TRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLP 314 P PPP +HF++ P P TR+GA P P P PPPP PPP + P Sbjct: 921 PPPPPPPPTTHFNAPPPPPPPPITRSGA--------PPPPPPPPGPPPPPPPPGARPGPP 972 Query: 315 PPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCR---PLRRSARGGGPPAGPEP 476 PP P + P PP PPP RP + P S R G PP P P Sbjct: 973 PPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPP 1029 Score = 53.5 bits (127), Expect = 8e-06 Identities = 43/124 (34%), Positives = 48/124 (38%), Gaps = 8/124 (6%) Frame = +3 Query: 129 LRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPP------PAPP 290 LR P PPP SH ++ P P A+R +P PPPPP P PP Sbjct: 890 LRSVPPPPPPPPISHSNAPPPPPLP-------AARFN----APPPPPPPPTTHFNAPPPP 938 Query: 291 PQSPLLL--PPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPA 464 P P+ PP PP PPPP PP R P P AR G PP Sbjct: 939 PPPPITRSGAPPPPPPPPGPPPPPPPPGARPGPPPP-----------PPPPGARPGPPPP 987 Query: 465 GPEP 476 P P Sbjct: 988 PPPP 991 [190][TOP] >UniRef100_Q93424 Protein E02A10.2, partially confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=Q93424_CAEEL Length = 385 Score = 58.2 bits (139), Expect = 3e-07 Identities = 33/64 (51%), Positives = 36/64 (56%) Frame = -3 Query: 382 GRCRVGGGECGGGGCDGGF*RGGGSRSGDCGGGAGGGGGGHDGDQHGHRRRDAHPAPARV 203 G C GGG CGGGG GG GGG G GGG GGGGGG G G ++R+A V Sbjct: 147 GGCGGGGGGCGGGG--GGCGGGGGGCGGGGGGGCGGGGGGGCGGGCGRKKREAINV---V 201 Query: 202 GHGD 191 GH D Sbjct: 202 GHDD 205 Score = 50.1 bits (118), Expect(2) = 2e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -3 Query: 382 GRCRVGGGECGGGG--CDGGF*RGGGSRSGDCGGGAGGGGGG 263 G C GGG CGGGG C GG GGG G CGGG GG GGG Sbjct: 63 GGCGGGGGGCGGGGGGCGGGGGCGGGG--GGCGGGGGGCGGG 102 Score = 25.4 bits (54), Expect(2) = 2e-06 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 242 PPPPRRSSRTRACGSWRQGTAGEVGRVGRGGGGG 141 PPPP G G G G G GGGGG Sbjct: 113 PPPPACGGGCGGGGGGCGGGCGGGGGGGCGGGGG 146 Score = 48.5 bits (114), Expect(2) = 6e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -3 Query: 382 GRCRVGGGECGGGGCDGGF*RGGGSRSGDCGGGAGGGGG 266 G C GGG CGGGG GG G G G CGGG G GGG Sbjct: 70 GGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGCGGG 108 Score = 25.0 bits (53), Expect(2) = 6e-06 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 239 PPPRRSSRTRACGSWRQGTAGEVGRVGRGGGGG 141 PPP + CG G G G G GG GG Sbjct: 111 PPPPPPACGGGCGGGGGGCGGGCGGGGGGGCGG 143 [191][TOP] >UniRef100_Q17G68 Formin 1,2/cappuccino n=1 Tax=Aedes aegypti RepID=Q17G68_AEDAE Length = 891 Score = 58.2 bits (139), Expect = 3e-07 Identities = 41/114 (35%), Positives = 46/114 (40%), Gaps = 1/114 (0%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P F + P P P P PPPPPP PPP S + +PP Sbjct: 307 PPPHPPPPPPMFKTAVAPPGP-------------PPLPP--PPPPPPPPPPISSVSIPPS 351 Query: 321 RQ-KPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPL 479 PP+ P PP PPPT PL A G GPPA P P+ Sbjct: 352 TSGGPPAPPLPPPPPPPT-----------------APL---AVGSGPPAPPPPM 385 [192][TOP] >UniRef100_B4N9Z0 GK12228 n=1 Tax=Drosophila willistoni RepID=B4N9Z0_DROWI Length = 451 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/60 (48%), Positives = 34/60 (56%), Gaps = 4/60 (6%) Frame = +3 Query: 237 RWPC-WSPSWPPPPPP---APPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRR 404 +WP ++P + PPPPP APPP P PPP PP PPPP PPP P G+ RR Sbjct: 80 QWPGDFNPYYRPPPPPPCGAPPPGPPPPGPPPPGPPPGCPPPPRGPPPRGSPPRGSPNRR 139 [193][TOP] >UniRef100_Q2U6Q3 Actin regulatory protein n=1 Tax=Aspergillus oryzae RepID=Q2U6Q3_ASPOR Length = 665 Score = 58.2 bits (139), Expect = 3e-07 Identities = 43/124 (34%), Positives = 49/124 (39%), Gaps = 12/124 (9%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P +S P P + P S S PPPPPP PPP S + PPP Sbjct: 447 PASQPPPPPVPAASRPTPPPPASSAVPPP-----PPPSSSVPPPPPPPPPPTSSVPPPPP 501 Query: 321 ------RQKPPSHPPPPHS------PPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPA 464 + PP+ PPPP S PPP P P + GG PP Sbjct: 502 PPPLPSSRGPPAPPPPPPSSSIPPPPPPPGRGPSAP---------PPPPPPAPAGGAPPP 552 Query: 465 GPEP 476 P P Sbjct: 553 PPPP 556 Score = 54.3 bits (129), Expect = 4e-06 Identities = 44/130 (33%), Positives = 48/130 (36%), Gaps = 12/130 (9%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*-PTRAGAG*ASRRRWPCWSPSWP---PPPPPA-------- 284 P PP P SS A+ P P + G AS P P P PPPPP Sbjct: 405 PPGPPPRPPPRTSSPAVPPQLPPKVPHGAASTPAPPPPPPRSPASQPPPPPVPAASRPTP 464 Query: 285 PPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPA 464 PPP S + PPP PPPP PPPT P PP Sbjct: 465 PPPASSAVPPPPPPSSSVPPPPPPPPPPTSSVP------------------------PPP 500 Query: 465 GPEPLSSTRG 494 P PL S+RG Sbjct: 501 PPPPLPSSRG 510 [194][TOP] >UniRef100_A1CMR3 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus clavatus RepID=A1CMR3_ASPCL Length = 642 Score = 58.2 bits (139), Expect = 3e-07 Identities = 33/76 (43%), Positives = 35/76 (46%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P SSPPP P ++ P P A A P PPPPPP PP S PPP Sbjct: 450 PISSPPPPPPVPAASRPIPPPPAASA-----------VPPPPPPPPPPPPSASIPPPPPP 498 Query: 321 RQKPPSHPPPPHSPPP 368 P SH PPP PPP Sbjct: 499 PPPPVSHVPPPRPPPP 514 Score = 53.5 bits (127), Expect = 8e-06 Identities = 42/127 (33%), Positives = 47/127 (37%), Gaps = 15/127 (11%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSP-SWPPPPPPA-------PPPQ 296 P PP P +S A P P P +P S PPPPPP PPP Sbjct: 424 PPQLPPKVPHAPTSAAGPPPPP------------PARNPISSPPPPPPVPAASRPIPPPP 471 Query: 297 SPLLLPPPRQKPPS-------HPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGG 455 + +PPP PP PPPP PPP H P RP + GG Sbjct: 472 AASAVPPPPPPPPPPPPSASIPPPPPPPPPPVSHVP-----------PPRPPPPPSSGGP 520 