[UP]
[1][TOP] >UniRef100_B6V3I3 Ubiquitin carrier protein n=1 Tax=Porphyra yezoensis RepID=B6V3I3_PORYE Length = 147 Score = 75.1 bits (183), Expect = 3e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 40 [2][TOP] >UniRef100_Q8H728 Ubiquitin carrier protein n=1 Tax=Phytophthora infestans RepID=Q8H728_PHYIN Length = 147 Score = 72.4 bits (176), Expect = 2e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+NCSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPANCSAGPVGDDLFHWQATIMGP 40 [3][TOP] >UniRef100_Q7XYB1 Ubiquitin carrier protein n=1 Tax=Griffithsia japonica RepID=Q7XYB1_GRIJA Length = 147 Score = 71.6 bits (174), Expect = 3e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLG+DPPSNCSAGPA DDLFHWQATIMGP Sbjct: 8 KELQDLGKDPPSNCSAGPASDDLFHWQATIMGP 40 [4][TOP] >UniRef100_UPI00003C048F PREDICTED: similar to Ubiquitin-conjugating enzyme E2-17 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein effete) n=1 Tax=Apis mellifera RepID=UPI00003C048F Length = 147 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [5][TOP] >UniRef100_Q6XID3 Ubiquitin carrier protein (Fragment) n=1 Tax=Drosophila yakuba RepID=Q6XID3_DROYA Length = 113 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [6][TOP] >UniRef100_Q2HQ73 Ubiquitin carrier protein n=1 Tax=Oesophagostomum dentatum RepID=Q2HQ73_9BILA Length = 147 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [7][TOP] >UniRef100_Q2HQ72 Ubiquitin carrier protein n=1 Tax=Oesophagostomum dentatum RepID=Q2HQ72_9BILA Length = 147 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [8][TOP] >UniRef100_Q2HQ71 Ubiquitin carrier protein n=1 Tax=Oesophagostomum dentatum RepID=Q2HQ71_9BILA Length = 147 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [9][TOP] >UniRef100_Q006M8 Ubiquitin carrier protein n=1 Tax=Litopenaeus vannamei RepID=Q006M8_LITVA Length = 147 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [10][TOP] >UniRef100_O17424 Ubiquitin carrier protein (Fragment) n=1 Tax=Drosophila silvestris RepID=O17424_DROSL Length = 103 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [11][TOP] >UniRef100_C9W1Q6 Ubiquitin-conjugating enzyme n=1 Tax=Rhipicephalus sanguineus RepID=C9W1Q6_RHISA Length = 148 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [12][TOP] >UniRef100_C3ZGJ2 Ubiquitin carrier protein n=1 Tax=Branchiostoma floridae RepID=C3ZGJ2_BRAFL Length = 147 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [13][TOP] >UniRef100_C3YP43 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3YP43_BRAFL Length = 121 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [14][TOP] >UniRef100_A8NWS2 Ubiquitin carrier protein n=1 Tax=Brugia malayi RepID=A8NWS2_BRUMA Length = 147 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [15][TOP] >UniRef100_A7RXR8 Ubiquitin carrier protein n=1 Tax=Nematostella vectensis RepID=A7RXR8_NEMVE Length = 147 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [16][TOP] >UniRef100_P25867 Ubiquitin-conjugating enzyme E2-17 kDa n=16 Tax=Neoptera RepID=UBCD1_DROME Length = 147 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [17][TOP] >UniRef100_P35129 Ubiquitin-conjugating enzyme E2 2 n=4 Tax=Chromadorea RepID=UBC2_CAEEL Length = 147 Score = 70.1 bits (170), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [18][TOP] >UniRef100_C5PIK5 Ubiquitin carrier protein n=2 Tax=Coccidioides RepID=C5PIK5_COCP7 Length = 147 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELSDLGRDPPSSCSAGPVGDDLFHWQATIMGP 40 [19][TOP] >UniRef100_C5JVG3 Ubiquitin carrier protein n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JVG3_AJEDS Length = 147 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELSDLGRDPPSSCSAGPVGDDLFHWQATIMGP 40 [20][TOP] >UniRef100_C5GPA9 Ubiquitin carrier protein n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GPA9_AJEDR Length = 137 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELSDLGRDPPSSCSAGPVGDDLFHWQATIMGP 40 [21][TOP] >UniRef100_A6QV53 Ubiquitin carrier protein n=3 Tax=Ajellomyces capsulatus RepID=A6QV53_AJECN Length = 147 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELSDLGRDPPSSCSAGPVGDDLFHWQATIMGP 40 [22][TOP] >UniRef100_B3S643 Ubiquitin carrier protein n=1 Tax=Trichoplax adhaerens RepID=B3S643_TRIAD Length = 147 Score = 69.3 bits (168), Expect = 2e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLGRDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELQDLGRDPPAQCSAGPVGDDMFHWQATIMGP 40 [23][TOP] >UniRef100_Q5B9M0 Ubiquitin carrier protein n=2 Tax=Emericella nidulans RepID=Q5B9M0_EMENI Length = 147 Score = 69.3 bits (168), Expect = 2e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGPAG+DLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPAGEDLFHWQATIMGP 40 [24][TOP] >UniRef100_B6HEM5 Ubiquitin carrier protein n=1 Tax=Penicillium chrysogenum Wisconsin 54-1255 RepID=B6HEM5_PENCW Length = 147 Score = 69.3 bits (168), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPVGDDLFHWQATIMGP 40 [25][TOP] >UniRef100_A1D8A7 Ubiquitin carrier protein n=3 Tax=Trichocomaceae RepID=A1D8A7_NEOFI Length = 147 Score = 69.3 bits (168), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPVGDDLFHWQATIMGP 40 [26][TOP] >UniRef100_A1CJ72 Ubiquitin carrier protein n=1 Tax=Aspergillus clavatus RepID=A1CJ72_ASPCL Length = 147 Score = 69.3 bits (168), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPTGDDLFHWQATIMGP 40 [27][TOP] >UniRef100_B7G7K7 Ubiquitin carrier protein n=1 Tax=Phaeodactylum tricornutum CCAP 1055/1 RepID=B7G7K7_PHATR Length = 147 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLG+DPPSNCSAGP GDD+FHWQATIMGP Sbjct: 8 KELVDLGKDPPSNCSAGPVGDDMFHWQATIMGP 40 [28][TOP] >UniRef100_C5LT04 Ubiquitin carrier protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5LT04_9ALVE Length = 147 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDL RDPP+NCSAGP GDD+FHWQATIMGP Sbjct: 8 KELQDLSRDPPANCSAGPIGDDMFHWQATIMGP 40 [29][TOP] >UniRef100_C5L2W5 Ubiquitin carrier protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5L2W5_9ALVE Length = 147 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDL RDPP+NCSAGP GDD+FHWQATIMGP Sbjct: 8 KELQDLSRDPPANCSAGPIGDDMFHWQATIMGP 40 [30][TOP] >UniRef100_Q0UZR5 Ubiquitin carrier protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0UZR5_PHANO Length = 147 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPIGDDLFHWQATIMGP 40 [31][TOP] >UniRef100_Q0CBR7 Ubiquitin carrier protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CBR7_ASPTN Length = 147 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPQGDDLFHWQATIMGP 40 [32][TOP] >UniRef100_C5FZT0 Ubiquitin carrier protein n=1 Tax=Microsporum canis CBS 113480 RepID=C5FZT0_NANOT Length = 148 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPIGDDLFHWQATIMGP 40 [33][TOP] >UniRef100_B8MNG0 Ubiquitin carrier protein n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8MNG0_TALSN Length = 114 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPIGDDLFHWQATIMGP 40 [34][TOP] >UniRef100_B6QT39 Ubiquitin carrier protein n=2 Tax=Trichocomaceae RepID=B6QT39_PENMQ Length = 147 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPIGDDLFHWQATIMGP 40 [35][TOP] >UniRef100_B2VTT5 Ubiquitin carrier protein n=1 Tax=Pyrenophora tritici-repentis Pt-1C-BFP RepID=B2VTT5_PYRTR Length = 147 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPIGDDLFHWQATIMGP 40 [36][TOP] >UniRef100_A7F0Q4 Ubiquitin carrier protein n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7F0Q4_SCLS1 Length = 147 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPIGDDLFHWQATIMGP 40 [37][TOP] >UniRef100_Q2U549 Ubiquitin carrier protein n=1 Tax=Aspergillus oryzae RepID=Q2U549_ASPOR Length = 147 Score = 68.2 bits (165), Expect = 4e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP