[UP]
[1][TOP] >UniRef100_C1MJ05 Predicted protein (Fragment) n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MJ05_9CHLO Length = 210 Score = 92.8 bits (229), Expect = 1e-17 Identities = 51/109 (46%), Positives = 57/109 (52%), Gaps = 1/109 (0%) Frame = +1 Query: 76 GGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAIT 255 GG G GGGGGGGGGGG G D + GGGG GL W +YL+ALD AP+ TK T Sbjct: 1 GGKGGGGGGGGGGGGGSGGDGASGGGGGGGGGGL-------WAAYLRALDTAPLLTKCFT 53 Query: 256 AGVLVGLGDTLAQ-MLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWYN 399 +GVL GD AQ M D R FA L GP H WY+ Sbjct: 54 SGVLNVFGDVFAQFMFEDAARNGCDWRRAGVFALLGFALVGPCLHFWYS 102 [2][TOP] >UniRef100_A4RU33 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RU33_OSTLU Length = 240 Score = 79.7 bits (195), Expect = 9e-14 Identities = 49/118 (41%), Positives = 55/118 (46%), Gaps = 1/118 (0%) Frame = +1 Query: 46 RGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALD 225 RGA GGG GGGGGGGGGGG G D GGG G + W +YL AL+ Sbjct: 12 RGAARGKSASVGGGNGGGGGGGGGGGGGGD--------GGGDGAAGGVQTLWAAYLNALE 63 Query: 226 VAPIKTKAITAGVLVGLGDTLAQM-LTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 P+ TK T+GVL LGD AQ +D R F L GP H WY Sbjct: 64 KNPLATKCATSGVLNALGDLFAQFSFDDAAKKGIDWRRAGVFTFLGGALVGPALHFWY 121 [3][TOP] >UniRef100_C1DZV4 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1DZV4_9CHLO Length = 322 Score = 77.0 bits (188), Expect = 6e-13 Identities = 49/131 (37%), Positives = 58/131 (44%), Gaps = 1/131 (0%) Frame = +1 Query: 7 PDEFLSSSTPPMSRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGAL 186 PD S RG GGGG GG GG GGG G G +S A++G GG GL Sbjct: 75 PDGNAGPSFRRQRRGVARAAEGGGGGGSGGSGGSGGGSGGGGGDS-GASSGSGGGGL--- 130 Query: 187 LLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQ-MLTGTPLGNLDLPRLFSFAAFVL 363 W YL +L+ P+ TK +T+G+L GD AQ M D R F Sbjct: 131 ----WVLYLSSLEKNPLLTKCVTSGILNSAGDLFAQFMFEDAASKGCDWKRAGVFTFLGA 186 Query: 364 VLQGPVGHAWY 396 L GP H WY Sbjct: 187 ALVGPCLHFWY 197 [4][TOP] >UniRef100_B9IHK6 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IHK6_POPTR Length = 264 Score = 76.6 bits (187), Expect = 8e-13 Identities = 46/107 (42%), Positives = 60/107 (56%) Frame = +1 Query: 76 GGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAIT 255 G GG GG GG GGGGEG+ A++G GG + L SW YL L P+ TKA+T Sbjct: 58 GSGGSGGVGGSAGGGGEGS----GASSGSGGNSNWSFL--SW--YLNLLANYPVLTKAVT 109 Query: 256 AGVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 + +L +GD + Q++ + +LDL R F F LVL GP H WY Sbjct: 110 SAILTFMGDLICQLVI-DQVPSLDLKRTFLFTLLGLVLVGPTLHIWY 155 [5][TOP] >UniRef100_UPI0001A2BF4C Hypothetical protein. n=1 Tax=Danio rerio RepID=UPI0001A2BF4C Length = 354 Score = 75.5 bits (184), Expect = 2e-12 Identities = 33/53 (62%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Frame = -3 Query: 200 QERRSRAPSPAP--PPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +ERR+ AP P P PPPA A P PPP P PPPPP PPPP GGG PPAP Sbjct: 101 RERRASAPPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAP 153 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/68 (45%), Positives = 35/68 (51%), Gaps = 21/68 (30%) Frame = +1 Query: 34 PPMSRGAGGPPPPPGGGGRGGGGGGGGGGGEGA---------------DES------FSA 150 PP S G P PPP GG GGGGGGGGGGG+G D+S SA Sbjct: 142 PPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAASA 201 Query: 151 AAGGGGAG 174 ++GGGG G Sbjct: 202 SSGGGGGG 209 [6][TOP] >UniRef100_A4QN64 Zgc:162320 protein n=1 Tax=Danio rerio RepID=A4QN64_DANRE Length = 412 Score = 75.5 bits (184), Expect = 2e-12 Identities = 33/53 (62%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Frame = -3 Query: 200 QERRSRAPSPAP--PPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +ERR+ AP P P PPPA A P PPP P PPPPP PPPP GGG PPAP Sbjct: 159 RERRASAPPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAP 211 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/68 (45%), Positives = 35/68 (51%), Gaps = 21/68 (30%) Frame = +1 Query: 34 PPMSRGAGGPPPPPGGGGRGGGGGGGGGGGEGA---------------DES------FSA 150 PP S G P PPP GG GGGGGGGGGGG+G D+S SA Sbjct: 200 PPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAASA 259 Query: 151 AAGGGGAG 174 ++GGGG G Sbjct: 260 SSGGGGGG 267 [7][TOP] >UniRef100_B9HDU1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HDU1_POPTR Length = 286 Score = 73.2 bits (178), Expect = 9e-12 Identities = 47/113 (41%), Positives = 61/113 (53%), Gaps = 7/113 (6%) Frame = +1 Query: 79 GGGRGG----GGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTS---YLKALDVAPI 237 GGG GG GG GGGGG+G AA+GG G+G R+W+ YL L P+ Sbjct: 75 GGGSGGSGRLGGSSGGGGGQG-----GAASGGSGSGGN----RNWSFLSWYLNLLAKYPV 125 Query: 238 KTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 TKA+T+ +L +GD + Q++ +LDL R F F LVL GP H WY Sbjct: 126 LTKAVTSAILTLMGDLICQLVI-DQAPSLDLKRTFVFTFLGLVLVGPTLHFWY 177 [8][TOP] >UniRef100_A7PTF2 Chromosome chr8 scaffold_29, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PTF2_VITVI Length = 293 Score = 71.6 bits (174), Expect = 3e-11 Identities = 45/102 (44%), Positives = 56/102 (54%) Frame = +1 Query: 91 GGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLV 270 GG GG GG GG G S + G GG G +LL SW YL L+ P+ TKAIT+ L Sbjct: 88 GGSGGTGGFGGFGDGNSGGKSEGSGGGGDWSLL--SW--YLALLEKYPVLTKAITSAFLT 143 Query: 271 GLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 +GD + Q++ + +LDL R F F LVL GP H WY Sbjct: 144 LVGDLICQLVI-DQVPSLDLKRTFLFTLLGLVLVGPTLHFWY 184 [9][TOP] >UniRef100_Q54SP2 Formin-B n=1 Tax=Dictyostelium discoideum RepID=FORB_DICDI Length = 1126 Score = 71.2 bits (173), Expect = 3e-11 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 5/56 (8%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAPRDIGGV 30 AP P PPPP A P PPPPPPPP PPP PPPP GG PP P GG+ Sbjct: 544 APPPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPPGGM 599 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 9/50 (18%) Frame = -3 Query: 170 APPPPAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAP 48 +PP A + AP PPPPPP PPPPP PPPP GGGPP P Sbjct: 531 SPPIEAPSSPSLGAPPPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPP 580 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGGGGGPPAP 48 P P PPPP+ S PPPPPPP PPP PPPPGG P AP Sbjct: 564 PPPPPPPPS-----SGGGPPPPPPPPSSGGPPPPPPPPGGMKKPGAP 605 [10][TOP] >UniRef100_Q01D06 Peroxisomal membrane protein MPV17 and related proteins (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01D06_OSTTA Length = 238 Score = 70.9 bits (172), Expect = 4e-11 Identities = 44/119 (36%), Positives = 54/119 (45%), Gaps = 1/119 (0%) Frame = +1 Query: 43 SRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKAL 222 +R G GG GG GGGG GG G + F ++ G G+ AL W +YL AL Sbjct: 4 TRARRGTATRATNGGNGGNGGGGNGGNGGNGDGFGSSNDGQNGGVRAL----WAAYLGAL 59 Query: 223 DVAPIKTKAITAGVLVGLGDTLAQMLTGTPLG-NLDLPRLFSFAAFVLVLQGPVGHAWY 396 + P+ TK T+GVL LGD AQ +D R F L GP H WY Sbjct: 60 