Query: 456 PPAGPEP 476 PP P P Sbjct: 521 PPPPPPP 527 [195][TOP] >UniRef100_UPI0001983015 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001983015 Length = 469 Score = 57.8 bits (138), Expect = 4e-07 Identities = 42/123 (34%), Positives = 53/123 (43%), Gaps = 8/123 (6%) Frame = +3 Query: 24 VPCSPAVASWRA--GSCARQTRCPLLKRRELGGSSLPLRG--CPTSSPPPYPSHFSSGAL 191 VPCSP ++ SC Q P +K G P G CP PPP P + Sbjct: 44 VPCSPPPSTPPPPRNSCPTQVCPPCVK-----GICPPCIGKPCPPPPPPPPPPKVTPPPP 98 Query: 192 SP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPP----SHPPPPHS 359 P P A + P +P PPP PPP +P+ PPP++ PP PPP + Sbjct: 99 PPVPVPA----PPPKGTPPPAPVPAPPPKETPPPPAPVPAPPPKETPPPAPVPAPPPKQT 154 Query: 360 PPP 368 PPP Sbjct: 155 PPP 157 Score = 50.4 bits (119), Expect(2) = 6e-06 Identities = 20/40 (50%), Positives = 26/40 (65%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPPP P PPP +P+ PPP++ PP P P +PPP + P Sbjct: 366 PPPPSPPPPPPAPIPAPPPKETPPP-PAPVPAPPPKKTLP 404 Score = 23.1 bits (48), Expect(2) = 6e-06 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +1 Query: 121 PCRYAGVPPPPPLPTLPTSPAVP 189 PCR PPP P P P P Sbjct: 345 PCRPPPPPPPVPGPAPPPKVTPP 367 [196][TOP] >UniRef100_UPI000155DCD8 PREDICTED: similar to WAS protein family, member 2 n=1 Tax=Equus caballus RepID=UPI000155DCD8 Length = 498 Score = 57.8 bits (138), Expect = 4e-07 Identities = 41/115 (35%), Positives = 45/115 (39%), Gaps = 4/115 (3%) Frame = +3 Query: 150 SPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSP----SWPPPPPPAPPPQSPLLLPP 317 SPPP P F S P P+ P + P + PPPPPP P P L PP Sbjct: 333 SPPPPPGGFGSPGTPPPPSP-----------PSFPPHPDFAAPPPPPPPPAADYPTLPPP 381 Query: 318 PRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLS 482 P +P PPP PPP P PL S G PA P PLS Sbjct: 382 PLSQPTGGAPPPPPPPPPPGPP--------------PLPFSG-ADGQPAAPPPLS 421 [197][TOP] >UniRef100_UPI0000F2D0CF PREDICTED: similar to reverse transcriptase n=1 Tax=Monodelphis domestica RepID=UPI0000F2D0CF Length = 573 Score = 57.8 bits (138), Expect = 4e-07 Identities = 50/159 (31%), Positives = 57/159 (35%), Gaps = 35/159 (22%) Frame = +3 Query: 105 ELGGSSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP---- 272 +L +S P P S PP P+ FS P + G+G A +R SPS PPP Sbjct: 251 QLDSNSPPSPTFPDDSLPPPPAEFSY----PADNQRGSGSAGPKRSSLVSPSHPPPAPPL 306 Query: 273 ----------PPPAPPPQSPLL---------------LPPPRQKP--PSHP----PPPHS 359 PPAPPP P+ PPP P P HP PPP Sbjct: 307 VSPPGPRPGFAPPAPPPPPPMAGVPPPPPPVGFASPGTPPPPSPPSFPPHPDFAAPPPPP 366 Query: 360 PPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEP 476 PPP PC P GG PP P P Sbjct: 367 PPPAADYPC----------LPPPPIAQPTGGAPPPPPPP 395 Score = 54.3 bits (129), Expect = 4e-06 Identities = 36/94 (38%), Positives = 42/94 (44%), Gaps = 13/94 (13%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPP------PPPPAP 287 P+ G P PPP P F+S P P+ PS+PP PPPP P Sbjct: 326 PMAGVP---PPPPPVGFASPGTPPPPS---------------PPSFPPHPDFAAPPPPPP 367 Query: 288 PPQS--PLLLPPPRQKP-----PSHPPPPHSPPP 368 PP + P L PPP +P P PPPP PPP Sbjct: 368 PPAADYPCLPPPPIAQPTGGAPPPPPPPPPGPPP 401 [198][TOP] >UniRef100_Q9E940 ICP4 protein n=1 Tax=Gallid herpesvirus 3 RepID=Q9E940_9ALPH Length = 2033 Score = 57.8 bits (138), Expect = 4e-07 Identities = 44/130 (33%), Positives = 54/130 (41%), Gaps = 7/130 (5%) Frame = +3 Query: 3 PASYLSHVPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPYPSH--- 173 P +S PC P G+C C +LP P+ PPP P Sbjct: 161 PVRCVSDAPCKPT------GACTPLAVCV---------ETLPP---PSGVPPPPPPEPIV 202 Query: 174 ---FSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHP 344 ++ L+P P + P SP P PPP +PPP +P L PP PP H Sbjct: 203 NFPWTFSPLTPGPFAQHHS-PTPPTPPPLSPPPPTPPPLSPPPPTPPPLSPPPPTPPPHT 261 Query: 345 PPPH-SPPPT 371 PPPH SPPPT Sbjct: 262 PPPHGSPPPT 271 [199][TOP] >UniRef100_Q9E938 ICP4 protein n=1 Tax=Gallid herpesvirus 3 RepID=Q9E938_9ALPH Length = 2033 Score = 57.8 bits (138), Expect = 4e-07 Identities = 44/130 (33%), Positives = 54/130 (41%), Gaps = 7/130 (5%) Frame = +3 Query: 3 PASYLSHVPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPYPSH--- 173 P +S PC P G+C C +LP P+ PPP P Sbjct: 161 PVRCVSDAPCKPT------GACTPLAVCV---------ETLPP---PSGVPPPPPPEPIV 202 Query: 174 ---FSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHP 344 ++ L+P P + P SP P PPP +PPP +P L PP PP H Sbjct: 203 NFPWTFSPLTPGPFAQHHS-PTPPTPPPLSPPPPTPPPLSPPPPTPPPLSPPPPTPPPHT 261 Query: 345 PPPH-SPPPT 371 PPPH SPPPT Sbjct: 262 PPPHGSPPPT 271 [200][TOP] >UniRef100_Q64371 PR-Vbeta1 n=2 Tax=Rattus RepID=Q64371_RAT Length = 148 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/81 (41%), Positives = 36/81 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P F G P P G G + P PPPPPP PPP P PPP Sbjct: 35 PPPPPPPPPPPFGPGIGQPPPPHFGPG---------FGP--PPPPPPPPPPFGPGFGPPP 83 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 PP PP+ P P HRP Sbjct: 84 -PPPPFGFYPPYIPHPPHHRP 103 [201][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +3 Query: 246 CWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 C P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [202][TOP] >UniRef100_Q5I2R0 Minus agglutinin n=1 Tax=Chlamydomonas incerta RepID=Q5I2R0_CHLIN Length = 4027 Score = 57.8 bits (138), Expect = 4e-07 Identities = 53/149 (35%), Positives = 60/149 (40%), Gaps = 19/149 (12%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*--------PTRAGAG*ASRRRWPCWSP----- 257 SS P P S PP P S G P P+ A R P SP Sbjct: 1485 SSAPPAPVPPSPGPPSPQPPSPGPAPPVQLPPSPRPPSLEPPSPAPRPPQPSPSPPSNPS 1544 Query: 258 --SWPPPPPPAPPPQSPLLLPPPRQKPPSHPPP-PHSPPPT-RHRPCGTCRRRT*RQRCR 425 S PP PPPAP P SP L PPP PP+ PP P P PT + C + RT Sbjct: 1545 PPSRPPAPPPAPQPPSPPLAPPPAPPPPAPPPSLPQPPGPTVTTQDCSSAAART----SF 1600 Query: 426 PLRRSARGGGPPAGPEPLSSTRGC--CGC 506 + ++RG A P SS C CGC Sbjct: 1601 AVASASRGAFFIAVAVPGSSPSYCQVCGC 1629 Score = 54.7 bits (130), Expect = 3e-06 Identities = 33/82 (40%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP-PPAPPPQSPLLLPP 317 P S PPP P+ S L+P P S P +P P P PP PPPQ P P Sbjct: 1356 PPSQPPPSPALPSPHPLAPFPPSPQPPSPSAPAPPSPAPLEPAAPVPPGPPPQPPGAPAP 1415 Query: 318 PRQKPPSHPPPPHSPPPTRHRP 383 P PPS PP +PP RP Sbjct: 1416 PAPPPPSPAPPSPAPPSPEPRP 1437 [203][TOP] >UniRef100_Q49I31 120 kDa pistil extensin-like protein (Fragment) n=1 Tax=Nicotiana langsdorffii RepID=Q49I31_9SOLA Length = 237 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/81 (41%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P P P+ A A++R P PS PPP APPP+ PL PPP Sbjct: 34 PAKQPPPPPPSAKPPVKPPSPSPAAQPPATQRATP---PSQPPPMQRAPPPKLPLP-PPP 89 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 Q P PPPP + P R P Sbjct: 90 AQLPIRQPPPPATQLPIRKPP 110 [204][TOP] >UniRef100_O49986 120 kDa style glycoprotein n=1 Tax=Nicotiana alata RepID=O49986_NICAL Length = 461 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/81 (41%), Positives = 39/81 (48%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P P P+ A A++R P PS PPP APPP+ PL PPP Sbjct: 119 PAKQPPPPPPSAKPPVKPPSPSPAAQPPATQRATP---PSQPPPMQRAPPPKLPLP-PPP 174 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 Q P PPPP + P R P Sbjct: 175 AQLPIRQPPPPATQLPIRKPP 195 [205][TOP] >UniRef100_C5Z794 Putative uncharacterized protein Sb10g026240 n=1 Tax=Sorghum bicolor RepID=C5Z794_SORBI Length = 514 Score = 57.8 bits (138), Expect = 4e-07 Identities = 39/94 (41%), Positives = 44/94 (46%), Gaps = 5/94 (5%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP--APP 290 SS +R PT SPP PS A SP T+ SPS PPPPPP P Sbjct: 53 SSPAIRTAPTVSPPLAPSPSPPSAPSPPVTQQT------------SPSPPPPPPPPSPSP 100 Query: 291 PQSPLLLPPPRQKPPSHPP--PPHSPP-PTRHRP 383 P +PL + P PP PP PHSPP P + P Sbjct: 101 PSAPLTIQAPHSPPPPPPPIQAPHSPPSPPKQTP 134 [206][TOP] >UniRef100_C1EC93 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EC93_9CHLO Length = 402 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/48 (58%), Positives = 31/48 (64%), Gaps = 5/48 (10%) Frame = +3 Query: 240 WPCW--SPSWPPPP-PPAPPPQSPLLLPPPR--QKPPSHPPPPHSPPP 368 WP W +PS PPPP PP+PPP P PPPR PP+ PPP SPPP Sbjct: 278 WPPWPDAPSPPPPPSPPSPPPSPPAPPPPPRPPPSPPNPPPPLPSPPP 325 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/50 (50%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +3 Query: 240 WPCWSPSWP--PPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 WP W P WP P PPP P P SP PP PP PP P +PPP P Sbjct: 275 WPAWPP-WPDAPSPPPPPSPPSPPPSPPAPPPPPRPPPSPPNPPPPLPSP 323 [207][TOP] >UniRef100_B9RLA3 ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RLA3_RICCO Length = 811 Score = 57.8 bits (138), Expect = 4e-07 Identities = 48/133 (36%), Positives = 52/133 (39%), Gaps = 12/133 (9%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP-------PPA 284 P PT+SPPP S A SP P P SP PPPP PP+ Sbjct: 170 PPSNTPTTSPPP--SSARPPANSPPPASLSP--------PQESPPSPPPPSSKPPENPPS 219 Query: 285 PPPQSPLLLPPPRQKPPSHPPPPHSP--PPTRHRPCGTCRRRT*RQRCRPLRRSARGGG- 455 PPP PP PPS PPPP +P PPT P P RRS G Sbjct: 220 PPPPPATPSEPPTNSPPSPPPPPATPSEPPTNSSPPPV--------SVPPPRRSPPGPAA 271 Query: 456 --PPAGPEPLSST 488 P P P +ST Sbjct: 272 TPPTTSPPPPAST 284 [208][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +3 Query: 246 CWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 C P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [209][TOP] >UniRef100_B3XYC5 Chitin-binding lectin n=1 Tax=Solanum lycopersicum var. cerasiforme RepID=B3XYC5_SOLLC Length = 365 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/82 (42%), Positives = 39/82 (47%) Frame = +3 Query: 138 CPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP 317 CP + PP PS P P+ P SPS PPPP P+PPP +P PP Sbjct: 92 CPHTPSPPPPSPPPPSPSPPPPSP-----------PPPSPS-PPPPTPSPPPPAP-SPPP 138 Query: 318 PRQKPPSHPPPPHSPPPTRHRP 383 P PPS PPP SPPP P Sbjct: 139 PSPPPPSPSPPPPSPPPPSPSP 160 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/86 (40%), Positives = 39/86 (45%), Gaps = 3/86 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP PS P P + + P P PPPP P+PPP +P PP Sbjct: 112 PPSPPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPS 171 Query: 321 RQKPP---SHPPPPHSPPPTRHRPCG 389 PP S PPP SPPP R CG Sbjct: 172 PSPPPPTPSPPPPAPSPPPPYPR-CG 196 [210][TOP] >UniRef100_A9SKS2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SKS2_PHYPA Length = 250 Score = 57.8 bits (138), Expect = 4e-07 Identities = 39/95 (41%), Positives = 42/95 (44%), Gaps = 9/95 (9%) Frame = -3 Query: 367 GGGECGGGGCDGGF*RGGGSRSGDCGGGAGGGGGGHDGDQHGHRRRDAHPAPARV----- 203 GGG GGGG GG GGG G GGG GGGGGG G G R R P R Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDRNRGGGRGPYRPPWNPP 163 Query: 202 ----GHGDKAPLEKWEG*GGGEEVGHPRSGRDEPP 110 G G + G GGG G+ GR+ PP Sbjct: 164 RDDRGRG-RGRDRGGGGGGGGGGGGNNNGGRNNPP 197 [211][TOP] >UniRef100_B9QH39 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii VEG RepID=B9QH39_TOXGO Length = 377 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = +3 Query: 252 SPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 S S PPPPPP+PPP SP PPP PPS PPP PPP P Sbjct: 49 SSSLPPPPPPSPPPPSP---PPPSPPPPSPPPPSPPPPPPVEDP 89 [212][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTR 374 P PPPPPP PPP P PPP PP PPPP PPP R Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLR 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCG 389 PPPPPP PPP P PPP PP PPPP PPP P G Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKG 44 [213][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 57.8 bits (138), Expect = 4e-07 Identities = 37/95 (38%), Positives = 37/95 (38%) Frame = +3 Query: 123 LPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSP 302 LP R P PPP P P P P P PPPPPP PPP P Sbjct: 23 LPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-------PPPPPPPPPPPPPPPPPPPP 75 Query: 303 LLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT 407 PPP PP PPPP PPP P RT Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIPLRT 110 [214][TOP] >UniRef100_B8NKG8 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus flavus NRRL3357 RepID=B8NKG8_ASPFN Length = 692 Score = 57.8 bits (138), Expect = 4e-07 Identities = 43/124 (34%), Positives = 51/124 (41%), Gaps = 12/124 (9%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P ++ +P P + A P S S PPPPPP PPP S + PPP Sbjct: 473 PASQPPPPPPVPAASRPTPPPPASSAVPPP----PPPSSSVPPPPPPPPPPTSSVPPPPP 528 Query: 321 ------RQKPPSHPPPPHS------PPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPA 464 + PP+ PPPP S PPP P P + GG PP Sbjct: 529 PPPLPSSRGPPAPPPPPPSSSIPRPPPPPGRGPSAP---------PPPPPPAPAGGAPPP 579 Query: 465 GPEP 476 P P Sbjct: 580 PPPP 583 [215][TOP] >UniRef100_Q9FPQ6 Vegetative cell wall protein gp1 n=1 Tax=Chlamydomonas reinhardtii RepID=GP1_CHLRE Length = 555 Score = 57.8 bits (138), Expect = 4e-07 Identities = 32/81 (39%), Positives = 36/81 (44%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P+ +PP PS SP P SPS P PP P PP +P PP Sbjct: 213 PSPAPPSPPSPAPPSPPSPAPP---------------SPSPPAPPSPVPPSPAPPSPAPP 257 Query: 321 RQKPPSHPPPPHSPPPTRHRP 383 KPP+ PPPP PPP RP Sbjct: 258 SPKPPAPPPPPSPPPPPPPRP 278 [216][TOP] >UniRef100_Q6SSE6 Plus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE6_CHLRE Length = 3409 Score = 52.4 bits (124), Expect(2) = 4e-07 Identities = 28/72 (38%), Positives = 32/72 (44%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSA 443 PP PPP PP P LLPP PP PP P SPPP+ P P+ R Sbjct: 481 PPRPPPLPPSPPPPLLPPSPPVPPPSPPSPPSPPPSPPEPPSPPPLPPSPPSPTPVARCI 540 Query: 444 RGGGPPAGPEPL 479 + GG P P+ Sbjct: 541 QVGGICDSPSPM 552 Score = 25.0 bits (53), Expect(2) = 4e-07 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 470 PPPPPSPPSPRPPRPP 485 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 22/43 (51%), Positives = 25/43 (58%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PPP++ PR PP HPP P SPP + P Sbjct: 561 PPSPPPPPPRPPPRA------PRPSPPFHPPSPDSPPASSVPP 597 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVPCR 195 P PPPLP P SP R Sbjct: 521 PSPPPLPPSPPSPTPVAR 538 Score = 53.5 bits (127), Expect = 8e-06 Identities = 36/93 (38%), Positives = 40/93 (43%), Gaps = 1/93 (1%) Frame = +3 Query: 117 SSLPLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWP-PPPPPAPPP 293 S P P S PP P+ S SP P SP P PPPPP+P P Sbjct: 888 SPAPPSPAPPSPEPPSPAPPSPAPPSPQPPSPEPP----------SPEPPSPPPPPSPAP 937 Query: 294 QSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGT 392 SP PP +PPS PPPP PP+ P T Sbjct: 938 PSPA---PPSPEPPSPPPPPSPAPPSPAPPSPT 967 [217][TOP] >UniRef100_C5JZG9 Actin cytoskeleton-regulatory complex protein PAN1 n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JZG9_AJEDS Length = 1532 Score = 47.4 bits (111), Expect(2) = 4e-07 Identities = 28/71 (39%), Positives = 29/71 (40%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSA 443 PPPPPPAP +P PPP PS PP PPP P G A Sbjct: 1433 PPPPPPAPFTDAPPTAPPPPPPVPSAAAPPPPPPP----PIG-----------------A 1471 Query: 444 RGGGPPAGPEP 476 GGPP P P Sbjct: 1472 APGGPPPPPPP 1482 Score = 30.0 bits (66), Expect(2) = 4e-07 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 133 AGVPPPPPLPTLPTSPAVPCRHDPHARVRDE 225 A PPPPP P + + P P D A DE Sbjct: 1389 AAPPPPPPAPPVVSEPPPPAHPDEDAEEDDE 1419 [218][TOP] >UniRef100_A1L1L5 Ccnk protein n=1 Tax=Rattus norvegicus RepID=A1L1L5_RAT Length = 589 Score = 47.4 bits (111), Expect(2) = 4e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 506 PTIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 545 Score = 30.0 bits (66), Expect(2) = 4e-07 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S P +P Sbjct: 479 HLTYHPHVYPPNPPPPPVPPPPASFPPPTIP 509 [219][TOP] >UniRef100_UPI0001B7AFE7 UPI0001B7AFE7 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7AFE7 Length = 582 Score = 47.4 bits (111), Expect(2) = 4e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 499 PTIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 538 Score = 30.0 bits (66), Expect(2) = 4e-07 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S P +P Sbjct: 472 HLTYHPHVYPPNPPPPPVPPPPASFPPPTIP 502 [220][TOP] >UniRef100_Q3U3M5 Putative uncharacterized protein n=1 Tax=Mus musculus RepID=Q3U3M5_MOUSE Length = 582 Score = 47.4 bits (111), Expect(2) = 4e-07 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 255 PSWPPPPP---PAPPPQSPLLLPPPRQKPPSHPPPPHSPP 365 P+ PPP P P PP +P PPP + PP+H PPH PP Sbjct: 499 PTIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPP 538 Score = 30.0 bits (66), Expect(2) = 4e-07 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +1 Query: 106 NLVAHPCRYAGVPPPPPLPTLPTS---PAVP 189 +L HP Y PPPPP+P P S P +P Sbjct: 472 HLTYHPHVYPPNPPPPPVPPPPASFPPPTIP 502 [221][TOP] >UniRef100_A8IZG7 Plus agglutinin protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8IZG7_CHLRE Length = 559 Score = 52.4 bits (124), Expect(2) = 4e-07 Identities = 28/72 (38%), Positives = 32/72 (44%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSA 443 PP PPP PP P LLPP PP PP P SPPP+ P P+ R Sbjct: 481 PPRPPPLPPSPPPPLLPPSPPVPPPSPPSPPSPPPSPPEPPSPPPLPPSPPSPTPVARCI 540 Query: 444 RGGGPPAGPEPL 479 + GG P P+ Sbjct: 541 QVGGICDSPSPM 552 Score = 25.0 bits (53), Expect(2) = 4e-07 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 470 PPPPPSPPSPRPPRPP 485 [222][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 57.4 bits (137), Expect = 5e-07 Identities = 42/116 (36%), Positives = 44/116 (37%), Gaps = 2/116 (1%) Frame = +3 Query: 27 PCSPAVASWRAGSCARQTRCPL--LKRRELGGSSLPLRGCPTSSPPPYPSHFSSGALSP* 200 P PA + A A Q C L L GS P P PPP P P Sbjct: 57 PVQPAAPAPLAYPMANQLPCTLAPLLPPVTDGSKPPPPPQPACPPPP-PGCGPPPPCPPP 115 Query: 201 PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PC P PPPPP PP P+ PPP PP PPPP PPP Sbjct: 116 PA------------PCPPP---PPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPP 156 Score = 53.9 bits (128), Expect(2) = 1e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPPPPP PPP PL PPP PP P PP PPP P Sbjct: 195 PPPPPPPPPPPCPLPPPPPPCPPPPAPCPPPPPPPACPAP 234 Score = 21.9 bits (45), Expect(2) = 1e-06 Identities = 10/18 (55%), Positives = 10/18 (55%), Gaps = 2/18 (11%) Frame = +1 Query: 142 PPPPP--LPTLPTSPAVP 189 PPPPP LP P P P Sbjct: 186 PPPPPMCLPPPPPPPPPP 203 [223][TOP] >UniRef100_UPI0000E82048 PREDICTED: similar to WASP-family protein n=1 Tax=Gallus gallus RepID=UPI0000E82048 Length = 500 Score = 57.4 bits (137), Expect = 5e-07 Identities = 51/157 (32%), Positives = 58/157 (36%), Gaps = 41/157 (26%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP---------------P 275 P S PP P FS P + G+G +R SPS PPP P Sbjct: 263 PDDSLPPPPVEFSY----PVDNQRGSGSGGTKRSSLVSPSHPPPAPPIGSPAGARPGFAP 318 Query: 276 PPAPPPQSPLL-----------LPPPRQKPPSHPP--PPH----SPPPTRHRPCGTCRRR 404 PPAPPP PL+ P P PP PP PPH +PPP P Sbjct: 319 PPAPPPPPPLMGSTPPPPPPVGFPSPGTPPPPSPPSFPPHPEFAAPPPPPPPPAAE---- 374 Query: 405 T*RQRCRPLRRSARGGG---------PPAGPEPLSST 488 +P GGG PP GP PLSS+ Sbjct: 375 --YSSVQPPPLPQPGGGSAPPPPPPPPPPGPPPLSSS 409 [224][TOP] >UniRef100_UPI0000E22B4E PREDICTED: splicing factor 1 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E22B4E Length = 675 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/76 (39%), Positives = 36/76 (47%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P +P P + G P P G+ A +P + PPPPPP PPPQ P PPP Sbjct: 32 PPPAPGPGAGLLAPGPPPPPPPPVGSMGALTAAFPFAALPPPPPPPPPPPPQQPPPPPPP 91 Query: 321 RQKPPSHPPPPHSPPP 368 S+PPP PPP Sbjct: 92 PSPGASYPPPQPLPPP 107 [225][TOP] >UniRef100_UPI0000E1F8E7 PREDICTED: Ras association and pleckstrin homology domains 1 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E1F8E7 Length = 1252 Score = 57.4 bits (137), Expect = 5e-07 Identities = 55/180 (30%), Positives = 70/180 (38%), Gaps = 13/180 (7%) Frame = +3 Query: 3 PASYLSH------VPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPY 164 PASY+ VP P + CA+ PL S+ + PPP Sbjct: 822 PASYIPPSPPTPPVPVPPPTLPKQQSFCAKPPPSPLSPV-----PSVVKQIASQFPPPPT 876 Query: 165 PSHFSSGALSP*PTR-AGAG*ASRRRWPCWSPSWPPPPPP---APPPQSPLLLPPPRQKP 332 P S L P P A + + P W PS P P P PPP+S L+ PPP P Sbjct: 877 PPAMESQPLKPVPANVAPQSPPAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSP 936 Query: 333 PSHPPPPHSPPPTRH---RPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSSTRGCCG 503 PPPP PPPT G+ ++T + S G PP P+ SS + G Sbjct: 937 VPAPPPP--PPPTASPTPDKSGSPGKKTSK------TSSPGGKKPPPTPQRNSSIKSSSG 988 [226][TOP] >UniRef100_UPI0000E1F8E6 PREDICTED: Ras association and pleckstrin homology domains 1 isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E1F8E6 Length = 1304 Score = 57.4 bits (137), Expect = 5e-07 Identities = 55/180 (30%), Positives = 70/180 (38%), Gaps = 13/180 (7%) Frame = +3 Query: 3 PASYLSH------VPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPY 164 PASY+ VP P + CA+ PL S+ + PPP Sbjct: 874 PASYIPPSPPTPPVPVPPPTLPKQQSFCAKPPPSPLSPV-----PSVVKQIASQFPPPPT 928 Query: 165 PSHFSSGALSP*PTR-AGAG*ASRRRWPCWSPSWPPPPPP---APPPQSPLLLPPPRQKP 332 P S L P P A + + P W PS P P P PPP+S L+ PPP P Sbjct: 929 PPAMESQPLKPVPANVAPQSPPAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSP 988 Query: 333 PSHPPPPHSPPPTRH---RPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSSTRGCCG 503 PPPP PPPT G+ ++T + S G PP P+ SS + G Sbjct: 989 VPAPPPP--PPPTASPTPDKSGSPGKKTSK------TSSPGGKKPPPTPQRNSSIKSSSG 1040 [227][TOP] >UniRef100_UPI0001951234 Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein). n=1 Tax=Canis lupus familiaris RepID=UPI0001951234 Length = 1045 Score = 57.4 bits (137), Expect = 5e-07 Identities = 41/130 (31%), Positives = 49/130 (37%), Gaps = 3/130 (2%) Frame = +3 Query: 3 PASYLSHVPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPYPSHFSS 182 P S LS VP P+V +++ P P PP P + Sbjct: 783 PPSPLSPVPSVPSVV------------------KQIASQFPPPPAPPPGEPPFKPPSTNV 824 Query: 183 GALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP---APPPQSPLLLPPPRQKPPSHPPPP 353 SP +A P W PS P P P PPP+S L+ PPP PP PPPP Sbjct: 825 APQSPPAVKAK---------PKWQPSSIPVPSPDFPPPPPESSLVFPPPPPPPPPPPPPP 875 Query: 354 HSPPPTRHRP 383 PPP P Sbjct: 876 PPPPPPAPAP 885 [228][TOP] >UniRef100_UPI0000ECC14B UPI0000ECC14B related cluster n=1 Tax=Gallus gallus RepID=UPI0000ECC14B Length = 508 Score = 57.4 bits (137), Expect = 5e-07 Identities = 51/157 (32%), Positives = 58/157 (36%), Gaps = 41/157 (26%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP---------------P 275 P S PP P FS P + G+G +R SPS PPP P Sbjct: 271 PDDSLPPPPVEFSY----PVDNQRGSGSGGTKRSSLVSPSHPPPAPPIGSPAGARPGFAP 326 Query: 276 