G+DLFHWQATIMGP Sbjct: 8 KELSDLGRDPPSSCSAGPVGEDLFHWQATIMGP 40 [38][TOP] >UniRef100_B6K767 Ubiquitin carrier protein n=1 Tax=Schizosaccharomyces japonicus yFS275 RepID=B6K767_SCHJY Length = 147 Score = 68.2 bits (165), Expect = 4e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 422 ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 EL DLG+DPPS+CSAGP GDDLFHWQATIMGP Sbjct: 9 ELMDLGKDPPSSCSAGPVGDDLFHWQATIMGP 40 [39][TOP] >UniRef100_Q6PBX6 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=Q6PBX6_DANRE Length = 147 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [40][TOP] >UniRef100_B8C0C0 Ubiquitin carrier protein n=1 Tax=Thalassiosira pseudonana CCMP1335 RepID=B8C0C0_THAPS Length = 147 Score = 67.8 bits (164), Expect = 5e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLG+DPP+NCSAGP GDD+FHWQATIMGP Sbjct: 8 KELVDLGKDPPANCSAGPVGDDMFHWQATIMGP 40 [41][TOP] >UniRef100_A9NV04 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=A9NV04_PICSI Length = 148 Score = 67.8 bits (164), Expect = 5e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGPV 520 +ELQDL RDPP +CSAGP GDDLFHWQATIMGPV Sbjct: 8 KELQDLQRDPPISCSAGPVGDDLFHWQATIMGPV 41 [42][TOP] >UniRef100_A8JBJ3 Ubiquitin carrier protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JBJ3_CHLRE Length = 148 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDL +DPP++CSAGPAGDDLFHWQATIMGP Sbjct: 8 KELQDLQKDPPTSCSAGPAGDDLFHWQATIMGP 40 [43][TOP] >UniRef100_Q2PEN9 Ubiquitin carrier protein n=1 Tax=Epichloe festucae RepID=Q2PEN9_9HYPO Length = 147 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP G+DLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPVGEDLFHWQATIMGP 40 [44][TOP] >UniRef100_C7Z111 Predicted protein n=1 Tax=Nectria haematococca mpVI 77-13-4 RepID=C7Z111_NECH7 Length = 147 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP G+DLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPVGEDLFHWQATIMGP 40 [45][TOP] >UniRef100_B2AL09 Ubiquitin carrier protein n=1 Tax=Podospora anserina RepID=B2AL09_PODAN Length = 147 Score = 67.8 bits (164), Expect = 5e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGPAGDDLF WQATIMGP Sbjct: 8 KELADLGRDPPSSCSAGPAGDDLFQWQATIMGP 40 [46][TOP] >UniRef100_P46595 Ubiquitin-conjugating enzyme E2 4 n=1 Tax=Schizosaccharomyces pombe RepID=UBC4_SCHPO Length = 147 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 422 ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 EL DLG+DPPS+CSAGP GDDLFHWQATIMGP Sbjct: 9 ELADLGKDPPSSCSAGPVGDDLFHWQATIMGP 40 [47][TOP] >UniRef100_Q9UVR2 Ubiquitin-conjugating enzyme E2-16 kDa n=1 Tax=Magnaporthe grisea RepID=UBC1_MAGGR Length = 147 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP G+DLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPVGEDLFHWQATIMGP 40 [48][TOP] >UniRef100_O74196 Ubiquitin-conjugating enzyme E2-16 kDa n=1 Tax=Colletotrichum gloeosporioides RepID=UBC1_COLGL Length = 147 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP G+DLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPVGEDLFHWQATIMGP 40 [49][TOP] >UniRef100_Q8JHF3 Ubiquitin conjugating enzyme E2D (Fragment) n=1 Tax=Danio rerio RepID=Q8JHF3_DANRE Length = 81 Score = 67.4 bits (163), Expect = 7e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELHDLGRDPPAQCSAGPVGDDMFHWQATIMGP 40 [50][TOP] >UniRef100_Q7ZUK1 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=Q7ZUK1_DANRE Length = 147 Score = 67.4 bits (163), Expect = 7e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELHDLGRDPPAQCSAGPVGDDMFHWQATIMGP 40 [51][TOP] >UniRef100_B9EMG0 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B9EMG0_SALSA Length = 147 Score = 67.4 bits (163), Expect = 7e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLGRDPPAQCSAGPVGDDMFHWQATIMGP 40 [52][TOP] >UniRef100_Q5CQI6 Ubiquitin carrier protein (Fragment) n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CQI6_CRYPV Length = 161 Score = 67.4 bits (163), Expect = 7e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+NCSAGP GDD+FHWQATIMGP Sbjct: 22 QELSDLNRDPPTNCSAGPIGDDMFHWQATIMGP 54 [53][TOP] >UniRef100_C1BV12 Ubiquitin carrier protein n=1 Tax=Lepeophtheirus salmonis RepID=C1BV12_9MAXI Length = 152 Score = 67.4 bits (163), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELVDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [54][TOP] >UniRef100_C1BUK9 Ubiquitin-conjugating enzyme E2-17 kDa n=1 Tax=Lepeophtheirus salmonis RepID=C1BUK9_9MAXI Length = 152 Score = 67.4 bits (163), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELVDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [55][TOP] >UniRef100_C1BTS5 Ubiquitin-conjugating enzyme E2-17 kDa n=1 Tax=Lepeophtheirus salmonis RepID=C1BTS5_9MAXI Length = 147 Score = 67.4 bits (163), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELVDLGRDPPTQCSAGPVGDDLFHWQATIMGP 40 [56][TOP] >UniRef100_C1BT96 Ubiquitin carrier protein n=1 Tax=Lepeophtheirus salmonis RepID=C1BT96_9MAXI Length = 147 Score = 67.4 bits (163), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELVDLGRDPPAQCSAGPVGDDLFHWQATIMGP 40 [57][TOP] >UniRef100_Q7RVS7 Ubiquitin carrier protein n=1 Tax=Neurospora crassa RepID=Q7RVS7_NEUCR Length = 147 Score = 67.4 bits (163), Expect = 7e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP G+DLFHWQATIMGP Sbjct: 8 KELADLGRDPPSSCSAGPQGEDLFHWQATIMGP 40 [58][TOP] >UniRef100_Q6FV50 Ubiquitin carrier protein n=1 Tax=Candida glabrata RepID=Q6FV50_CANGA Length = 147 Score = 67.4 bits (163), Expect = 7e-10 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 A+EL DLGRDPP++CSAGP GDDL+HWQA+IMGP Sbjct: 7 AKELSDLGRDPPTSCSAGPVGDDLYHWQASIMGP 40 [59][TOP] >UniRef100_Q6C907 Ubiquitin carrier protein n=1 Tax=Yarrowia lipolytica RepID=Q6C907_YARLI Length = 147 Score = 67.4 bits (163), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP G DLFHWQATIMGP Sbjct: 8 KELSDLGRDPPSSCSAGPVGQDLFHWQATIMGP 40 [60][TOP] >UniRef100_C0SDD0 Ubiquitin carrier protein n=1 Tax=Paracoccidioides brasiliensis Pb03 RepID=C0SDD0_PARBP Length = 147 Score = 67.4 bits (163), Expect = 7e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP G+DLFHWQATIMGP Sbjct: 8 KELLDLGRDPPSSCSAGPVGEDLFHWQATIMGP 40 [61][TOP] >UniRef100_B3LGL0 Ubiquitin carrier protein n=2 Tax=Saccharomyces cerevisiae RepID=B3LGL0_YEAS1 Length = 148 Score = 67.4 bits (163), Expect = 7e-10 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 A+EL DLGRDPP++CSAGP GDDL+HWQA+IMGP Sbjct: 8 AKELSDLGRDPPASCSAGPVGDDLYHWQASIMGP 41 [62][TOP] >UniRef100_A6SPN3 Ubiquitin carrier protein n=1 Tax=Botryotinia fuckeliana B05.10 RepID=A6SPN3_BOTFB Length = 147 Score = 67.4 bits (163), Expect = 7e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP G+DLFHWQATIMGP Sbjct: 8 KELTDLGRDPPSSCSAGPIGEDLFHWQATIMGP 40 [63][TOP] >UniRef100_P15732 Ubiquitin-conjugating enzyme E2-16 kDa n=2 Tax=Saccharomyces cerevisiae RepID=UBC5_YEAST Length = 148 Score = 67.4 bits (163), Expect = 7e-10 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 A+EL DLGRDPP++CSAGP GDDL+HWQA+IMGP Sbjct: 8 AKELSDLGRDPPASCSAGPVGDDLYHWQASIMGP 41 [64][TOP] >UniRef100_UPI00016E0EAC UPI00016E0EAC related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E0EAC Length = 148 Score = 67.0 bits (162), Expect = 9e-10 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPPS CSAGP GDDLFHWQATIMGP Sbjct: 8 KELSDLSRDPPSQCSAGPVGDDLFHWQATIMGP 40 [65][TOP] >UniRef100_Q6PC58 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=Q6PC58_DANRE Length = 147 Score = 67.0 bits (162), Expect = 9e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELQDLQRDPPAQCSAGPVGDDLFHWQATIMGP 40 [66][TOP] >UniRef100_C3KH85 Ubiquitin carrier protein n=1 Tax=Anoplopoma fimbria RepID=C3KH85_9PERC Length = 147 Score = 67.0 bits (162), Expect = 9e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDLG+DPP++CSAGP