EKNPLPTKMATSGVLNALGDLFAQFAFDDAANKGVDWRRAGIFTILGSFLVGPALHFWY 118 [11][TOP] >UniRef100_C8V0K5 Cytokinesis protein sepA (Forced expression inhibition of growth A)(Protein FH1/2) [Source:UniProtKB/Swiss-Prot;Acc:P78621] n=1 Tax=Aspergillus nidulans FGSC A4 RepID=C8V0K5_EMENI Length = 1789 Score = 70.5 bits (171), Expect = 6e-11 Identities = 32/63 (50%), Positives = 35/63 (55%), Gaps = 11/63 (17%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPP-----------PPPPPPPRPPPPGGGGGP 57 V + + P P PPPPA +AP PPPP PPPPPPP PPPPGG GGP Sbjct: 1008 VDKATAAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGP 1067 Query: 56 PAP 48 P P Sbjct: 1068 PPP 1070 Score = 70.5 bits (171), Expect = 6e-11 Identities = 31/54 (57%), Positives = 32/54 (59%), Gaps = 9/54 (16%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAP 48 AP P PPPP +AP PPPPPP PPPPP PPPPGG GGPP P Sbjct: 1032 APPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPP 1085 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 48 AP P PPPP P PPPPPPPP PPP PPPPGG GGPP P Sbjct: 1049 APPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPP 1098 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAPRDIGGV 30 P PPPP P PPPPPP PPPPP PPP G G PP P G V Sbjct: 1067 PPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPPGTV 1119 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/47 (51%), Positives = 27/47 (57%), Gaps = 12/47 (25%) Frame = -3 Query: 152 AAEKDSSAPSPPPP------------PPPPPPPRPPPPGGGGGPPAP 48 A +K ++AP PPPP PPPPPPP PPPPG G PP P Sbjct: 1007 AVDKATAAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPP 1053 [12][TOP] >UniRef100_P78621 Cytokinesis protein sepA n=1 Tax=Emericella nidulans RepID=SEPA_EMENI Length = 1790 Score = 70.5 bits (171), Expect = 6e-11 Identities = 32/63 (50%), Positives = 35/63 (55%), Gaps = 11/63 (17%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPP-----------PPPPPPPRPPPPGGGGGP 57 V + + P P PPPPA +AP PPPP PPPPPPP PPPPGG GGP Sbjct: 1009 VDKATAAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGP 1068 Query: 56 PAP 48 P P Sbjct: 1069 PPP 1071 Score = 70.5 bits (171), Expect = 6e-11 Identities = 31/54 (57%), Positives = 32/54 (59%), Gaps = 9/54 (16%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAP 48 AP P PPPP +AP PPPPPP PPPPP PPPPGG GGPP P Sbjct: 1033 APPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPP 1086 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 48 AP P PPPP P PPPPPPPP PPP PPPPGG GGPP P Sbjct: 1050 APPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPP 1099 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAPRDIGGV 30 P PPPP P PPPPPP PPPPP PPP G G PP P G V Sbjct: 1068 PPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPPGTV 1120 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/47 (51%), Positives = 27/47 (57%), Gaps = 12/47 (25%) Frame = -3 Query: 152 AAEKDSSAPSPPPP------------PPPPPPPRPPPPGGGGGPPAP 48 A +K ++AP PPPP PPPPPPP PPPPG G PP P Sbjct: 1008 AVDKATAAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPP 1054 [13][TOP] >UniRef100_UPI000175F433 PREDICTED: similar to formin-like 1 n=1 Tax=Danio rerio RepID=UPI000175F433 Length = 1102 Score = 70.1 bits (170), Expect = 7e-11 Identities = 39/106 (36%), Positives = 50/106 (47%), Gaps = 6/106 (5%) Frame = -3 Query: 347 KLNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPA 168 +L ++G RL V S+ V P + + + S+A + AP P Sbjct: 527 ELQEKGLLRLERTVSGSLDIDVIPVTLEKIVTQTVTVPDSASQA-----PPSPAAAPPPP 581 Query: 167 PPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPPAP 48 PPPP ++ P PPPPPP PPPPP PPPPGGG PP P Sbjct: 582 PPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPP 627 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 7/54 (12%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP--PPPPRPPPPGGG-----GGPPAP 48 + AP P PPPP + + P PPPPPPP PPP PPPPG G G PPAP Sbjct: 590 AEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAP 643 [14][TOP] >UniRef100_UPI0001A2D69A UPI0001A2D69A related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D69A Length = 1058 Score = 70.1 bits (170), Expect = 7e-11 Identities = 39/106 (36%), Positives = 50/106 (47%), Gaps = 6/106 (5%) Frame = -3 Query: 347 KLNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPA 168 +L ++G RL V S+ V P + + + S+A + AP P Sbjct: 474 ELQEKGLLRLERTVSGSLDIDVIPVTLEKIVTQTVTVPDSASQA-----PPSPAAAPPPP 528 Query: 167 PPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPPAP 48 PPPP ++ P PPPPPP PPPPP PPPPGGG PP P Sbjct: 529 PPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPP 574 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 7/54 (12%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP--PPPPRPPPPGGG-----GGPPAP 48 + AP P PPPP + + P PPPPPPP PPP PPPPG G G PPAP Sbjct: 537 AEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAP 590 [15][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 70.1 bits (170), Expect = 7e-11 Identities = 37/96 (38%), Positives = 44/96 (45%), Gaps = 6/96 (6%) Frame = -3 Query: 317 PSGVPVSICASV------SPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPP 156 P G P CA+ P + + + L L A L +P P+PPPP Sbjct: 182 PPGYPSGFCAAAIFDTTCECCPISQASTLPLPLPNAPPSPLPPSPPPPPPPSPPPSPPPP 241 Query: 155 AAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S PSPPPPPPPPPPP PPPP PP+P Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P P PPPP + S P PPPPPPPPPPP PPPP PP P Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P PPPP+ P PPPPPPPPPPP PPPP PP P Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP PSPPPPPPPPPPP PPPP PP P Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/46 (56%), Positives = 26/46 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 42 P P PPPP S P PPPPPPPPPPP PPPP PP D Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPD 306 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S PSP PPPP P PPPPPP PPPP PPPP PP P Sbjct: 248 SPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P PPPP P PP PPPPPPPP PPPP PP P Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P P PPPPPPPPP PPPP PP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPP PPPP PP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP P PP P PPPPPPPPPP PPPP PP P Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 [16][TOP] >UniRef100_B3N3N0 GG24397 n=1 Tax=Drosophila erecta RepID=B3N3N0_DROER Length = 1462 Score = 70.1 bits (170), Expect = 7e-11 Identities = 32/67 (47%), Positives = 38/67 (56%), Gaps = 6/67 (8%) Frame = -3 Query: 230 ATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGG 69 +T+ A D ++ + AP P PPPP + AP PPPPPPP PPPP PPPPG Sbjct: 875 STNSAKDEDEEKPHAAAPPPPPPPPPPPAFAAPAPPPPPPPPPLANYGAPPPPPPPPPGS 934 Query: 68 GGGPPAP 48 G PP P Sbjct: 935 GSAPPPP 941 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/50 (54%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 48 AP+P PPPP + AP PPPPPPP PPPP P P GGG P P Sbjct: 906 APAPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPLEGGGAIPPP 955 [17][TOP] >UniRef100_B4I348 GM18116 n=1 Tax=Drosophila sechellia RepID=B4I348_DROSE Length = 1519 Score = 69.7 bits (169), Expect = 1e-10 Identities = 31/66 (46%), Positives = 37/66 (56%), Gaps = 7/66 (10%) Frame = -3 Query: 224 SRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGG 66 + +L+ D + + AP P PPPP D+ P PPPPPPP PPPP PPPPG G Sbjct: 932 NESLKEDGDKPHAVAPPPPPPPPPPPAFDAPPPPPPPPPPPPLANYGAPPPPPPPPPGSG 991 Query: 65 GGPPAP 48 PP P Sbjct: 992 SAPPPP 997 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/53 (49%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAPRDIG 36 P P PPPP + P PPPPPP PPPPP P GG G PP P +G Sbjct: 964 PPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIQGGSGIPPPPPPLG 1016 [18][TOP] >UniRef100_C9S8M2 Cytokinesis protein sepA n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9S8M2_9PEZI Length = 842 Score = 69.7 bits (169), Expect = 1e-10 Identities = 36/94 (38%), Positives = 41/94 (43%), Gaps = 6/94 (6%) Frame = -3 Query: 311 GVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSS 132 G + V+P T+TP + +V P P PPPP Sbjct: 138 GTTMESAPLVTPAGTDTPKI---------------EVTSAAPPPPPPPPPPPPPMPGQGG 182 Query: 131 APSPPPPPPPPPPPRPPPP------GGGGGPPAP 48 AP PPPPPPPPPPP PPPP GGGPP P Sbjct: 183 APPPPPPPPPPPPPPPPPPPMPGMLSPGGGPPPP 216 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP +P PPPPPPPPP PP PG G PP P Sbjct: 192 PPPPPPPPPPPMPGMLSPGGGPPPPPPPPPPPPMPGAPGMPPPP 235 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP PPPPPPPPPPP P PG PP P Sbjct: 195 PPPPPPPPMPGMLSPGGGPPPPPPPPPPPPMPGAPGMPPPPPPP 238 [19][TOP] >UniRef100_B6Q311 Actin associated protein Wsp1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q311_PENMQ Length = 627 Score = 69.7 bits (169), Expect = 1e-10 Identities = 37/100 (37%), Positives = 46/100 (46%), Gaps = 8/100 (8%) Frame = -3 Query: 323 RLPSGVPVSIC-ASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAA 147 +LP +P ++ AS+ P P + L + +R + S AP P PPPP Sbjct: 424 QLPPKIPHAVAPASIPPPPPARAPIAPPQLPPSNTRLVPPPPPAPSSGAPPPPPPPPPPP 483 Query: 146 EKDSSAPSPPPPP-------PPPPPPRPPPPGGGGGPPAP 48 P PPPPP PPPPPP PPPP G PP P Sbjct: 484 PSSGIPPPPPPPPPPPSSGAPPPPPPPPPPPASSGAPPPP 523 Score = 67.4 bits (163), Expect = 5e-10 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 5/57 (8%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAPRDIGG 33 S P P PPPP + P PPPPPPP PPPP PPPPGG PP P GG Sbjct: 486 SGIPPPPPPPPPPPSSGAPPPPPPPPPPPASSGAPPPPPPPPPGGAAPPPLPSVGGG 542 [20][TOP] >UniRef100_B4MTT1 GK23771 n=1 Tax=Drosophila willistoni RepID=B4MTT1_DROWI Length = 1512 Score = 69.3 bits (168), Expect = 1e-10 Identities = 35/67 (52%), Positives = 40/67 (59%), Gaps = 10/67 (14%) Frame = -3 Query: 206 DVQE--RRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPP---PRPPPP-----GGGGGP 57 ++QE ++ AP P PPPP AA S+ P PPPPPPPPPP P PPPP GG P Sbjct: 919 EIQESNKQQTAPPPPPPPPPAAPTISAGPPPPPPPPPPPPPGIPAPPPPPNLSVGGPPPP 978 Query: 56 PAPRDIG 36 P P IG Sbjct: 979 PPPPGIG 985 [21][TOP] >UniRef100_A0DA74 Chromosome undetermined scaffold_43, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0DA74_PARTE Length = 1401 Score = 68.9 bits (167), Expect = 2e-10 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGG--PPAPRDIGGVDEERNSS 9 P P PPPP K SAP PPPPP P PP PPPP GG PP PR GG D + +S Sbjct: 870 PPPPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAPPLPPGPRPPGGPDPQFGAS 928 Score = 68.2 bits (165), Expect = 3e-10 Identities = 29/52 (55%), Positives = 29/52 (55%), Gaps = 8/52 (15%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP--------PPPPPRPPPPGGGGGPPAP 48 P P PPPP K P PPPPPP PPPPP PPPPGG G PP P Sbjct: 807 PPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPP 858 Score = 65.9 bits (159), Expect = 1e-09 Identities = 31/53 (58%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAP 48 R P P PPPP K SAP PPPPPP PPPPP PPPPG GPP P Sbjct: 823 RPPPPPPPPPPPGGK--SAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPP 873 Score = 63.2 bits (152), Expect = 9e-09 Identities = 32/59 (54%), Positives = 32/59 (54%), Gaps = 9/59 (15%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGG--GGGPPAPRDIGG 33 AP P PPPP K AP PPPPPP PPPPP PPPPG G PP P GG Sbjct: 839 APPPPPPPPPPGGK--GAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGG 895 [22][TOP] >UniRef100_Q8L9G1 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana RepID=Q8L9G1_ARATH Length = 289 Score = 68.6 bits (166), Expect = 2e-10 Identities = 49/118 (41%), Positives = 60/118 (50%) Frame = +1 Query: 43 SRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKAL 222 S G+GG GG G GG GG GGGGG+G+D G G LL SW Y L Sbjct: 81 SGGSGGL----GGSGGGGNGGSGGGGGDGSD----------GKGKKRSLL-SW--YQALL 123 Query: 223 DVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 +P+ TKA+TA +L +GD + Q LT +LD R +F L L GP H WY Sbjct: 124 SNSPVLTKAVTAALLNLVGDLICQ-LTINKTSSLDKKRTLTFTFLGLGLVGPTLHFWY 180 [23][TOP] >UniRef100_A0D1C0 Chromosome undetermined scaffold_34, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D1C0_PARTE Length = 1131 Score = 68.6 bits (166), Expect = 2e-10 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 10/63 (15%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEK-DSSAPSPPPPPPPP-------PPPRPPPPG--GGGGPPAPRD 42 +S+ P P PPPP+ + ++SAP PPPPPPPP PPP PPPPG GG PP P Sbjct: 610 KSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPP 669 Query: 41 IGG 33 GG Sbjct: 670 PGG 672 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/93 (36%), Positives = 39/93 (41%), Gaps = 3/93 (3%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P P S + V P P P+V + + AP P PPPP Sbjct: 602 PPPPPPSAKSQVPPPPPPPPSVP----------------KSTNNSAPPPPPPPPPPPGGK 645 Query: 137 SSAPSPPPPPPPPP---PPRPPPPGGGGGPPAP 48 + AP PPPPPP PP PPPP GG PP P Sbjct: 646 TGAPPPPPPPPGAKAGGPPPPPPPPGGKAPPLP 678 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/67 (43%), Positives = 30/67 (44%), Gaps = 15/67 (22%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP---------------PPPRPPPPGG 69 VQ +A P PPPP SA S PPPPPP PPP PPPPGG Sbjct: 585 VQAAPQKAAPPPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGG 644 Query: 68 GGGPPAP 48 G P P Sbjct: 645 KTGAPPP 651 [24][TOP] >UniRef100_C6HGV1 Cytokinesis protein SepA/Bni1 n=1 Tax=Ajellomyces capsulatus H143 RepID=C6HGV1_AJECH Length = 1711 Score = 68.6 bits (166), Expect = 2e-10 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPGGGGGPPAP 48 AP P PPPP S P PPPPPPPPP PP PPPPG GG PP P Sbjct: 974 APPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPP 1023 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 9/53 (16%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAP 48 P P PPPP AP PPPPPP PPPPP PPPP G GGPP P Sbjct: 958 PGPPPPPPPPPPPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPP 1010 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/56 (48%), Positives = 28/56 (50%), Gaps = 7/56 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAPRDIGG 33 P P PPPP P PPPPPP PPPPP PP GG PP P +GG Sbjct: 963 PPPPPPPPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGG 1018 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 P PPPP P PPPPPP PPPPP PP G GG PP P Sbjct: 992 PPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPP 1037 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAPRDIGG 33 P P PPPP P PPPP PPPPPPP PGG PP +GG Sbjct: 992 PPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPPGASMGG 1044 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/85 (35%), Positives = 34/85 (40%), Gaps = 9/85 (10%) Frame = -3 Query: 275 RPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPP----- 111 RP P +L SR + D + A P + P PPPP Sbjct: 911 RPRMNPEQATGLLGEIASRVQKIDDSDDEKDGEKDAIEKPKVEDAVPPGPPPPPPPPPPP 970 Query: 110 ----PPPPPPPRPPPPGGGGGPPAP 48 PPPPPPP PPPP G GPP P Sbjct: 971 GVGAPPPPPPPPPPPPPGISGPPPP 995 [25][TOP] >UniRef100_C0NZQ8 Cytokinesis protein SepA/Bni1 n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NZQ8_AJECG Length = 1741 Score = 68.6 bits (166), Expect = 2e-10 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPGGGGGPPAP 48 AP P PPPP S P PPPPPPPPP PP PPPPG GG PP P Sbjct: 1004 APPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPP 1053 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 9/53 (16%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAP 48 P P PPPP AP PPPPPP PPPPP PPPP G GGPP P Sbjct: 988 PGPPPPPPPPPPPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPP 1040 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/56 (48%), Positives = 28/56 (50%), Gaps = 7/56 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAPRDIGG 33 P P PPPP P PPPPPP PPPPP PP GG PP P +GG Sbjct: 993 PPPPPPPPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGG 1048 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 P PPPP P PPPPPP PPPPP PP G GG PP P Sbjct: 1022 PPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPP 1067 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAPRDIGG 33 P P PPPP P PPPP PPPPPPP PGG PP +GG Sbjct: 1022 PPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPPGASMGG 1074 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/85 (35%), Positives = 34/85 (40%), Gaps = 9/85 (10%) Frame = -3 Query: 275 RPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPP----- 111 RP P +L SR + D + A P + P PPPP Sbjct: 941 RPRMNPEQATGLLGEIASRVQKIDDSDDEKDGEKDAIEKPKVEDAVPPGPPPPPPPPPPP 1000 Query: 110 ----PPPPPPPRPPPPGGGGGPPAP 48 PPPPPPP PPPP G GPP P Sbjct: 1001 GVGAPPPPPPPPPPPPPGISGPPPP 1025 [26][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 68.2 bits (165), Expect = 3e-10 Identities = 29/51 (56%), Positives = 29/51 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGVD 27 P P PPPP P PPPPPPPPPPP PPPP PP P GGVD Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVD 85 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/49 (55%), Positives = 27/49 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 P P PPPP P PPPPPPPPPPP PPPP PP P GG Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGG 81 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/49 (55%), Positives = 27/49 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 P P PPPP P PPPPPPPPPPP PPPP PP P GG Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGG 82 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 [27][TOP] >UniRef100_A1CMR3 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus clavatus RepID=A1CMR3_ASPCL Length = 642 Score = 68.2 bits (165), Expect = 3e-10 Identities = 29/49 (59%), Positives = 30/49 (61%), Gaps = 4/49 (8%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 48 A P PPPP +S P PPPPPPPP PPPRPPPP GGPP P Sbjct: 475 AVPPPPPPPPPPPPSASIPPPPPPPPPPVSHVPPPRPPPPPSSGGPPPP 523 Score = 60.1 bits (144), Expect = 8e-08 Identities = 41/100 (41%), Positives = 44/100 (44%), Gaps = 6/100 (6%) Frame = -3 Query: 329 RSRLPSGVPVSICASVSPR-PTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPA 153 RS P G P PR P P + V TS A R+ SP PPPP Sbjct: 406 RSPAPPGPPPP-----PPRSPATPPQLPPKVPHAPTSAAGPPPPPPARNPISSPPPPPPV 460 Query: 152 AAEKDSSAPSPPPP-----PPPPPPPRPPPPGGGGGPPAP 48 A +S P PPPP PPPPPPP PPPP PP P Sbjct: 461 PA---ASRPIPPPPAASAVPPPPPPPPPPPPSASIPPPPP 497 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/56 (50%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPGGGGGPPAPRDIG 36 S P P PPPP + S P PPPPPPP P PP PPPP GG P P+ G Sbjct: 504 SHVPPPRPPPPPS----SGGPPPPPPPPPAPGGFAPPPPPPPPPGGAAPHLPQPAG 555 [28][TOP] >UniRef100_C0SFQ9 Putative uncharacterized protein n=1 Tax=Paracoccidioides brasiliensis Pb03 RepID=C0SFQ9_PARBP Length = 675 Score = 67.8 bits (164), Expect = 4e-10 Identities = 38/102 (37%), Positives = 45/102 (44%), Gaps = 11/102 (10%) Frame = -3 Query: 320 LPSGVPVSICASVS-------PRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPP 162 LP VP VS PRP +P+ + + R + AP P PP Sbjct: 435 LPHKVPHGTSGPVSAPPPSPPPRPHVSPSAIPQPPPASAPPPARQPPPPVSAPAPPPPPP 494 Query: 161 PPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAP 48 PP ++ P PPPPPPPPP PP PPPP G PP P Sbjct: 495 PPPGPAPSTAVPPPPPPPPPPPSGSAPPPPPPPSGSAPPPPP 536 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/60 (46%), Positives = 30/60 (50%), Gaps = 12/60 (20%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP------------PPRPPPPGGGGGPPAPRDIG 36 P+ APPP SAP+PPPPPPPPP PP PPPP G PP P G Sbjct: 470 PASAPPPARQPPPPVSAPAPPPPPPPPPGPAPSTAVPPPPPPPPPPPSGSAPPPPPPPSG 529 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/49 (53%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAP-----PPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PAP PPP + SS P PPPP PPP PPPP G GG P P Sbjct: 536 PHPAPSASHSPPPPLSAPSSSPPPPPPPASGVPPPPPPPPAGSGGAPLP 584 [29][TOP] >UniRef100_UPI0000162516 peroxisomal membrane 22 kDa family protein n=1 Tax=Arabidopsis thaliana RepID=UPI0000162516 Length = 288 Score = 67.4 bits (163), Expect = 5e-10 Identities = 49/118 (41%), Positives = 60/118 (50%) Frame = +1 Query: 43 SRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKAL 222 S G+GG GG GGGGG GGGGG+G+D G G LL SW Y L Sbjct: 81 SGGSGGL-----GGSGGGGGGSGGGGGDGSD----------GKGKKWSLL-SW--YQALL 122 Query: 223 DVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 +P+ TKA+TA +L +GD + Q LT +LD R +F L L GP H WY Sbjct: 123 SNSPVLTKAVTAALLNLVGDLICQ-LTINKTSSLDKKRTLTFTFLGLGLVGPTLHFWY 179 [30][TOP] >UniRef100_Q93Z42 AT5g19750/T29J13_170 n=1 Tax=Arabidopsis thaliana RepID=Q93Z42_ARATH Length = 288 Score = 67.4 bits (163), Expect = 5e-10 Identities = 49/118 (41%), Positives = 60/118 (50%) Frame = +1 Query: 43 SRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKAL 222 S G+GG GG GGGGG GGGGG+G+D G G LL SW Y L Sbjct: 81 SGGSGGL-----GGSGGGGGGSGGGGGDGSD----------GKGKKWSLL-SW--YQALL 122 Query: 223 DVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 +P+ TKA+TA +L +GD + Q LT +LD R +F L L GP H WY Sbjct: 123 SNSPVLTKAVTAALLNLVGDLICQ-LTINKTSSLDKKRTLTFTFLGLGLVGPTLHFWY 179 [31][TOP] >UniRef100_B4NYG5 GE14785 n=1 Tax=Drosophila yakuba RepID=B4NYG5_DROYA Length = 1458 Score = 67.4 bits (163), Expect = 5e-10 Identities = 29/57 (50%), Positives = 33/57 (57%), Gaps = 6/57 (10%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 48 ++ + AP P PPPP + AP PPPPPPP PPPP PPPPG G PP P Sbjct: 880 EKPHASAPPPPPPPPPPPAFVAPAPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 936 Score = 63.2 bits (152), Expect = 9e-09 Identities = 28/52 (53%), Positives = 30/52 (57%), Gaps = 7/52 (13%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPP-------PPPPPPRPPPPGGGGGPPAP 48 AP+P PPPP + AP PPPPP PPPPPP P P GGG PP P Sbjct: 901 APAPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPAPEGGGAIPPPP 952 [32][TOP] >UniRef100_A9V6E2 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V6E2_MONBE Length = 2389 Score = 67.4 bits (163), Expect = 5e-10 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPPAP 48 P P PPPP A S P PPPPPP PPPPP PPPPGG GPP P Sbjct: 1217 PPPPPPPPGGA---SGPPPPPPPPPPGGASGPPPPPPPPPPGGASGPPPP 1263 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 7/48 (14%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGG 60 A P PPPP +S P PPPPPP PPPPP PPPPG G Sbjct: 1227 ASGPPPPPPPPPPGGASGPPPPPPPPPPGGASGPPPPPPPPPPGASSG 1274 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 8/48 (16%) Frame = -3 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGG--------GPPAP 48 PPPP SSAPS PPPP PP PP PPPPG GG PP P Sbjct: 1326 PPPPPLPPTGSSAPSAPPPPGPPVPPGPPPPGVGGADVESMSRAPPPP 1373 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/64 (45%), Positives = 32/64 (50%), Gaps = 8/64 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP--------PPPPRPPPPGGGGGPPAPRDIGGVDE 24 P P PPPP ++AP PPPP PP PPPP PP P G P P +GG D Sbjct: 1308 PPPPPPPPPPPVTGNAAPPPPPPLPPTGSSAPSAPPPPGPPVPPG----PPPPGVGGADV 1363 Query: 23 ERNS 12 E S Sbjct: 1364 ESMS 1367 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/33 (66%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = -3 Query: 128 PSPPPPPP------PPPPPRPPPPGGGGGPPAP 48 P PPPPPP PPPPP PPPPGG GPP P Sbjct: 1216 PPPPPPPPPGGASGPPPPPPPPPPGGASGPPPP 1248 [33][TOP] >UniRef100_A9V1R7 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V1R7_MONBE Length = 1099 Score = 67.4 bits (163), Expect = 5e-10 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 48 A +P PPPP AP PPPPPPP PPPP PPPPGG GG P P Sbjct: 396 ASAPPPPPPPPPGVSGGAPPPPPPPPPGGSGGAPPPPPPPPPGGSGGAPPP 446 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/63 (44%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGGPPAPRDIGGVDEE 21 AP P PPPP + P PPPPP PPPPPP P PG G PP P + G Sbjct: 413 APPPPPPPPPGGSGGAPPPPPPPPPGGSGGAPPPPPPPPGVPGAPGAPPPPPGVPGAPSM 472 Query: 20 RNS 12 N+ Sbjct: 473 ANA 475 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/64 (40%), Positives = 31/64 (48%), Gaps = 11/64 (17%) Frame = -3 Query: 206 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP-----------PPPPRPPPPGGGGG 60 DV +AP P PPA +++ + PPPP PPPP PPPPGG GG Sbjct: 368 DVFAEPPKAPMPPTAPPAPGGPEATGTTASAPPPPPPPPPGVSGGAPPPPPPPPPGGSGG 427 Query: 59 PPAP 48 P P Sbjct: 428 APPP 431 [34][TOP] >UniRef100_A0D550 Chromosome undetermined scaffold_38, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D550_PARTE Length = 493 Score = 67.4 bits (163), Expect = 5e-10 Identities = 29/50 (58%), Positives = 32/50 (64%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPA 51 Q++ AP P PPPP K + P PPPPPPPPPPP PPPPG PPA Sbjct: 357 QQQNKSAPPPPPPPPPPPPK-GAPPPPPPPPPPPPPPGPPPPGQLPPPPA 405 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Frame = -3 Query: 164 PPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPPAP 48 PPP + S+ P PPPPPP PPPPP PPPP GPP P Sbjct: 353 PPPQQQQNKSAPPPPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPP 397 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/39 (58%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPP--RPPPPGG 69 P P PPPP A P PPPPPP PPPP PPPP G Sbjct: 368 PPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPPAG 406 [35][TOP] >UniRef100_Q7SF15 WASP-like pretein las17p n=1 Tax=Neurospora crassa RepID=Q7SF15_NEUCR Length = 636 Score = 67.4 bits (163), Expect = 5e-10 Identities = 42/118 (35%), Positives = 49/118 (41%), Gaps = 6/118 (5%) Frame = -3 Query: 383 PTGPWRTSTNAAKLNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*D 204 P P ++NA ++ P P+ ++ P P PA A L A Sbjct: 438 PQAPPLPTSNAPPPPPLPATQAPPPPPLPATSAPPPPPPAPPAPPAPPLPAA-------- 489 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 48 AP P PP P AP PPPPPPP PPPP PPPPGG PPAP Sbjct: 490 ------HAPPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPPPGGMPPPPAP 541 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/62 (53%), Positives = 35/62 (56%), Gaps = 12/62 (19%) Frame = -3 Query: 179 PSPAPP-PPAAAEKDSSAPSPPPPPPP--------PPPPRPPPPGGGGG---PPAPRDIG 36 P PAPP PPA + AP PPPP PP PPPP PPPPGG GG PP P G Sbjct: 474 PPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPPPG 533 Query: 35 GV 30 G+ Sbjct: 534 GM 535 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/51 (47%), Positives = 26/51 (50%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGV 30 AP P PP P A + PPPPPP PP P P GG PP P GG+ Sbjct: 470 APPPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGGM 520 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/68 (42%), Positives = 34/68 (50%), Gaps = 15/68 (22%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPP---------PPPPPPRPPPPGGGGG------PP 54 ++AP P PP PA + P+PP PP PPPPPP PP P GG PP Sbjct: 457 TQAPPP-PPLPATSAPPPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPP 515 Query: 53 APRDIGGV 30 P +GGV Sbjct: 516 PPGGMGGV 523 [36][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 67.0 bits (162), Expect = 6e-10 Identities = 43/111 (38%), Positives = 49/111 (44%), Gaps = 3/111 (2%) Frame = -3 Query: 374 PWRTSTNAAKLNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQE 195 P +T LN RGR L +PV+ V P P T + + L +TS Sbjct: 316 PGQTILVEVSLN-RGREFLAHTIPVNTSNCVPP-PVTTTSTLPTTLTTSTSPV------- 366 Query: 194 RRSRAPSPAPPPPAAAEKDSSAPSP---PPPPPPPPPPRPPPPGGGGGPPA 51 P P PPPP P P PPPPPPPPPPRPPPP PPA Sbjct: 367 --PTTPLPPPPPPLPPPPPRPVPPPAPPPPPPPPPPPPRPPPPPAIVRPPA 415 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 E++ + P P PPP +PPPPPPPPPPP PPPP PP Sbjct: 468 EKKEKPPPPVPPP-----------TPPPPPPPPPPPPPPPPPPVKAPP 504 [37][TOP] >UniRef100_UPI00016E98C2 UPI00016E98C2 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E98C2 Length = 500 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/48 (62%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPP-PGGGGGPPAP 48 SRAP APPPP + SAP PPPPP PPPP PP P GGG PP P Sbjct: 324 SRAPISAPPPPPPSRPGISAPPPPPPPSRPPPPPPPSIPSGGGAPPPP 371 