PPAPPPQSPLL-----------LPPPRQKPPSHPP--PPH----SPPPTRHRPCGTCRRR 404 PPAPPP PL+ P P PP PP PPH +PPP P Sbjct: 327 PPAPPPPPPLMGSTPPPPPPVGFPSPGTPPPPSPPSFPPHPEFAAPPPPPPPPAAE---- 382 Query: 405 T*RQRCRPLRRSARGGG---------PPAGPEPLSST 488 +P GGG PP GP PLSS+ Sbjct: 383 --YSSVQPPPLPQPGGGSAPPPPPPPPPPGPPPLSSS 417 [229][TOP] >UniRef100_A1TG37 Putative uncharacterized protein n=1 Tax=Mycobacterium vanbaalenii PYR-1 RepID=A1TG37_MYCVP Length = 396 Score = 57.4 bits (137), Expect = 5e-07 Identities = 33/76 (43%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +3 Query: 159 PYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPS 338 P H G +P R AG A RR P W PPP PAPPP P PPP P Sbjct: 190 PAEPHPPEGEWAP---RGEAGGAHRRS--AEQPQWAPPPAPAPPPPPPPPPPPPPPPPAQ 244 Query: 339 HPPPPHSP-PPTRHRP 383 PPPP P PP +P Sbjct: 245 QPPPPPQPTPPPAQQP 260 [230][TOP] >UniRef100_Q7DLN2 Pistil extensin like protein, partial CDS only (Fragment) n=1 Tax=Nicotiana tabacum RepID=Q7DLN2_TOBAC Length = 171 Score = 57.4 bits (137), Expect = 5e-07 Identities = 37/96 (38%), Positives = 43/96 (44%), Gaps = 11/96 (11%) Frame = +3 Query: 243 PC---WSPSWPPPPP-PAPPPQSPLLLPPPRQKP-PSHPPPPHS------PPPTRHRPCG 389 PC W WPPPPP P PPP+ P PR +P PS PPPP PPP R RPC Sbjct: 12 PCYLTWPFPWPPPPPWPCPPPR-----PRPRPRPCPSPPPPPRPRPCPSPPPPPRPRPCP 66 Query: 390 TCRRRT*RQRCRPLRRSARGGGPPAGPEPLSSTRGC 497 + P + R PP P P + + C Sbjct: 67 S--------PPPPPQPRPRPSPPPPSPPPPAPSSSC 94 Score = 54.7 bits (130), Expect = 3e-06 Identities = 33/82 (40%), Positives = 35/82 (42%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P SP P R PC SP PPPP P P P P PPP Sbjct: 26 PWPCPPPRPRPRPRPCPSPPPPP--------RPRPCPSP--PPPPRPRPCPSPP---PPP 72 Query: 321 RQKPPSHPPPPHSPPPTRHRPC 386 + +P PPPP PPP C Sbjct: 73 QPRPRPSPPPPSPPPPAPSSSC 94 [231][TOP] >UniRef100_Q08194 Cysteine-rich extensin-like protein-1 n=1 Tax=Nicotiana tabacum RepID=Q08194_TOBAC Length = 209 Score = 57.4 bits (137), Expect = 5e-07 Identities = 37/96 (38%), Positives = 43/96 (44%), Gaps = 11/96 (11%) Frame = +3 Query: 243 PC---WSPSWPPPPP-PAPPPQSPLLLPPPRQKP-PSHPPPPHS------PPPTRHRPCG 389 PC W WPPPPP P PPP+ P PR +P PS PPPP PPP R RPC Sbjct: 50 PCYLTWPFPWPPPPPWPCPPPR-----PRPRPRPCPSPPPPPRPRPCPSPPPPPRPRPCP 104 Query: 390 TCRRRT*RQRCRPLRRSARGGGPPAGPEPLSSTRGC 497 + P + R PP P P + + C Sbjct: 105 S--------PPPPPQPRPRPSPPPPSPPPPAPSSSC 132 Score = 54.7 bits (130), Expect = 3e-06 Identities = 33/82 (40%), Positives = 35/82 (42%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P PPP P SP P R PC SP PPPP P P P P PPP Sbjct: 64 PWPCPPPRPRPRPRPCPSPPPPP--------RPRPCPSP--PPPPRPRPCPSPP---PPP 110 Query: 321 RQKPPSHPPPPHSPPPTRHRPC 386 + +P PPPP PPP C Sbjct: 111 QPRPRPSPPPPSPPPPAPSSSC 132 [232][TOP] >UniRef100_C7BGM9 Formin 2B n=1 Tax=Physcomitrella patens RepID=C7BGM9_PHYPA Length = 1329 Score = 57.4 bits (137), Expect = 5e-07 Identities = 49/135 (36%), Positives = 51/135 (37%), Gaps = 13/135 (9%) Frame = +3 Query: 126 PLRGCPTSSPPPYP---SHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPP-----PPP 281 P G P PPP P +SGA +P P G S P P PPP PPP Sbjct: 725 PNSGAPAPPPPPPPPSGGRPNSGAPAPPPPPFGGRPNSGAPGP--PPPPPPPGKSGAPPP 782 Query: 282 APPPQSPLLLPPPRQKPPSH----PPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARG 449 PPP PPP PP PPP PPP RP G P RG Sbjct: 783 PPPPPGRSDAPPPPPPPPGDRGVGGPPPPPPPPGAPRPGG--------PPPPPPPPGGRG 834 Query: 450 -GGPPAGPEPLSSTR 491 GGPP P P R Sbjct: 835 VGGPPPPPPPPGGAR 849 Score = 54.3 bits (129), Expect = 4e-06 Identities = 44/144 (30%), Positives = 50/144 (34%), Gaps = 21/144 (14%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPL 305 P G P PPP+ +SGA P P G + P P PPP PPP Sbjct: 744 PNSGAPAPPPPPFGGRPNSGAPGPPPPPPPPGKSGAPPPPPPPPGRSDAPPPPPPPPGDR 803 Query: 306 LL--PPPRQKPPSHP-------------------PPPHSPPPTRHRPCGTCRRRT*RQRC 422 + PPP PP P PPP PPP RP G Sbjct: 804 GVGGPPPPPPPPGAPRPGGPPPPPPPPGGRGVGGPPPPPPPPGGARPGGPLP-------- 855 Query: 423 RPLRRSARGGGPPAGPEPLSSTRG 494 P +G G P P P S+ RG Sbjct: 856 PPPPPGGKGPGGPPPPPPPSAGRG 879 [233][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PPP P PPP PP PPPP PPP +P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQP 46 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 49.3 bits (116), Expect(2) = 6e-06 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 P PPPPPP PPP PPP PP PPPP P P+ P Sbjct: 15 PPPPPPPPPPPPP------PPPPPPPPPPPPPPPPPQPSEILP 51 Score = 24.3 bits (51), Expect(2) = 6e-06 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 142 PPPPPLPTLPTSPAVP 189 PPPPP P P P P Sbjct: 3 PPPPPPPPPPPPPPPP 18 [234][TOP] >UniRef100_C5X9Y5 Putative uncharacterized protein Sb02g034435 n=1 Tax=Sorghum bicolor RepID=C5X9Y5_SORBI Length = 310 Score = 57.4 bits (137), Expect = 5e-07 Identities = 38/88 (43%), Positives = 40/88 (45%), Gaps = 3/88 (3%) Frame = -3 Query: 496 HPRVDDRGSGPAG---GPPPRADRLRGLQRCLHVLRRHVPHGRCRVGGGECGGGGCDGGF 326 H DD GP G GP P+ RG + R GRCR GGG GGGG GG Sbjct: 30 HDDYDDPRYGPGGFGRGPGPKGGYGRGPRFGRGPFGRDCRFGRCRGGGGGLGGGGGFGGG 89 Query: 325 *RGGGSRSGDCGGGAGGGGGGHDGDQHG 242 GG GGG GGGGGG G G Sbjct: 90 GGAGGGGGLGGGGGLGGGGGGGLGGGGG 117 [235][TOP] >UniRef100_B9HWP9 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9HWP9_POPTR Length = 390 Score = 57.4 bits (137), Expect = 5e-07 Identities = 45/124 (36%), Positives = 52/124 (41%), Gaps = 7/124 (5%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWP----PPPPPAPPP 293 PL PTSS PP PS + SP P+ +S SPS P PPPP +PPP Sbjct: 136 PLLNPPTSSSPPSPST-TPPQNSPPPSSTPPPQSS-------SPSPPQISSPPPPSSPPP 187 Query: 294 QS---PLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPA 464 QS P