GDDLFHWQATI GP Sbjct: 8 KELQDLGKDPPASCSAGPVGDDLFHWQATITGP 40 [67][TOP] >UniRef100_C4YN21 Ubiquitin carrier protein n=2 Tax=Candida RepID=C4YN21_CANAL Length = 147 Score = 67.0 bits (162), Expect = 9e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDL+HWQA+IMGP Sbjct: 8 KELSDLGRDPPSSCSAGPVGDDLYHWQASIMGP 40 [68][TOP] >UniRef100_P43102 Ubiquitin-conjugating enzyme E2 4 n=1 Tax=Candida albicans RepID=UBC4_CANAL Length = 147 Score = 67.0 bits (162), Expect = 9e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDL+HWQA+IMGP Sbjct: 8 KELSDLGRDPPSSCSAGPVGDDLYHWQASIMGP 40 [69][TOP] >UniRef100_UPI0000F2D5B5 PREDICTED: similar to Ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) n=1 Tax=Monodelphis domestica RepID=UPI0000F2D5B5 Length = 147 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 EEL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 EELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [70][TOP] >UniRef100_UPI0000E80EBA PREDICTED: similar to Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex n=1 Tax=Gallus gallus RepID=UPI0000E80EBA Length = 265 Score = 66.6 bits (161), Expect = 1e-09 Identities = 49/133 (36%), Positives = 56/133 (42%), Gaps = 7/133 (5%) Frame = +2 Query: 140 TPRGAAWCHPSDPHARKLYCCTLCCACGFSRFSALRWWR----HPRTP---PVTATMRRG 298 TP A HPS P ACG R++ + HPRTP P+TA R G Sbjct: 64 TPGRRAARHPSAP------------ACGPVRWAGPGTVQIGAEHPRTPAEPPLTAATRPG 111 Query: 299 SACGCTLEVAWPSHLRTSLFTHGLRHVVCCFFLNSVCGGAEELQDLGRDPPSNCSAGPAG 478 T + S EEL DL RDPP+ CSA P G Sbjct: 112 LLPAATTRETFASR--------------------------EELNDLARDPPAQCSAPPVG 145 Query: 479 DDLFHWQATIMGP 517 DD+FHWQATIMGP Sbjct: 146 DDMFHWQATIMGP 158 [71][TOP] >UniRef100_UPI00005A0156 PREDICTED: similar to Ubiquitin-conjugating enzyme E2 D2 (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) isoform 2 n=1 Tax=Canis lupus familiaris RepID=UPI00005A0156 Length = 57 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGPV 520 +EL DL RDPP+ CSAGP GDD+FHWQATIMGPV Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGPV 41 [72][TOP] >UniRef100_UPI0001B7BC95 UPI0001B7BC95 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7BC95 Length = 51 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGPV 520 +EL DL RDPP+ CSAGP GDD+FHWQATIMGPV Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGPV 41 [73][TOP] >UniRef100_Q4SDP1 Ubiquitin carrier protein (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SDP1_TETNG Length = 148 Score = 66.6 bits (161), Expect = 1e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPPS CSAGP GDDLFHWQATIMGP Sbjct: 8 KELADLSRDPPSQCSAGPVGDDLFHWQATIMGP 40 [74][TOP] >UniRef100_Q6BJ01 Ubiquitin carrier protein n=1 Tax=Debaryomyces hansenii RepID=Q6BJ01_DEBHA Length = 147 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDL+HWQA+IMGP Sbjct: 8 KELADLGRDPPSSCSAGPVGDDLYHWQASIMGP 40 [75][TOP] >UniRef100_A3GGX4 Ubiquitin carrier protein n=1 Tax=Pichia stipitis RepID=A3GGX4_PICST Length = 147 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDL+HWQA+IMGP Sbjct: 8 KELADLGRDPPSSCSAGPVGDDLYHWQASIMGP 40 [76][TOP] >UniRef100_UPI00005B3DAB ubiquitin-conjugating enzyme E2 n=1 Tax=Toxoplasma gondii RepID=UPI00005B3DAB Length = 166 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP+NCSAGP GDD+FHWQATIMGP Sbjct: 28 KELNDLSKDPPTNCSAGPVGDDMFHWQATIMGP 60 [77][TOP] >UniRef100_Q7SXH5 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=Q7SXH5_DANRE Length = 147 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDL RDPPS CSAGP G+DLFHWQATIMGP Sbjct: 8 KELQDLQRDPPSQCSAGPLGEDLFHWQATIMGP 40 [78][TOP] >UniRef100_Q9ZTZ8 Ubiquitin carrier protein n=1 Tax=Pinus resinosa RepID=Q9ZTZ8_PINRE Length = 148 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGPV 520 +ELQDL RDPP +CS GP GDDLFHWQATIMGPV Sbjct: 8 KELQDLQRDPPISCSTGPVGDDLFHWQATIMGPV 41 [79][TOP] >UniRef100_C5L2W4 Ubiquitin carrier protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5L2W4_9ALVE Length = 147 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL++L RDPP+NCSAGP GDD+FHWQATIMGP Sbjct: 8 KELEELSRDPPANCSAGPIGDDMFHWQATIMGP 40 [80][TOP] >UniRef100_C5KRQ1 Ubiquitin carrier protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KRQ1_9ALVE Length = 147 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL++L RDPP+NCSAGP GDD+FHWQATIMGP Sbjct: 8 KELEELSRDPPANCSAGPIGDDMFHWQATIMGP 40 [81][TOP] >UniRef100_B6KPI2 Ubiquitin carrier protein n=3 Tax=Toxoplasma gondii RepID=B6KPI2_TOXGO Length = 345 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP+NCSAGP GDD+FHWQATIMGP Sbjct: 206 KELNDLSKDPPTNCSAGPVGDDMFHWQATIMGP 238 [82][TOP] >UniRef100_Q2GQZ7 Ubiquitin carrier protein n=1 Tax=Chaetomium globosum RepID=Q2GQZ7_CHAGB Length = 147 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GDDLF WQATIMGP Sbjct: 8 KELADLGRDPPSSCSAGPTGDDLFQWQATIMGP 40 [83][TOP] >UniRef100_UPI000179EC14 UPI000179EC14 related cluster n=1 Tax=Bos taurus RepID=UPI000179EC14 Length = 146 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 ++EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 6 SQELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 39 [84][TOP] >UniRef100_UPI000179CF13 Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19) (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1). n=1 Tax=Bos taurus RepID=UPI000179CF13 Length = 146 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 ++EL DL RDPP++CSAGP GDDLFHWQATIMGP Sbjct: 6 SKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGP 39 [85][TOP] >UniRef100_A9NLA0 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=A9NLA0_PICSI Length = 148 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDL RDPP++CSAGP G+DLFHWQATIMGP Sbjct: 8 KELQDLQRDPPTSCSAGPVGEDLFHWQATIMGP 40 [86][TOP] >UniRef100_B6AEH9 Ubiquitin carrier protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6AEH9_9CRYT Length = 147 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+NCSAGP GDD+FHWQATI+GP Sbjct: 8 KELSDLNRDPPTNCSAGPVGDDMFHWQATIIGP 40 [87][TOP] >UniRef100_C5DIQ2 Ubiquitin carrier protein n=2 Tax=Saccharomycetaceae RepID=C5DIQ2_LACTC Length = 147 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP++CSAGP GDDL+HWQA+IMGP Sbjct: 8 KELNDLGRDPPTSCSAGPVGDDLYHWQASIMGP 40 [88][TOP] >UniRef100_A5DHX8 Ubiquitin carrier protein n=1 Tax=Pichia guilliermondii RepID=A5DHX8_PICGU Length = 147 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 ++EL DLGRDPPS+CSAGP GDD++HWQA+IMGP Sbjct: 7 SKELADLGRDPPSSCSAGPVGDDVYHWQASIMGP 40 [89][TOP] >UniRef100_UPI000194D200 PREDICTED: ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) n=1 Tax=Taeniopygia guttata RepID=UPI000194D200 Length = 174 Score = 65.5 bits (158), Expect = 2e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 35 QELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 67 [90][TOP] >UniRef100_UPI0000DA4445 PREDICTED: similar to ubiquitin-conjugating enzyme E2D 1, UBC4/5 homolog n=1 Tax=Rattus norvegicus RepID=UPI0000DA4445 Length = 384 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP++CSAGP GDDLFHWQATIMGP Sbjct: 245 KELSDLQRDPPAHCSAGPVGDDLFHWQATIMGP 277 [91][TOP] >UniRef100_UPI00004CAA98 PREDICTED: ubiquitin-conjugating enzyme E2D 1 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI00004CAA98 Length = 133 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP++CSAGP GDDLFHWQATIMGP Sbjct: 8 KELSDLQRDPPAHCSAGPVGDDLFHWQATIMGP 40 [92][TOP] >UniRef100_UPI0000D60F6C Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19) (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (UbcH5) (Ubiquitin- conjugating enzyme E2-17 kDa 1) (E2(17)KB 1). n=1 Tax=Homo sapiens RepID=UPI0000D60F6C Length = 146 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP++CSAGP GDDLFHWQATIMGP Sbjct: 7 KELSDLQRDPPAHCSAGPVGDDLFHWQATIMGP 39 [93][TOP] >UniRef100_Q4SZV0 Ubiquitin