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/49 (55%), Positives = 28/49 (57%), Gaps = 9/49 (18%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPP---------GGGGGPP 54 P PPPP + AP PPPPPPPPPPP PPPP GG GPP Sbjct: 353 PPPPPPPSIPSGGGAP-PPPPPPPPPPPGPPPPAPPPTSDANGGDAGPP 400 [38][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP A AP PPPPP PPPPP PPPP PPAP Sbjct: 625 PPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAP 668 Score = 66.6 bits (161), Expect = 8e-10 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P+PAPPP A + P+PPPPPPPPPPP PPPP PP P Sbjct: 605 PAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPP 648 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSS-APSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PAPPPP A + AP P PPPPPPPPP PPPP PPAP Sbjct: 646 PPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAP 690 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP--PPPPPRPPPPGGGGGPPAP 48 AP PAP PPA A + P PPPPPP PPPPP PPPP PP P Sbjct: 608 APPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPP 654 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP PAPPPP AP PPP PPPPPPP PPPP PPAP Sbjct: 619 APPPAPPPPPPPPPPP-APPPPPAPPPPPPPAPPPPPAPPPPPAP 662 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-PPPPPRPPPPGGGGGPPA 51 P PAPPPP A + P PPPPPP PPPPP PPPP PPA Sbjct: 652 PPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPPPPA 695 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PAP PP A + AP P PPPPPPPPP P PP PP P Sbjct: 603 PPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPP 646 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 ++P P PPP A + P+P PPP PPPPP PPPP PPAP Sbjct: 597 QSPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAP 642 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PAPPPP A P+PPPPP PPPPP P PP PP P Sbjct: 632 PPPAPPPPPAPPPPPP-PAPPPPPAPPPPPAPAPPPAPPPPPPP 674 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-PPPRPPPPGGGGGPPAP 48 P+P PPPP A + P PP P PPP PPP PPPP PPAP Sbjct: 640 PAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAP 684 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 6/58 (10%) Frame = -3 Query: 203 VQERRSRAP-SPAPPPPAAAEKDSS----APSPPPPPPPPPPPRPPP-PGGGGGPPAP 48 +Q S P SP PPPP A + AP+PPP PPPPPPP PPP P PP P Sbjct: 588 IQRAESMMPQSPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPP 645 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP-PPRPPPPGGGGGPPAP 48 P P PPPPA + P PPP PPPPP PP PP P PP P Sbjct: 627 PPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPP 671 [39][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/51 (52%), Positives = 29/51 (56%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 Q R + +P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 38 QSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/52 (50%), Positives = 29/52 (55%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +Q+ R+ P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 36 LQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 44 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP P+ Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP P P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPADP 105 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPA 51 P P PPPP P PPPPPPPPPPP PPP PP+ Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPADPPS 107 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PP ++ +A SPPPPPPPPPPP PPPP PP P Sbjct: 28 PIFPPSLFLQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPP 69 [40][TOP] >UniRef100_A0DEW5 Chromosome undetermined scaffold_48, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0DEW5_PARTE Length = 1120 Score = 67.0 bits (162), Expect = 6e-10 Identities = 31/56 (55%), Positives = 34/56 (60%), Gaps = 9/56 (16%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPG--GGGGPPAPRDIGG 33 PAPPPP A+ ++ P PPPPPP PPPPP PPPPG GG PP P GG Sbjct: 606 PAPPPPPGAKTNAPPPPPPPPPPPGAKTGAPPPPPPPPPPGAKAGGPPPPPPPPGG 661 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/53 (52%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 48 ++ AP P PPPP + AP PPPPPPPP PP PPPP GG PP P Sbjct: 615 KTNAPPPPPPPPPPPGAKTGAPPPPPPPPPPGAKAGGPPPPPPPPGGKAPPLP 667 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = -3 Query: 170 APPPPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGGPPAP 48 APPPP S P+PPPPP PPPPPP PPPPG G P P Sbjct: 592 APPPPPPPSLQSQVPAPPPPPGAKTNAPPPPPPPPPPPGAKTGAPPP 638 [41][TOP] >UniRef100_Q1E467 Putative uncharacterized protein n=1 Tax=Coccidioides immitis RepID=Q1E467_COCIM Length = 1705 Score = 67.0 bits (162), Expect = 6e-10 Identities = 36/86 (41%), Positives = 43/86 (50%), Gaps = 10/86 (11%) Frame = -3 Query: 275 RPTNTPAVMALVLMGATSRALR*DVQERRSRAP----SPAPPPPAAAEKDSSAPSPPPPP 108 RP P +L S+A + D + P SPAP PAA ++ + P PPPPP Sbjct: 927 RPRMNPEQATGLLNELASKAEKVDQTDEEEETPKPDSSPAPEKPAAKQEGFNGPPPPPPP 986 Query: 107 P------PPPPPRPPPPGGGGGPPAP 48 P PPPPP PP PG GGPP P Sbjct: 987 PLPGFSGPPPPPPPPLPGFSGGPPPP 1012 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/51 (52%), Positives = 27/51 (52%), Gaps = 7/51 (13%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAP 48 P P PPPP S P PPPPPP PPPPP PP PG GG P P Sbjct: 980 PPPPPPPPLPG---FSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPP 1027 [42][TOP] >UniRef100_A1DL75 Actin associated protein Wsp1, putative n=1 Tax=Neosartorya fischeri NRRL 181 RepID=A1DL75_NEOFI Length = 638 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/52 (55%), Positives = 31/52 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGVDE 24 P P PPPPA SAP PPPPPP P PPPP GG PP P+ GG D+ Sbjct: 511 PPPPPPPPAPG---GSAPPPPPPPPGASAPPPPPPAGGAAPPLPKPTGGRDD 559 Score = 57.8 bits (138), Expect = 4e-07 Identities = 42/117 (35%), Positives = 46/117 (39%), Gaps = 23/117 (19%) Frame = -3 Query: 329 RSRLPSGVPVSICASVSPR-PTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPA 153 RS P G P PR P P + V TS A R+ P PAPPP Sbjct: 402 RSSAPPGPPPP-----PPRSPATPPQLPPKVPYAPTSAAGPPPPPPARNPVPPPAPPPVP 456 Query: 152 AAEK------------------DSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 AA + +S P PPPPPPP PP P PPPP GPP P Sbjct: 457 AASRPTPPPPATSAVPPPPPPPSASVPPPPPPPPPASAGPPAPPPPPPPSIAGPPPP 513 [43][TOP] >UniRef100_C7BGM9 Formin 2B n=1 Tax=Physcomitrella patens RepID=C7BGM9_PHYPA Length = 1329 Score = 66.6 bits (161), Expect = 8e-10 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 14/59 (23%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPPAP 48 AP P PPPP +SSAP+PPPPPPPP PPP PPPP GG G PAP Sbjct: 523 APPPPPPPPFGGRPNSSAPAPPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAP 581 Score = 66.2 bits (160), Expect = 1e-09 Identities = 44/127 (34%), Positives = 61/127 (48%), Gaps = 18/127 (14%) Frame = -3 Query: 374 PWRTSTNAAKLNKRG---RSRLPS-GVPVSICASVSPRPTNTPAVMALVLMGATSRALR* 207 P RT++ L+K R++ PS G + + + TN +++ + + + AL Sbjct: 436 