LPP PP PPP S PP+ +P R + PP Sbjct: 188 QSSPPPPSLPPQSSPPPPSTPPPQSSPPS-----------------QPSSRPPQNSPPPP 230 Query: 465 GPEP 476 P P Sbjct: 231 PPTP 234 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/87 (40%), Positives = 39/87 (44%), Gaps = 6/87 (6%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQS-----PL 305 P+S+PPP S S +S P + S P P PPPP PPPQS P Sbjct: 160 PSSTPPPQSSSPSPPQISSPPPPSSPPPQSSPPPPSLPPQSSPPPPSTPPPQSSPPSQPS 219 Query: 306 LLPPPRQKPPSHP-PPPHSPPPTRHRP 383 PP PP P PPP S PP R P Sbjct: 220 SRPPQNSPPPPPPTPPPASLPPPRRSP 246 [236][TOP] >UniRef100_A9TWI4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWI4_PHYPA Length = 818 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +3 Query: 267 PPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRP 383 PPPPP+PPP SP PPP PPS PPPP SPPP P Sbjct: 480 PPPPPSPPPPSPP--PPPSPPPPSPPPPPPSPPPPPPSP 516 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/82 (42%), Positives = 36/82 (43%), Gaps = 1/82 (1%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPPP 320 P S PPP P P P P P PPPPPP+PPP PPP Sbjct: 483 PPSPPPPSP---------PPP-------------PSPPPPSPPPPPPSPPP------PPP 514 Query: 321 RQKPPSHPPPPH-SPPPTRHRP 383 PPS PPPP SPPP RP Sbjct: 515 SPPPPSPPPPPSPSPPPPAPRP 536 [237][TOP] >UniRef100_Q8MQG9 Prion-like-(Q/n-rich)-domain-bearing protein protein 75, isoform c n=1 Tax=Caenorhabditis elegans RepID=Q8MQG9_CAEEL Length = 539 Score = 57.4 bits (137), Expect = 5e-07 Identities = 49/134 (36%), Positives = 55/134 (41%), Gaps = 12/134 (8%) Frame = +3 Query: 111 GGSSLPLRGCPTSSPPPYPSHFSSGALSP*PT-RAGAG*ASRRRWPCWSPSWPPPPPPAP 287 G P G P PPP S +G+ SP P AG+ R P P+ PPPPPA Sbjct: 248 GKRQAPPAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAG 307 Query: 288 PPQSPLLLPPPRQKPPSHPPPPHSPPPT----------RHRPCGT-CRRRT*RQRCRPLR 434 SP PPPR P PPPP PPT P GT RQ+ + Sbjct: 308 G--SP---PPPRAGSPPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPE 362 Query: 435 RSARGGGPPAGPEP 476 RS G PP G P Sbjct: 363 RSPPTGSPPTGSPP 376 [238][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P P+ PPPPPP PPP P PPP PP PPPP PPP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +3 Query: 264 PPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 PPP PPAPPP P PPP PP PPPP PPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 [239][TOP] >UniRef100_Q18265 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans RepID=Q18265_CAEEL Length = 448 Score = 57.4 bits (137), Expect = 5e-07 Identities = 43/112 (38%), Positives = 50/112 (44%), Gaps = 21/112 (18%) Frame = -3 Query: 388 PHGRCRVGG-----GECGGGGCDGGF*RGGGSRSGDCGG---------GAGGGGGGHDGD 251 P+G+ R GG G GGGG DGG GGSR G GG G GGG GG+DG+ Sbjct: 82 PYGQSRGGGRGGFGGSRGGGGYDGG---RGGSRGGYDGGRGGYGGDRGGRGGGRGGYDGE 138 Query: 250 QHGHRR-------RDAHPAPARVGHGDKAPLEKWEG*GGGEEVGHPRSGRDE 116 + G R R P R G+ D+ P GGG G SG E Sbjct: 139 RRGGSRWDDGNSDRQGGPPGGRGGYQDRGPRRDGPPSGGGYGGGGAASGNRE 190 [240][TOP] >UniRef100_O02123 Prion-like-(Q/n-rich)-domain-bearing protein protein 75, isoform a n=2 Tax=Caenorhabditis elegans RepID=O02123_CAEEL Length = 524 Score = 57.4 bits (137), Expect = 5e-07 Identities = 49/134 (36%), Positives = 55/134 (41%), Gaps = 12/134 (8%) Frame = +3 Query: 111 GGSSLPLRGCPTSSPPPYPSHFSSGALSP*PT-RAGAG*ASRRRWPCWSPSWPPPPPPAP 287 G P G P PPP S +G+ SP P AG+ R P P+ PPPPPA Sbjct: 233 GKRQAPPAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAG 292 Query: 288 PPQSPLLLPPPRQKPPSHPPPPHSPPPT----------RHRPCGT-CRRRT*RQRCRPLR 434 SP PPPR P PPPP PPT P GT RQ+ + Sbjct: 293 G--SP---PPPRAGSPPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPE 347 Query: 435 RSARGGGPPAGPEP 476 RS G PP G P Sbjct: 348 RSPPTGSPPTGSPP 361 [241][TOP] >UniRef100_B9QEP3 Chloride channel protein k, putative n=1 Tax=Toxoplasma gondii VEG RepID=B9QEP3_TOXGO Length = 1733 Score = 57.4 bits (137), Expect = 5e-07 Identities = 51/175 (29%), Positives = 61/175 (34%), Gaps = 14/175 (8%) Frame = +3 Query: 3 PASYLSHVPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPYPSHFSS 182 P S S P S +S S + P S+ P P SS PP PS S Sbjct: 180 PPSSSSSSPSSSPSSSSPPPSSSPPPSSPPSPSSAPSSSTSPSPSSPPSSSPPSPSSAPS 239 Query: 183 GALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQS--PLLLPPPRQKPPSHPPPPH 356 + SP P+ SP P PPP+ PP S P PP PPS PPP Sbjct: 240 SSTSPSPS---------------SPPSPSSPPPSSPPSSSPPSPSSPPSSSPPSPSPPPS 284 Query: 357 SPP------------PTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSS 485 SPP P+ P + + P S PP+ P SS Sbjct: 285 SPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPPPPSPPSSSPPSSSSPSSS 339 [242][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTC 395 P PPPPPP PPP P PPP PP PPPP PPP P C Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLC 49 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPP 368 P PPPPPP PPP P PPP PP PPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 [243][TOP] >UniRef100_A0D1C0 Chromosome undetermined scaffold_34, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D1C0_PARTE Length = 1131 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/82 (41%), Positives = 38/82 (46%), Gaps = 8/82 (9%) Frame = +3 Query: 255 PSWPPPPPPAPPPQSPLLLPPPRQKPP--------SHPPPPHSPPPTRHRPCGTCRRRT* 410 P PPPPPP PPP + +PPP PP S PPPP PPP P G +T Sbjct: 595 PPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPP---PGG----KTG 647 Query: 411 RQRCRPLRRSARGGGPPAGPEP 476 P A+ GGPP P P Sbjct: 648 APPPPPPPPGAKAGGPPPPPPP 669 [244][TOP] >UniRef100_C9K0J5 Putative uncharacterized protein RAPH1 n=1 Tax=Homo sapiens RepID=C9K0J5_HUMAN Length = 1302 Score = 57.4 bits (137), Expect = 