carrier protein (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SZV0_TETNG Length = 98 Score = 65.5 bits (158), Expect = 2e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 1 QELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 33 [94][TOP] >UniRef100_Q05CK8 Ube2d3 protein n=1 Tax=Mus musculus RepID=Q05CK8_MOUSE Length = 50 Score = 65.5 bits (158), Expect = 2e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGPV 520 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP+ Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGPL 41 [95][TOP] >UniRef100_Q8VWV2 Ubiquitin carrier protein (Fragment) n=1 Tax=Pinus pinaster RepID=Q8VWV2_PINPS Length = 140 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 422 ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 ELQDL RDPP++CSAGP G+DLFHWQATIMGP Sbjct: 1 ELQDLQRDPPTSCSAGPVGEDLFHWQATIMGP 32 [96][TOP] >UniRef100_P61077-3 Isoform 3 of Ubiquitin-conjugating enzyme E2 D3 n=1 Tax=Homo sapiens RepID=P61077-3 Length = 149 Score = 65.5 bits (158), Expect = 2e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 ++EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 9 SKELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 42 [97][TOP] >UniRef100_P51668 Ubiquitin-conjugating enzyme E2 D1 n=6 Tax=Eutheria RepID=UB2D1_HUMAN Length = 147 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP++CSAGP GDDLFHWQATIMGP Sbjct: 8 KELSDLQRDPPAHCSAGPVGDDLFHWQATIMGP 40 [98][TOP] >UniRef100_UPI0000F2B9B3 PREDICTED: similar to ubiquitin-conjugating enzyme HBUCE1 n=1 Tax=Monodelphis domestica RepID=UPI0000F2B9B3 Length = 164 Score = 65.1 bits (157), Expect = 3e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 25 QELTDLQRDPPAQCSAGPVGDDLFHWQATIMGP 57 [99][TOP] >UniRef100_UPI0000F2B380 PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b n=1 Tax=Monodelphis domestica RepID=UPI0000F2B380 Length = 270 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 131 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 163 [100][TOP] >UniRef100_UPI0000EBF33A PREDICTED: similar to ubiquitin-conjugating enzyme E2D 3 n=1 Tax=Bos taurus RepID=UPI0000EBF33A Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [101][TOP] >UniRef100_UPI0000EBEFFA PREDICTED: similar to ubiquitin-conjugating enzyme E2D 3 n=1 Tax=Bos taurus RepID=UPI0000EBEFFA Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [102][TOP] >UniRef100_UPI0000E20AF5 PREDICTED: similar to ubiquitin conjugating enzyme isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E20AF5 Length = 133 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [103][TOP] >UniRef100_UPI0000D8F387 PREDICTED: similar to ubiquitin conjugating enzyme n=1 Tax=Monodelphis domestica RepID=UPI0000D8F387 Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [104][TOP] >UniRef100_UPI00005A54BA PREDICTED: similar to ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) isoform 11 n=2 Tax=Canis lupus familiaris RepID=UPI00005A54BA Length = 99 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [105][TOP] >UniRef100_UPI000036D1AC PREDICTED: similar to ubiquitin conjugating enzyme isoform 2 n=1 Tax=Pan troglodytes RepID=UPI000036D1AC Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [106][TOP] >UniRef100_UPI000020B26D PREDICTED: hypothetical protein isoform 1 n=1 Tax=Pan troglodytes RepID=UPI000020B26D Length = 69 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [107][TOP] >UniRef100_UPI00001947F2 PREDICTED: similar to UBE2D3 n=1 Tax=Mus musculus RepID=UPI00001947F2 Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [108][TOP] >UniRef100_UPI0001B7BC97 UPI0001B7BC97 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7BC97 Length = 144 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 4 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 36 [109][TOP] >UniRef100_UPI0001B7BC96 UPI0001B7BC96 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7BC96 Length = 146 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 7 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 39 [110][TOP] >UniRef100_UPI0000180BB2 Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19) (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) (Phosphoarginine phosphatase) (PAPase). n=1 Tax=Rattus norvegicus RepID=UPI0000180BB2 Length = 150 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [111][TOP] >UniRef100_UPI00016E8B91 UPI00016E8B91 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E8B91 Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELSDLQRDPPAQCSAGPVGDDLFHWQATIMGP 40 [112][TOP] >UniRef100_UPI00016E8B90 UPI00016E8B90 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E8B90 Length = 151 Score = 65.1 bits (157), Expect = 3e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELSDLQRDPPAQCSAGPVGDDLFHWQATIMGP 40 [113][TOP] >UniRef100_UPI0000363DAB UPI0000363DAB related cluster n=1 Tax=Tetraodon nigroviridis RepID=UPI0000363DAB Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [114][TOP] >UniRef100_UPI000179E95F Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2). n=1 Tax=Bos taurus RepID=UPI000179E95F Length = 146 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 7 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 39 [115][TOP] >UniRef100_UPI0000F34946 Similar to phosphoarginine phosphatase n=1 Tax=Bos taurus RepID=UPI0000F34946 Length = 118 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [116][TOP] >UniRef100_Q1M197 Ubiquitin carrier protein n=1 Tax=Oncorhynchus mykiss RepID=Q1M197_ONCMY Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [117][TOP] >UniRef100_C1K734 Ubiquitin carrier protein n=1 Tax=Larimichthys crocea RepID=C1K734_LARCR Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELSDLQRDPPAQCSAGPVGDDLFHWQATIMGP 40 [118][TOP] >UniRef100_C1BX26 Ubiquitin carrier protein n=1 Tax=Esox lucius RepID=C1BX26_ESOLU Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [119][TOP] >UniRef100_C1BJE8 Ubiquitin carrier protein n=1 Tax=Osmerus mordax RepID=C1BJE8_OSMMO Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [120][TOP] >UniRef100_B9EP40 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B9EP40_SALSA Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [121][TOP] >UniRef100_B9EN06 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B9EN06_SALSA Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [122][TOP] >UniRef100_B5XFZ1 Ubiquitin-conjugating enzyme E2 D2 n=1 Tax=Salmo salar RepID=B5XFZ1_SALSA Length = 92 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [123][TOP] >UniRef100_B5DFV0 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B5DFV0_SALSA Length = 148 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [124][TOP] >UniRef100_A0JM78 Ubiquitin carrier protein n=2 Tax=Xenopus RepID=A0JM78_XENTR Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELNDLQRDPPAQCSAGPVGDDLFHWQATIMGP 40 [125][TOP] >UniRef100_Q9D7F5 Ubiquitin carrier protein n=1 Tax=Mus musculus RepID=Q9D7F5_MOUSE Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [126][TOP] >UniRef100_Q3U5V6 Ubiquitin carrier protein n=1 Tax=Mus musculus RepID=Q3U5V6_MOUSE Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [127][TOP] >UniRef100_Q862C5 Ubiquitin carrier protein (Fragment) n=1 Tax=Bos taurus RepID=Q862C5_BOVIN Length = 123 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [128][TOP] >UniRef100_Q8I607 Ubiquitin carrier protein n=2 Tax=Plasmodium RepID=Q8I607_PLAF7 Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDL +DPP+NCSAGP GDDLF WQATIMGP Sbjct: 8 KELQDLNKDPPTNCSAGPIGDDLFFWQATIMGP 40 [129][TOP] >UniRef100_Q4MZR4 Ubiquitin carrier protein n=2 Tax=Theileria RepID=Q4MZR4_THEPA Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP+NCSAGP GDD+FHWQATIMGP Sbjct: 8 KELADLTKDPPTNCSAGPVGDDMFHWQATIMGP 40 [130][TOP] >UniRef100_A7AVH5 Ubiquitin carrier protein n=1 Tax=Babesia bovis RepID=A7AVH5_BABBO Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP+NCSAGP GDD+FHWQATIMGP Sbjct: 8 KELADLTKDPPTNCSAGPVGDDMFHWQATIMGP 40 [131][TOP] >UniRef100_B3LB25 Ubiquitin carrier protein n=2 Tax=Plasmodium (Plasmodium) RepID=B3LB25_PLAKH Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDL +DPP+NCSAGP GDDLF WQATIMGP Sbjct: 8 KELQDLNKDPPTNCSAGPIGDDLFFWQATIMGP 40 [132][TOP] >UniRef100_P61077-2 Isoform 2 of Ubiquitin-conjugating enzyme E2 D3 n=1 Tax=Homo sapiens RepID=P61077-2 Length = 148 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [133][TOP] >UniRef100_P61077 Ubiquitin-conjugating enzyme E2 D3 n=7 Tax=Amniota RepID=UB2D3_HUMAN Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [134][TOP] >UniRef100_Q3ZCF7 Ubiquitin-conjugating enzyme E2 D3 n=1 Tax=Bos taurus RepID=UB2D3_BOVIN Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [135][TOP] >UniRef100_Q06AA9 Ubiquitin-conjugating enzyme E2 D2 n=1 Tax=Sus scrofa RepID=UB2D2_PIG Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [136][TOP] >UniRef100_P62837 Ubiquitin-conjugating enzyme E2 D2 n=8 Tax=Euteleostomi RepID=UB2D2_HUMAN Length = 147 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 40 [137][TOP] >UniRef100_UPI0001556273 PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b, partial n=1 Tax=Ornithorhynchus anatinus RepID=UPI0001556273 Length = 589 Score = 64.7 bits (156), Expect = 4e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 422 ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 275 ELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 306 [138][TOP] >UniRef100_UPI00015E0721 Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2). n=1 Tax=Homo sapiens RepID=UPI00015E0721 Length = 146 Score = 64.7 bits (156), Expect = 4e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 422 ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 ELNDLARDPPAQCSAGPVGDDMFHWQATIMGP 39 [139][TOP] >UniRef100_UPI0000457256 Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19) (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3). n=1 Tax=Homo sapiens RepID=UPI0000457256 Length = 148 Score = 64.7 bits (156), Expect = 4e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 422 ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 10 ELSDLARDPPAQCSAGPVGDDMFHWQATIMGP 41 [140][TOP] >UniRef100_UPI000179D301 hypothetical protein LOC511801 n=1 Tax=Bos taurus RepID=UPI000179D301 Length = 151 Score = 64.7 bits (156), Expect = 4e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLQRDPPAQCSAGPVGDDLFHWQATIMGP 40 [141][TOP] >UniRef100_Q32LL1 Ubiquitin carrier protein n=1 Tax=Bos taurus RepID=Q32LL1_BOVIN Length = 151 Score = 64.7 bits (156), Expect = 4e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLQRDPPAQCSAGPVGDDLFHWQATIMGP 40 [142][TOP] >UniRef100_Q4YR21 Ubiquitin carrier protein (Fragment) n=2 Tax=Plasmodium (Vinckeia) RepID=Q4YR21_PLABE Length = 139 Score = 64.7 bits (156), Expect = 4e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 422 ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 ELQDL +DPP+NCSAGP GDDLF WQATIMGP Sbjct: 1 ELQDLNKDPPTNCSAGPIGDDLFFWQATIMGP 32 [143][TOP] >UniRef100_C9JM05 Putative uncharacterized protein UBE2D4 n=1 Tax=Homo sapiens RepID=C9JM05_HUMAN Length = 74 Score = 64.7 bits (156), Expect = 4e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLQRDPPAQCSAGPVGDDLFHWQATIMGP 40 [144][TOP] >UniRef100_C9J9H9 Putative uncharacterized protein UBE2D4 n=1 Tax=Homo sapiens RepID=C9J9H9_HUMAN Length = 122 Score = 64.7 bits (156), Expect = 4e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLQRDPPAQCSAGPVGDDLFHWQATIMGP 40 [145][TOP] >UniRef100_Q6CNH3 Ubiquitin carrier protein n=1 Tax=Kluyveromyces lactis RepID=Q6CNH3_KLULA Length = 148 Score = 64.7 bits (156), Expect = 4e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP++CSAGP GDD++HWQA+IMGP Sbjct: 9 KELNDLGRDPPTSCSAGPVGDDVYHWQASIMGP 41 [146][TOP] >UniRef100_C5E0H9 Ubiquitin carrier protein n=1 Tax=Zygosaccharomyces rouxii CBS 732 RepID=C5E0H9_ZYGRC Length = 147 Score = 64.7 bits (156), Expect = 4e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP++CSAGP GDD++HWQA+IMGP Sbjct: 8 KELNDLGRDPPTSCSAGPVGDDVYHWQASIMGP 40 [147][TOP] >UniRef100_C4R5C5 Ubiquitin carrier protein n=1 Tax=Pichia pastoris GS115 RepID=C4R5C5_PICPG Length = 147 Score = 64.7 bits (156), Expect = 4e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP++CSAGP GDDL+HWQA+IMGP Sbjct: 8 KELIDLGRDPPTSCSAGPVGDDLYHWQASIMGP 40 [148][TOP] >UniRef100_A7TM13 Ubiquitin carrier protein n=1 Tax=Vanderwaltozyma polyspora DSM 70294 RepID=A7TM13_VANPO Length = 148 Score = 64.7 bits (156), Expect = 4e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP++CSAGP GDD++HWQA+IMGP Sbjct: 9 KELNDLGRDPPTSCSAGPVGDDVYHWQASIMGP 41 [149][TOP] >UniRef100_Q9Y2X8 Ubiquitin-conjugating enzyme E2 D4 n=2 Tax=Homo sapiens RepID=UB2D4_HUMAN Length = 147 Score = 64.7 bits (156), Expect = 4e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLQRDPPAQCSAGPVGDDLFHWQATIMGP 40 [150][TOP] >UniRef100_UPI0001556040 PREDICTED: similar to ubiquitin-conjugating enzyme E2D 4 (putative) n=1 Tax=Ornithorhynchus anatinus RepID=UPI0001556040 Length = 143 Score = 64.3 bits (155), Expect = 6e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 422 ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 5 ELTDLQRDPPAQCSAGPVGDDLFHWQATIMGP 36 [151][TOP] >UniRef100_UPI0000E2143A PREDICTED: similar to ubiquitin-conjugating enzyme HBUCE1 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E2143A Length = 167 Score = 64.3 bits (155), Expect = 6e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 422 ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 EL DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 29 ELTDLQRDPPAQCSAGPVGDDLFHWQATIMGP 60 [152][TOP] >UniRef100_Q7ZUR2 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=Q7ZUR2_DANRE Length = 147 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELTDLARDPPAQCSAGPVGDDVFHWQATIMGP 40 [153][TOP] >UniRef100_A9JRT4 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=A9JRT4_DANRE Length = 148 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 8 KELTDLARDPPAQCSAGPVGDDVFHWQATIMGP 40 [154][TOP] >UniRef100_C5X897 Ubiquitin carrier protein n=1 Tax=Sorghum bicolor RepID=C5X897_SORBI Length = 148 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP++CSAGPAG+DLFHWQATIMGP Sbjct: 8 KELMDLQKDPPTSCSAGPAGEDLFHWQATIMGP 40 [155][TOP] >UniRef100_B9SLF2 Ubiquitin carrier protein n=1 Tax=Ricinus communis RepID=B9SLF2_RICCO Length = 148 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP +CSAGPAGDD+FHWQATIMGP Sbjct: 8 KELKDLQKDPPVSCSAGPAGDDMFHWQATIMGP 40 [156][TOP] >UniRef100_Q69JN7 Ubiquitin carrier protein n=2 Tax=Oryza sativa RepID=Q69JN7_ORYSJ Length = 148 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP++CSAGPAG+DLFHWQATIMGP Sbjct: 8 KELMDLRKDPPTSCSAGPAGEDLFHWQATIMGP 40 [157][TOP] >UniRef100_B6U4K0 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6U4K0_MAIZE Length = 148 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP++CSAGPAG+DLFHWQATIMGP Sbjct: 8 KELMDLQKDPPTSCSAGPAGEDLFHWQATIMGP 40 [158][TOP] >UniRef100_B6STY8 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B6STY8_MAIZE Length = 96 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP++CSAGPAG+DLFHWQATIMGP Sbjct: 8 KELMDLQKDPPTSCSAGPAGEDLFHWQATIMGP 40 [159][TOP] >UniRef100_B4FCQ9 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B4FCQ9_MAIZE Length = 148 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP++CSAGPAG+DLFHWQATIMGP Sbjct: 8 KELMDLQKDPPTSCSAGPAGEDLFHWQATIMGP 40 [160][TOP] >UniRef100_P15731 Ubiquitin-conjugating enzyme E2 4 n=3 Tax=Saccharomyces cerevisiae RepID=UBC4_YEAST Length = 148 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 A+EL DL RDPP++CSAGP GDDL+HWQA+IMGP Sbjct: 8 AKELSDLERDPPTSCSAGPVGDDLYHWQASIMGP 41 [161][TOP] >UniRef100_UPI0000DD8DB5 Os01g0819400 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD8DB5 Length = 368 Score = 63.9 bits (154), Expect = 7e-09 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGPAG+D+FHWQATIMGP Sbjct: 109 KELKDLQKDPPTSCSAGPAGEDMFHWQATIMGP 141 [162][TOP] >UniRef100_UPI000069E064 Ubiquitin-conjugating enzyme E2 D4 (EC 6.3.2.19) (Ubiquitin-protein ligase D4) (Ubiquitin carrier protein D4) (HBUCE1). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069E064 Length = 147 Score = 63.9 bits (154), Expect = 7e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP G+DLFHWQATIMGP Sbjct: 8 QELMDLQRDPPAQCSAGPVGEDLFHWQATIMGP 40 [163][TOP] >UniRef100_Q4TBG2 Ubiquitin carrier protein (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4TBG2_TETNG Length = 167 Score = 63.9 bits (154), Expect = 7e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 ++EL DL RDPP+ CSAGP G+D+FHWQATIMGP Sbjct: 2 SQELTDLSRDPPAQCSAGPVGEDMFHWQATIMGP 35 [164][TOP] >UniRef100_Q1XAQ1 Ubiquitin carrier protein n=1 Tax=Triticum aestivum RepID=Q1XAQ1_WHEAT Length = 148 Score = 63.9 bits (154), Expect = 7e-09 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGPAG+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPAGEDMFHWQATIMGP 40 [165][TOP] >UniRef100_C5YZT9 Ubiquitin carrier protein n=2 Tax=Andropogoneae RepID=C5YZT9_SORBI Length = 148 Score = 63.9 bits (154), Expect = 7e-09 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGPAG+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPAGEDMFHWQATIMGP 40 [166][TOP] >UniRef100_Q8L458 Ubiquitin carrier protein n=2 Tax=Oryza sativa RepID=Q8L458_ORYSJ Length = 148 Score = 63.9 bits (154), Expect = 7e-09 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGPAG+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPAGEDMFHWQATIMGP 40 [167][TOP] >UniRef100_B6T1C0 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6T1C0_MAIZE Length = 148 Score = 63.9 bits (154), Expect = 7e-09 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGPAG+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPAGEDMFHWQATIMGP 40 [168][TOP] >UniRef100_C5XN94 Ubiquitin carrier protein n=2 Tax=Andropogoneae RepID=C5XN94_SORBI Length = 148 Score = 63.9 bits (154), Expect = 7e-09 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGPAG+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPAGEDMFHWQATIMGP 40 [169][TOP] >UniRef100_A6N0N4 Ubiquitin carrier protein n=1 Tax=Oryza sativa Indica Group RepID=A6N0N4_ORYSI Length = 148 Score = 63.9 bits (154), Expect = 7e-09 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGPAG+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPAGEDMFHWQATIMGP 40 [170][TOP] >UniRef100_A5AI12 Ubiquitin carrier protein n=1 Tax=Vitis vinifera RepID=A5AI12_VITVI Length = 148 Score = 63.9 bits (154), Expect = 7e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP GDD+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGDDMFHWQATIMGP 40 [171][TOP] >UniRef100_A2ZZ12 Ubiquitin carrier protein n=1 Tax=Oryza sativa Japonica Group RepID=A2ZZ12_ORYSJ Length = 103 Score = 63.9 bits (154), Expect = 7e-09 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGPAG+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPAGEDMFHWQATIMGP 40 [172][TOP] >UniRef100_B3TK57 Ubiquitin carrier protein n=1 Tax=Haliotis diversicolor RepID=B3TK57_HALDV Length = 147 Score = 63.9 bits (154), Expect = 7e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP+ CSAGP GDDLFHWQATIMGP Sbjct: 8 KELTDLDKDPPAQCSAGPVGDDLFHWQATIMGP 40 [173][TOP] >UniRef100_A8Q9R9 Ubiquitin carrier protein n=1 Tax=Malassezia globosa CBS 7966 RepID=A8Q9R9_MALGO Length = 147 Score = 63.9 bits (154), Expect = 7e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 ++EL DLGRDPPS+CSAGP GD++F WQATIMGP Sbjct: 7 SKELADLGRDPPSSCSAGPTGDNMFQWQATIMGP 40 [174][TOP] >UniRef100_UPI0000522A5B PREDICTED: similar to ubiquitin-conjugating enzyme H5b n=1 Tax=Ciona intestinalis RepID=UPI0000522A5B Length = 148 Score = 63.5 bits (153), Expect = 9e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDL RDPPS+CSAGP G+D FHWQATI GP Sbjct: 8 KELQDLNRDPPSHCSAGPVGEDYFHWQATITGP 40 [175][TOP] >UniRef100_B5XGQ5 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B5XGQ5_SALSA Length = 147 Score = 63.5 bits (153), Expect = 9e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP G+DLFHWQATIMGP Sbjct: 8 KELHDLQRDPPAQCSAGPVGEDLFHWQATIMGP 40 [176][TOP] >UniRef100_B5XDT0 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B5XDT0_SALSA Length = 147 Score = 63.5 bits (153), Expect = 9e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP G+DLFHWQATIMGP Sbjct: 8 KELHDLQRDPPAQCSAGPVGEDLFHWQATIMGP 40 [177][TOP] >UniRef100_B5X966 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B5X966_SALSA Length = 147 Score = 63.5 bits (153), Expect = 9e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP G+DLFHWQATIMGP Sbjct: 8 KELHDLQRDPPAQCSAGPVGEDLFHWQATIMGP 40 [178][TOP] >UniRef100_B5X6W5 Ubiquitin carrier protein n=3 Tax=Euteleostei RepID=B5X6W5_SALSA Length = 147 Score = 63.5 bits (153), Expect = 9e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP G+DLFHWQATIMGP Sbjct: 8 KELHDLQRDPPAQCSAGPVGEDLFHWQATIMGP 40 [179][TOP] >UniRef100_B5X5R7 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B5X5R7_SALSA Length = 133 Score = 63.5 bits (153), Expect = 9e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP G+DLFHWQATIMGP Sbjct: 8 KELHDLQRDPPAQCSAGPVGEDLFHWQATIMGP 40 [180][TOP] >UniRef100_A5PKP9 Ubiquitin carrier protein n=1 Tax=Xenopus laevis RepID=A5PKP9_XENLA Length = 147 Score = 63.5 bits (153), Expect = 9e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP G+DLFHWQATIMGP Sbjct: 8 KELMDLQRDPPAQCSAGPVGEDLFHWQATIMGP 40 [181][TOP] >UniRef100_B7PKN3 Ubiquitin carrier protein n=1 Tax=Ixodes scapularis RepID=B7PKN3_IXOSC Length = 147 Score = 63.5 bits (153), Expect = 9e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL RDPP+ CSAGP DDLFHWQATIMGP Sbjct: 8 KELEDLKRDPPAQCSAGPVNDDLFHWQATIMGP 40 [182][TOP] >UniRef100_A4QNX5 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=A4QNX5_DANRE Length = 147 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP G+DLFHWQATIMGP Sbjct: 8 KELTDLQRDPPAQCSAGPVGEDLFHWQATIMGP 40 [183][TOP] >UniRef100_Q4PFY1 Ubiquitin carrier protein n=1 Tax=Ustilago maydis RepID=Q4PFY1_USTMA Length = 147 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP GD++F WQATIMGP Sbjct: 8 KELVDLGRDPPSSCSAGPTGDNMFQWQATIMGP 40 [184][TOP] >UniRef100_P35134 Ubiquitin-conjugating enzyme E2 11 n=1 Tax=Arabidopsis thaliana RepID=UBC11_ARATH Length = 148 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPPSNCSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPSNCSAGPVAEDMFHWQATIMGP 40 [185][TOP] >UniRef100_Q6YUS2 Ubiquitin carrier protein n=2 Tax=Oryza sativa Japonica Group RepID=Q6YUS2_ORYSJ Length = 148 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL RDPP++CSAGP DD+FHWQATIMGP Sbjct: 8 KELKDLQRDPPTSCSAGPVSDDMFHWQATIMGP 40 [186][TOP] >UniRef100_UPI0000182094 UPI0000182094 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000182094 Length = 147 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP G+D+FHWQATIMGP Sbjct: 8 KELLDLARDPPTQCSAGPVGEDMFHWQATIMGP 40 [187][TOP] >UniRef100_C1BLB0 Ubiquitin carrier protein n=1 Tax=Osmerus mordax RepID=C1BLB0_OSMMO Length = 147 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +ELQDL RDPP+ CSAGP G+ LFHWQATIMGP Sbjct: 8 KELQDLQRDPPAQCSAGPVGEGLFHWQATIMGP 40 [188][TOP] >UniRef100_Q5UAG0 Ubiquitin carrier protein n=1 Tax=Arachis hypogaea RepID=Q5UAG0_ARAHY Length = 148 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP +CSAGP GDD+FHWQATIMGP Sbjct: 8 KELKDLQKDPPVSCSAGPVGDDMFHWQATIMGP 40 [189][TOP] >UniRef100_Q0R0E5 Ubiquitin carrier protein n=1 Tax=Symbiodinium sp. C3 RepID=Q0R0E5_9DINO Length = 146 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLG DPP+NCSAGP GDD F+WQATIMGP Sbjct: 8 KELADLGNDPPANCSAGPVGDDHFNWQATIMGP 40 [190][TOP] >UniRef100_B9T3W7 Ubiquitin carrier protein n=1 Tax=Ricinus communis RepID=B9T3W7_RICCO Length = 148 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL RDPP++CSAGP DD+FHWQATIMGP Sbjct: 8 KELKDLQRDPPASCSAGPVADDMFHWQATIMGP 40 [191][TOP] >UniRef100_B6THL6 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B6THL6_MAIZE Length = 61 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/48 (56%), Positives = 35/48 (72%), Gaps = 11/48 (22%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP-----------VCCA 529 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP +CCA Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDMFHWQATIMGPSGRPTRARRSCLCCA 55 [192][TOP] >UniRef100_B6T1T5 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6T1T5_MAIZE Length = 148 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/33 (72%), Positives = 32/33 (96%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 ++L+DL +DPP++CSAGPAG+D+FHWQATIMGP Sbjct: 8 KDLKDLQKDPPTSCSAGPAGEDMFHWQATIMGP 40 [193][TOP] >UniRef100_B4FSG6 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B4FSG6_MAIZE Length = 148 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL RDPP++CSAGP DD+FHWQATIMGP Sbjct: 8 KELKDLQRDPPTSCSAGPVSDDMFHWQATIMGP 40 [194][TOP] >UniRef100_Q9D1S1 Ubiquitin carrier protein n=1 Tax=Mus musculus RepID=Q9D1S1_MOUSE Length = 147 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP+ CSAGP GD +FHWQATIMGP Sbjct: 8 KELSDLARDPPAQCSAGPVGDGMFHWQATIMGP 40 [195][TOP] >UniRef100_Q9SPF9 Ubiquitin carrier protein n=1 Tax=Mesembryanthemum crystallinum RepID=Q9SPF9_MESCR Length = 148 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDMFHWQATIMGP 40 [196][TOP] >UniRef100_Q8RXA0 Ubiquitin carrier protein n=1 Tax=Oryza sativa RepID=Q8RXA0_ORYSA Length = 147 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDMFHWQATIMGP 40 [197][TOP] >UniRef100_Q5XUV4 Ubiquitin carrier protein n=1 Tax=Triticum aestivum RepID=Q5XUV4_WHEAT Length = 148 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDMFHWQATIMGP 40 [198][TOP] >UniRef100_Q2WEA9 Ubiquitin carrier protein n=1 Tax=Oryza sativa Indica Group RepID=Q2WEA9_ORYSI Length = 147 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDMFHWQATIMGP 40 [199][TOP] >UniRef100_C6T2F1 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6T2F1_SOYBN Length = 148 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP +CSAGP GDD+FHWQATIMGP Sbjct: 8 KELKDLQQDPPVSCSAGPVGDDMFHWQATIMGP 40 [200][TOP] >UniRef100_Q8S920 Ubiquitin carrier protein n=2 Tax=Oryza sativa RepID=Q8S920_ORYSJ Length = 147 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDMFHWQATIMGP 40 [201][TOP] >UniRef100_B6T650 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6T650_MAIZE Length = 147 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDIFHWQATIMGP 40 [202][TOP] >UniRef100_B6SYI7 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6SYI7_MAIZE Length = 147 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDIFHWQATIMGP 40 [203][TOP] >UniRef100_B6SIU1 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6SIU1_MAIZE Length = 147 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDMFHWQATIMGP 40 [204][TOP] >UniRef100_A3AYE9 Ubiquitin carrier protein n=1 Tax=Oryza sativa Japonica Group RepID=A3AYE9_ORYSJ Length = 203 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDMFHWQATIMGP 40 [205][TOP] >UniRef100_A3BC59 Ubiquitin carrier protein n=2 Tax=Oryza sativa RepID=A3BC59_ORYSJ Length = 148 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDMFHWQATIMGP 40 [206][TOP] >UniRef100_C5YA13 Ubiquitin carrier protein n=5 Tax=Poaceae RepID=C5YA13_SORBI Length = 148 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVGEDMFHWQATIMGP 40 [207][TOP] >UniRef100_Q8MYD4 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans RepID=Q8MYD4_CAEEL Length = 78 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP+ CS G GDDL+HWQATIMGP Sbjct: 8 KELHDLGRDPPAQCSTGSVGDDLYHWQATIMGP 40 [208][TOP] >UniRef100_B9WN01 Ubiquitin carrier protein n=1 Tax=Candida dubliniensis CD36 RepID=B9WN01_CANDC Length = 148 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = +2 Query: 419 EELQDLGR-DPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGR DPPS+CSAGP GDDL+HWQA+IMGP Sbjct: 8 KELSDLGRRDPPSSCSAGPVGDDLYHWQASIMGP 41 [209][TOP] >UniRef100_C6TKT1 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6TKT1_SOYBN Length = 148 Score = 62.0 bits (149), Expect = 3e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL RDPP++CSAGP G+D+FHWQATI+GP Sbjct: 8 KELKDLQRDPPTSCSAGPVGEDMFHWQATIIGP 40 [210][TOP] >UniRef100_B9IQJ4 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=B9IQJ4_POPTR Length = 148 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP+ CSAGPAG D+FHWQATIMGP Sbjct: 8 KELRDLQKDPPTACSAGPAGSDMFHWQATIMGP 40 [211][TOP] >UniRef100_B3TLV3 Ubiquitin carrier protein n=1 Tax=Elaeis guineensis RepID=B3TLV3_ELAGV Length = 148 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP++CSAGP G+DLFHWQATIMGP Sbjct: 8 KELLDLQKDPPTSCSAGPVGEDLFHWQATIMGP 40 [212][TOP] >UniRef100_Q5DHA7 Ubiquitin carrier protein n=1 Tax=Schistosoma japonicum RepID=Q5DHA7_SCHJA Length = 147 Score = 62.0 bits (149), Expect = 3e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGPV 520 ++EL DL RDPP+ CSAGP DDLF WQATIMGPV Sbjct: 7 SKELHDLNRDPPAQCSAGPVSDDLFDWQATIMGPV 41 [213][TOP] >UniRef100_A9UR38 Ubiquitin carrier protein n=1 Tax=Monosiga brevicollis RepID=A9UR38_MONBE Length = 147 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 422 ELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 EL+DL R+PP+ CSAGP GDD FHWQATIMGP Sbjct: 9 ELKDLEREPPAQCSAGPVGDDFFHWQATIMGP 40 [214][TOP] >UniRef100_Q6ZWY6 Ubiquitin-conjugating enzyme E2 D2B n=2 Tax=Murinae RepID=U2D2B_MOUSE Length = 147 Score = 62.0 bits (149), Expect = 3e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL +DPP+ CSAGP G+D+FHWQATIMGP Sbjct: 8 KELNDLAQDPPAQCSAGPVGEDMFHWQATIMGP 40 [215][TOP] >UniRef100_UPI0000522A5A PREDICTED: similar to Ubiquitin-conjugating enzyme E2-17 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein effete) n=1 Tax=Ciona intestinalis RepID=UPI0000522A5A Length = 148 Score = 61.6 bits (148), Expect = 4e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL D+ RDPP+ CSAGP GDDLF WQATIMGP Sbjct: 8 KELADISRDPPAQCSAGPVGDDLFQWQATIMGP 40 [216][TOP] >UniRef100_C0PPT0 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=C0PPT0_PICSI Length = 148 Score = 61.6 bits (148), Expect = 4e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP DD+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVADDMFHWQATIMGP 40 [217][TOP] >UniRef100_C0PPR9 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=C0PPR9_PICSI Length = 148 Score = 61.6 bits (148), Expect = 4e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP DD+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVADDMFHWQATIMGP 40 [218][TOP] >UniRef100_B9N5K7 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=B9N5K7_POPTR Length = 148 Score = 61.6 bits (148), Expect = 4e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP DD+FHWQATIMGP Sbjct: 8 KELKDLQKDPPASCSAGPVADDMFHWQATIMGP 40 [219][TOP] >UniRef100_B9GHJ6 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=B9GHJ6_POPTR Length = 148 Score = 61.6 bits (148), Expect = 4e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP DD+FHWQATIMGP Sbjct: 8 KELKDLQKDPPASCSAGPVADDMFHWQATIMGP 40 [220][TOP] >UniRef100_B8LMC9 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=B8LMC9_PICSI