5e-07 Identities = 55/180 (30%), Positives = 70/180 (38%), Gaps = 13/180 (7%) Frame = +3 Query: 3 PASYLSH------VPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPY 164 PASY+ VP P + CA+ PL S+ + PPP Sbjct: 872 PASYIPPSPPTPPVPVPPPTLPKQQSFCAKPPPSPLSPV-----PSVVKQIASQFPPPPT 926 Query: 165 PSHFSSGALSP*PTR-AGAG*ASRRRWPCWSPSWPPPPPP---APPPQSPLLLPPPRQKP 332 P S L P P A + + P W PS P P P PPP+S L+ PPP P Sbjct: 927 PPAMESQPLKPVPANVAPQSPPAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSP 986 Query: 333 PSHPPPPHSPPPTRH---RPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSSTRGCCG 503 PPPP PPPT G+ ++T + S G PP P+ SS + G Sbjct: 987 VPAPPPP--PPPTASPTPDKSGSPGKKTSK------TSSPGGKKPPPTPQRNSSIKSSSG 1038 [245][TOP] >UniRef100_C1GXM9 Cytokinesis protein sepA n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1GXM9_PARBA Length = 1734 Score = 57.4 bits (137), Expect = 5e-07 Identities = 41/126 (32%), Positives = 46/126 (36%), Gaps = 5/126 (3%) Frame = +3 Query: 141 PTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPP-----APPPQSPL 305 P S PPP P + G P P G G +P PPPPPP PPP + Sbjct: 976 PPSPPPPPPPPAAGGPPPPPPPPPGIG----------APPPPPPPPPGAGPPPPPPPPGV 1025 Query: 306 LLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSS 485 PPP PP PP PPP P GG PP P P ++ Sbjct: 1026 GSPPPPPPPPGMGGPPPPPPPPGAAP---------------------GGSPPPPPPPGAA 1064 Query: 486 TRGCCG 503 T G G Sbjct: 1065 TGGWRG 1070 [246][TOP] >UniRef100_A8N398 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8N398_COPC7 Length = 511 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/81 (41%), Positives = 39/81 (48%), Gaps = 5/81 (6%) Frame = +3 Query: 141 PTSSPPP-YPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPPPPAPPPQSPLLLPP 317 PT PPP +PS F +GA P P AG +P PPPPP P +P + PP Sbjct: 251 PTPPPPPGFPSSFPTGAPPPPPGMPVAG----------APGVPPPPPGMPVAGAPGIPPP 300 Query: 318 PRQKP----PSHPPPPHSPPP 368 P P P PPPP PPP Sbjct: 301 PPGMPFAGAPGVPPPPPGPPP 321 [247][TOP] >UniRef100_Q70E73 Ras-associated and pleckstrin homology domains-containing protein 1 n=1 Tax=Homo sapiens RepID=RAPH1_HUMAN Length = 1250 Score = 57.4 bits (137), Expect = 5e-07 Identities = 55/180 (30%), Positives = 70/180 (38%), Gaps = 13/180 (7%) Frame = +3 Query: 3 PASYLSH------VPCSPAVASWRAGSCARQTRCPLLKRRELGGSSLPLRGCPTSSPPPY 164 PASY+ VP P + CA+ PL S+ + PPP Sbjct: 820 PASYIPPSPPTPPVPVPPPTLPKQQSFCAKPPPSPLSPV-----PSVVKQIASQFPPPPT 874 Query: 165 PSHFSSGALSP*PTR-AGAG*ASRRRWPCWSPSWPPPPPP---APPPQSPLLLPPPRQKP 332 P S L P P A + + P W PS P P P PPP+S L+ PPP P Sbjct: 875 PPAMESQPLKPVPANVAPQSPPAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSP 934 Query: 333 PSHPPPPHSPPPTRH---RPCGTCRRRT*RQRCRPLRRSARGGGPPAGPEPLSSTRGCCG 503 PPPP PPPT G+ ++T + S G PP P+ SS + G Sbjct: 935 VPAPPPP--PPPTASPTPDKSGSPGKKTSK------TSSPGGKKPPPTPQRNSSIKSSSG 986 [248][TOP] >UniRef100_C9SXK4 Predicted protein n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9SXK4_9PEZI Length = 1096 Score = 48.9 bits (115), Expect(2) = 6e-07 Identities = 22/38 (57%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +3 Query: 264 PPPPPPAP---PPQSPLLLPPPRQKPPSHPPPPHSPPP 368 PPPPPPAP PP P PP PP PPPP PPP Sbjct: 963 PPPPPPAPWVQPPGPPPGQPPAYYNPPPPPPPPPPPPP 1000 Score = 28.1 bits (61), Expect(2) = 6e-07 Identities = 18/57 (31%), Positives = 21/57 (36%) Frame = +1 Query: 1 PQRPTSPTYLVHLLWPRGGQAAAPGRRAVPC*RGVNLVAHPCRYAGVPPPPPLPTLP 171 P+ P +P WP G P R+ P P R PPPPP P P Sbjct: 930 PREPPNP-------WPPAGLPPGPPLRSPP---------PPGRGQPAPPPPPPPPAP 970 [249][TOP] >UniRef100_Q7XME8 OSJNBa0061G20.11 protein n=2 Tax=Oryza sativa RepID=Q7XME8_ORYSJ Length = 540 Score = 55.5 bits (132), Expect(2) = 6e-07 Identities = 27/48 (56%), Positives = 29/48 (60%) Frame = +3 Query: 237 RWPCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHR 380 R P SP PPPPPPAP P +P PPP PP PP P +PP TR R Sbjct: 166 RPPAPSPPAPPPPPPAPSPPAPPAPPPP---PPPPPPCPPAPPKTRSR 210 Score = 21.6 bits (44), Expect(2) = 6e-07 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 Query: 145 PPPPLPTLPTSPAVPCR 195 P PP P P+ P P R Sbjct: 150 PAPPSPPAPSPPVPPPR 166 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/66 (43%), Positives = 35/66 (53%) Frame = +3 Query: 243 PCWSPSWPPPPPPAPPPQSPLLLPPPRQKPPSHPPPPHSPPPTRHRPCGTCRRRT*RQRC 422 P SP PPP PPAP P +P PPP PP+ P PP PPP PC +T ++ Sbjct: 156 PAPSPPVPPPRPPAPSPPAP-PPPPPAPSPPAPPAPPPPPPPP--PPCPPAPPKTRSRQA 212 Query: 423 RPLRRS 440 PL R+ Sbjct: 213 PPLART 218 [250][TOP] >UniRef100_Q7ZYY2 Wiskott-Aldrich syndrome, like n=1 Tax=Danio rerio RepID=Q7ZYY2_DANRE Length = 518 Score = 54.7 bits (130), Expect(2) = 6e-07 Identities = 37/91 (40%), Positives = 42/91 (46%), Gaps = 10/91 (10%) Frame = +3 Query: 132 RGCPTSSPPPYPSHFSSGALSP*P-TRAGAG*ASRRRWPCWSPSWPPPPPPAP------P 290 RG P PPP PS + A P P +R G G P P+ PPPPP P P Sbjct: 320 RGAP---PPPPPSRAPTSAPPPPPPSRPGMGAPPPPPPPSRGPTQAPPPPPPPHSASISP 376 Query: 291 PQSPLL--LPPPRQKPPSHP-PPPHSPPPTR 374 P P + PPP PP P PPP PPP + Sbjct: 377 PAPPSIGGAPPPPPPPPPPPGPPPPGPPPAQ 407 Score = 22.3 bits (46), Expect(2) = 6e-07 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 100 GVNLVAHPCRYAGVPPPPP 156 GV V + R PPPPP Sbjct: 277 GVEAVKNEMRRQAPPPPPP 295 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/86 (39%), Positives = 38/86 (44%), Gaps = 6/86 (6%) Frame = +3 Query: 126 PLRGCPTSSPPPYPSHFSSGALSP*PTRAGAG*ASRRRWPCWSPSWPPPP------PPAP 287 P R ++ PPP PS GA P P + R P +P PPPP PPAP Sbjct: 328 PSRAPTSAPPPPPPSRPGMGAPPPPPPPS--------RGPTQAPPPPPPPHSASISPPAP 379 Query: 288 PPQSPLLLPPPRQKPPSHPPPPHSPP 365 P PPP PP PPPP PP Sbjct: 380 PSIGGAPPPPPPPPPPPGPPPPGPPP 405