Length = 148 Score = 61.6 bits (148), Expect = 4e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP DD+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVADDMFHWQATIMGP 40 [221][TOP] >UniRef100_B2LUR9 Ubiquitin carrier protein n=1 Tax=Malus x domestica RepID=B2LUR9_MALDO Length = 148 Score = 61.6 bits (148), Expect = 4e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP DD+FHWQATIMGP Sbjct: 8 KELKDLQKDPPASCSAGPVADDMFHWQATIMGP 40 [222][TOP] >UniRef100_A5YVL3 Ubiquitin carrier protein n=1 Tax=Adiantum capillus-veneris RepID=A5YVL3_ADICA Length = 148 Score = 61.6 bits (148), Expect = 4e-08 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGPV 520 +EL+DL +DPP++CSAGP +D+FHWQATIMGPV Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPV 41 [223][TOP] >UniRef100_B0DBM3 Ubiquitin carrier protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0DBM3_LACBS Length = 147 Score = 61.6 bits (148), Expect = 4e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPP++CSAGP GD++F WQATIMGP Sbjct: 8 KELIDLGRDPPTSCSAGPTGDNMFQWQATIMGP 40 [224][TOP] >UniRef100_B0JYU2 Ubiquitin carrier protein (Fragment) n=1 Tax=Xenopus (Silurana) tropicalis RepID=B0JYU2_XENTR Length = 136 Score = 61.2 bits (147), Expect = 5e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +2 Query: 431 DLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 DL RDPP+ CSAGP GDDLFHWQATIMGP Sbjct: 1 DLQRDPPAQCSAGPVGDDLFHWQATIMGP 29 [225][TOP] >UniRef100_Q84QC6 Ubiquitin carrier protein n=1 Tax=Hordeum vulgare RepID=Q84QC6_HORVU Length = 148 Score = 61.2 bits (147), Expect = 5e-08 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +E +DL +DPP++CSAGP+G+D+FHWQATIMGP Sbjct: 8 KEFKDLQKDPPTSCSAGPSGEDMFHWQATIMGP 40 [226][TOP] >UniRef100_A9NKT3 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=A9NKT3_PICSI Length = 148 Score = 61.2 bits (147), Expect = 5e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL RDPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQRDPPTSCSAGPVAEDMFHWQATIMGP 40 [227][TOP] >UniRef100_Q6YI35 Ubiquitin carrier protein (Fragment) n=2 Tax=Cetartiodactyla RepID=Q6YI35_PIG Length = 104 Score = 61.2 bits (147), Expect = 5e-08 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +2 Query: 431 DLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 DL RDPP+ CSAGP GDD+FHWQATIMGP Sbjct: 1 DLARDPPAQCSAGPVGDDMFHWQATIMGP 29 [228][TOP] >UniRef100_UPI0000585220 PREDICTED: similar to ubiquitin-conjugating enzyme n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000585220 Length = 147 Score = 60.8 bits (146), Expect = 6e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +E +D ++PPSNCSAGP GDD++HWQATIMGP Sbjct: 8 KEYKDFEKEPPSNCSAGPVGDDMYHWQATIMGP 40 [229][TOP] >UniRef100_Q98TM7 Ubiquitin carrier protein (Fragment) n=1 Tax=Platichthys flesus RepID=Q98TM7_PLAFE Length = 98 Score = 60.8 bits (146), Expect = 6e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DL RDPP++CSAGP G+D+FHWQATI GP Sbjct: 1 KELNDLQRDPPASCSAGPVGEDMFHWQATITGP 33 [230][TOP] >UniRef100_Q5KF72 Ubiquitin carrier protein n=2 Tax=Filobasidiella neoformans RepID=Q5KF72_CRYNE Length = 147 Score = 60.8 bits (146), Expect = 6e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLGRDPPS+CSAGP D+LF WQATIMGP Sbjct: 8 KELIDLGRDPPSSCSAGPINDNLFQWQATIMGP 40 [231][TOP] >UniRef100_Q9FKT3 Ubiquitin carrier protein E2 30 n=1 Tax=Arabidopsis thaliana RepID=UBC30_ARATH Length = 148 Score = 60.8 bits (146), Expect = 6e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL RDPP +CSAGP GDD+F WQATIMGP Sbjct: 8 KELRDLQRDPPVSCSAGPTGDDMFQWQATIMGP 40 [232][TOP] >UniRef100_Q9SLE4 Ubiquitin carrier protein E2 29 n=1 Tax=Arabidopsis thaliana RepID=UBC29_ARATH Length = 148 Score = 60.8 bits (146), Expect = 6e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL++L RDPP +CSAGP G+D+FHWQATIMGP Sbjct: 8 KELKELQRDPPVSCSAGPTGEDMFHWQATIMGP 40 [233][TOP] >UniRef100_UPI000198342B PREDICTED: similar to UBC9 (UBIQUITIN CONJUGATING ENZYME 9); ubiquitin-protein ligase n=1 Tax=Vitis vinifera RepID=UPI000198342B Length = 148 Score = 60.5 bits (145), Expect = 8e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +2 Query: 416 AEELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 ++EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 7 SKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [234][TOP] >UniRef100_C0HHI6 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=C0HHI6_MAIZE Length = 138 Score = 60.5 bits (145), Expect = 8e-08 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 431 DLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 DL +DPP++CSAGPAG+DLFHWQATIMGP Sbjct: 2 DLQKDPPTSCSAGPAGEDLFHWQATIMGP 30 [235][TOP] >UniRef100_A3E3W0 Ubiquitin carrier protein n=1 Tax=Pfiesteria piscicida RepID=A3E3W0_PFIPI Length = 147 Score = 60.5 bits (145), Expect = 8e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL DLG DPP+NCSAGP G+D+F W ATIMGP Sbjct: 8 KELADLGNDPPANCSAGPTGEDMFSWSATIMGP 40 [236][TOP] >UniRef100_UPI0001A7B344 UBC10 (ubiquitin-conjugating enzyme 10); ubiquitin-protein ligase n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B344 Length = 109 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [237][TOP] >UniRef100_Q8LJR9 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=Q8LJR9_SOYBN Length = 148 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [238][TOP] >UniRef100_Q84YH3 Ubiquitin carrier protein n=2 Tax=Gossypium RepID=Q84YH3_GOSRA Length = 148 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [239][TOP] >UniRef100_Q84K93 Ubiquitin carrier protein n=1 Tax=Gossypium hirsutum RepID=Q84K93_GOSHI Length = 148 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [240][TOP] >UniRef100_Q64FZ9 Ubiquitin conjugating enzyme E2 (Fragment) n=1 Tax=Pisum sativum RepID=Q64FZ9_PEA Length = 61 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [241][TOP] >UniRef100_Q42266 Ubiquitin conjugating enzyme homolog (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q42266_ARATH Length = 71 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [242][TOP] >UniRef100_Q38JG8 Ubiquitin carrier protein n=2 Tax=Solanum RepID=Q38JG8_SOLTU Length = 148 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [243][TOP] >UniRef100_Q287S5 Ubiquitin conjugating enzyme E2 (Fragment) n=1 Tax=Lupinus albus RepID=Q287S5_LUPAL Length = 59 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 6 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 38 [244][TOP] >UniRef100_Q06H24 Ubiquitin carrier protein n=1 Tax=Arachis hypogaea RepID=Q06H24_ARAHY Length = 149 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [245][TOP] >UniRef100_Q06H23 Ubiquitin carrier protein n=1 Tax=Arachis hypogaea RepID=Q06H23_ARAHY Length = 148 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [246][TOP] >UniRef100_C6TD37 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6TD37_SOYBN Length = 96 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [247][TOP] >UniRef100_Q66N67 Ubiquitin-conjugating enzyme (Fragment) n=2 Tax=core eudicotyledons RepID=Q66N67_VITVI Length = 44 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 6 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 38 [248][TOP] >UniRef100_C6T3B1 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6T3B1_SOYBN Length = 148 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [249][TOP] >UniRef100_C6SXK4 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6SXK4_SOYBN Length = 148 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40 [250][TOP] >UniRef100_C6SX33 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6SX33_SOYBN Length = 148 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 419 EELQDLGRDPPSNCSAGPAGDDLFHWQATIMGP 517 +EL+DL +DPP++CSAGP +D+FHWQATIMGP Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP 40