PSRTTSFDTSLHKPSILSRTQSPSMGRIEGVKNDSAGQTTNPVPILSAIDRSSGATALSA 495 Query: 206 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG-- 66 + P P PPPP +SSAP+PPPPPPPP PPP PPPP GG Sbjct: 496 LAAPSPAPPPPPPPPPPFGGRPNSSAPAPPPPPPPPFGGRPNSSAPAPPPPPPPPFGGRP 555 Query: 65 -GGPPAP 48 G PAP Sbjct: 556 NSGAPAP 562 Score = 65.5 bits (158), Expect = 2e-09 Identities = 34/63 (53%), Positives = 34/63 (53%), Gaps = 10/63 (15%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGG---GGGPPAPRD 42 RS AP P PPPP D PPPPPPPP PPP PPPPGG GG PP P Sbjct: 789 RSDAPPPPPPPPG----DRGVGGPPPPPPPPGAPRPGGPPPPPPPPGGRGVGGPPPPPPP 844 Query: 41 IGG 33 GG Sbjct: 845 PGG 847 Score = 65.1 bits (157), Expect = 2e-09 Identities = 31/59 (52%), Positives = 33/59 (55%), Gaps = 14/59 (23%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPPAP 48 AP P PPPP +S AP+PPPPPPPP PPP PPPP GG G PAP Sbjct: 542 APPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAP 600 Score = 65.1 bits (157), Expect = 2e-09 Identities = 31/59 (52%), Positives = 33/59 (55%), Gaps = 14/59 (23%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPPAP 48 AP P PPPP +S AP+PPPPPPPP PPP PPPP GG G PAP Sbjct: 561 APPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAP 619 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/72 (41%), Positives = 33/72 (45%), Gaps = 27/72 (37%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP---------------------------PPPRP 84 AP P PPPP+ +S AP+PPPPPPPP PPP P Sbjct: 712 APPPPPPPPSGGRPNSGAPAPPPPPPPPSGGRPNSGAPAPPPPPFGGRPNSGAPGPPPPP 771 Query: 83 PPPGGGGGPPAP 48 PPPG G PP P Sbjct: 772 PPPGKSGAPPPP 783 Score = 64.3 bits (155), Expect = 4e-09 Identities = 32/62 (51%), Positives = 37/62 (59%), Gaps = 15/62 (24%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEK-DSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPP 54 S AP+P PPPP + + +S AP+PPPPPPPP PPP PPPP GG G P Sbjct: 690 SGAPAPPPPPPPSGGRPNSGAPAPPPPPPPPSGGRPNSGAPAPPPPPPPPSGGRPNSGAP 749 Query: 53 AP 48 AP Sbjct: 750 AP 751 Score = 63.5 bits (153), Expect = 7e-09 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 13/58 (22%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGG--GGGPPAP 48 AP P PPPP +S AP+PPPPPPPP PPP PPP GG G PAP Sbjct: 656 APPPPPPPPFGGRPNSGAPAPPPPPPPPFGSRPNSGAPAPPPPPPPSGGRPNSGAPAP 713 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 14/59 (23%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGG---GGGPPAP 48 AP P PPPP +S AP+PPPPPPPP PPP PPPP G G PAP Sbjct: 637 APPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAPPPPPPPPFGSRPNSGAPAP 695 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/52 (57%), Positives = 31/52 (59%), Gaps = 5/52 (9%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAP 48 S AP P PPPP + S AP PPPPPP PPPPP PP G GGPP P Sbjct: 762 SGAPGPPPPPPPPGK--SGAPPPPPPPPGRSDAPPPPPPPPGDRGVGGPPPP 811 Score = 62.0 bits (149), Expect = 2e-08 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 14/59 (23%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP-----------PPPPPRPPPPGGG---GGPPAP 48 AP P PPPP +S AP+PPPPPP P PPP PPPP GG G PAP Sbjct: 599 APPPPPPPPFGGRPNSGAPAPPPPPPLPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAP 657 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/63 (50%), Positives = 35/63 (55%), Gaps = 16/63 (25%) Frame = -3 Query: 188 SRAPSPAPPPPA--AAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGP 57 S AP+P PPPP +S AP+PPPPPPPP PPP PPPP GG G Sbjct: 614 SGAPAPPPPPPLPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGA 673 Query: 56 PAP 48 PAP Sbjct: 674 PAP 676 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 14/59 (23%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPPAP 48 AP P PPPP +S AP+PPPPPPPP PPP PP P GG G PAP Sbjct: 580 APPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAPPPPPPLPFGGRPNSGAPAP 638 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/63 (50%), Positives = 35/63 (55%), Gaps = 11/63 (17%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPP-PPPPP----PPPPRPPPPGGGGGPPAP------RD 42 S AP+P PPPP +S AP PP PPPPP PPP PPPPG PP P R Sbjct: 746 SGAPAP-PPPPFGGRPNSGAPGPPPPPPPPGKSGAPPPPPPPPGRSDAPPPPPPPPGDRG 804 Query: 41 IGG 33 +GG Sbjct: 805 VGG 807 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/59 (50%), Positives = 33/59 (55%), Gaps = 14/59 (23%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPPAP 48 AP P PPPP + +S AP+PPPPPP P PPP PPPP GG G PAP Sbjct: 675 APPPPPPPPFGSRPNSGAPAPPPPPP-PSGGRPNSGAPAPPPPPPPPSGGRPNSGAPAP 732 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/70 (42%), Positives = 31/70 (44%), Gaps = 20/70 (28%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAP-----------SPPPPPPPP-------PPPRPPPPG 72 +R P P PPPP A P PPPPPPPP P P PPPPG Sbjct: 802 DRGVGGPPPPPPPPGAPRPGGPPPPPPPPGGRGVGGPPPPPPPPGGARPGGPLPPPPPPG 861 Query: 71 --GGGGPPAP 48 G GGPP P Sbjct: 862 GKGPGGPPPP 871 [44][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/46 (58%), Positives = 27/46 (58%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 42 P P PPPP P PPPPPPPPPPP PPPP PP PRD Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRD 49 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/46 (56%), Positives = 26/46 (56%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 RVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/50 (52%), Positives = 27/50 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGV 30 P P PPPP P PPPPPPPPPPP PPPP PR + GV Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLSGV 61 [45][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP G PP P Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP G PP P Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPP 969 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP G PP P Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPP 970 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/52 (51%), Positives = 28/52 (53%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 V E + P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 847 VCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/51 (50%), Positives = 28/51 (54%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +E + P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 849 EEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP G P P Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP P AP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAP 965 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGG---GGPPAP 48 P P PPPP P PPPPPPPPPP PPPP G PP P Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPP 980 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/39 (56%), Positives = 25/39 (64%) Frame = -3 Query: 164 PPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P E+ ++ P PPPPPPPPPPP PPPP PP P Sbjct: 843 PAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPP 881 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/40 (55%), Positives = 23/40 (57%) Frame = -3 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P E + P PPPPPPPPPPP PPPP PP P Sbjct: 843 PAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 882 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPP--PPGGGGGPPA 51 P P PPPP P PPPPPP PPP PP PPG PPA Sbjct: 938 PPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPPA 982 [46][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/52 (55%), Positives = 32/52 (61%), Gaps = 3/52 (5%) Frame = -3 Query: 194 RRSRAPSPAPPPPAAAEKDSSAP---SPPPPPPPPPPPRPPPPGGGGGPPAP 48 R S+ P P PPPP + S P SPPPPPPPPPPP PPPP PP+P Sbjct: 200 RASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 251 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+P PP + S P PPPPPPPP PP PPPP PP P Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP PSPPPPPPPPPPP PPPP PP P Sbjct: 225 PSPPPPPPPPPP-----PSPPPPPPPPPPPSPPPP---PSPPPP 260 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/47 (55%), Positives = 28/47 (59%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S +P P+PPPP S P PPPPPPP PPP PPPP PP P Sbjct: 214 SPSPPPSPPPPP-----SPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/49 (53%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPA 51 S P P+PPPP S P PPPPPP PPPPP PPPP PP+ Sbjct: 220 SPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPS 268 [47][TOP] >UniRef100_C7J8C9 Os11g0105750 protein (Fragment) n=2 Tax=Oryza sativa Japonica Group RepID=C7J8C9_ORYSJ Length = 918 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = -3 Query: 206 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 ++++R R P P PP P+A +SA SPPPP PP PP PPPPG GGPP P Sbjct: 588 NIEKRAPRVPRP-PPAPSATANTASALSPPPPRPPGAPPPPPPPGKPGGPPPP 639 [48][TOP] >UniRef100_B8BNT3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BNT3_ORYSI Length = 930 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = -3 Query: 206 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 ++++R R P P PP P+A +SA SPPPP PP PP PPPPG GGPP P Sbjct: 588 NIEKRAPRVPRP-PPAPSATANTASALSPPPPRPPGAPPPPPPPGKPGGPPPP 639 [49][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 S + P PPPP SS+PSPPPPPPPPPPP PPPP PP Sbjct: 1517 SNSSPPPPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPPPPPP 1561 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/63 (46%), Positives = 33/63 (52%) Frame = -3 Query: 233 GATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 G + R D S + S PPPP SS+ SP PPPPPPPPP PPPP PP Sbjct: 1500 GFSGSGPRSDSASAGSGSNSSPPPPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPPPP 1559 Query: 53 APR 45 P+ Sbjct: 1560 PPK 1562 [50][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 9/53 (16%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP---------PPRPPPPGGGGGPPAP 48 P P PPPP K P PPPPPPPPP PP PPPPG GGG P P Sbjct: 1049 PPPPPPPPPPGGKGMGVPPPPPPPPPPPGFGGGMPPPPPPPPPPGFGGGMPPP 1101 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/64 (50%), Positives = 32/64 (50%), Gaps = 15/64 (23%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPP---------PPPPPPRPPPPGGGGG------PPAPR 45 P P PPPP A P PPPPP PPPPPP PPPPG GGG PP P Sbjct: 1033 PPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPPPPPPPGFGGGMPPPPPPPPPP 1092 Query: 44 DIGG 33 GG Sbjct: 1093 GFGG 1096 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 6/55 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGPPAPRDIGG 33 P P PPPP P PPPPPPPP PPP PPPPG G PP P GG Sbjct: 1066 PPPPPPPPPPPGFGGGMPPPPPPPPPPGFGGGMPPPPPPPPGRFGAPPPPPPPGG 1120 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/69 (44%), Positives = 33/69 (47%), Gaps = 14/69 (20%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPPPRPPPPGGGG--------G 60 E + +PAPPPP P PPP PPPPPPPP PPPPGG G Sbjct: 1012 ESKKPVSAPAPPPPPPPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPP 1071 Query: 59 PPAPRDIGG 33 PP P GG Sbjct: 1072 PPPPPGFGG 1080 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/50 (54%), Positives = 28/50 (56%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 E S+ P AP PP PPPPPPPPPPP PPPPG G PP P Sbjct: 1010 ESESKKPVSAPAPPP----------PPPPPPPPPPPPPPPPGAIGVPPPP 1049 [51][TOP] >UniRef100_A9RI20 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RI20_PHYPA Length = 334 Score = 65.9 bits (159), Expect = 1e-09 Identities = 41/110 (37%), Positives = 55/110 (50%), Gaps = 1/110 (0%) Frame = +1 Query: 76 GGGGRGGG-GGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAI 252 G GG G G GG GG GG+ D GAGL W Y + LD P+ K++ Sbjct: 95 GDGGNGDGIGGSGGDGGDNEDGDDKNQPLAPGAGL-------WFRYTELLDRHPLIVKSL 147 Query: 253 TAGVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWYNL 402 TAG+L + D + Q+L + +DL RL SF A L + GP H W+ + Sbjct: 148 TAGLLNAIADLVCQVLV-ERVSAVDLRRLLSFVAIGLFMSGPGLHYWFGI 196 [52][TOP] >UniRef100_C5JYR8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JYR8_AJEDS Length = 1704 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/54 (55%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAPRDIGGV 30 AP P PPPP P PPPPPP PPPP PPPPG GG PP P GV Sbjct: 943 APPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGV 996 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 P PPPP AP PPPPPPP PPPP PPPPG GG PP P Sbjct: 958 PPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPP 1003 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAPRDIGGV 30 P P PPPP A P PPPPPPP PPPP PPPPG G PP P G+ Sbjct: 901 PPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGI 954 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/48 (58%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPP PPPP PPPPG GG PP P Sbjct: 914 PLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGIGGPPPPP 961 Score = 64.3 bits (155), Expect = 4e-09 Identities = 32/57 (56%), Positives = 33/57 (57%), Gaps = 7/57 (12%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGG---GPPAPRDIGG 33 AP P PPPP A P PPPPPPP PPPP PPPPG GG PP P +GG Sbjct: 972 APPPPPPPPPGA----GGPPPPPPPPPGVGGPPPPPPPPPGMGGPPLPPPPPPGMGG 1024 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/49 (55%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPP PPP PPPP G G PP P Sbjct: 899 PKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPP 947 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/50 (56%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 48 P P PPPP AP PPPPPPP PPPP PPPP G G PP P Sbjct: 932 PPPPPPPPGVG-----APPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPP 976 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP----PPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPP PPPPPPPP PPPPG G PP P Sbjct: 931 PPPPPPPPPGVGAPPPPPPPPPGIGGPPPPPPPP-PPPPGVGAPPPPP 977 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/55 (49%), Positives = 27/55 (49%), Gaps = 11/55 (20%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPP-------PPPPPP----PPPRPPPPGGGGGPPAP 48 P P PPPP P PP PPPPPP PPP PPPPG G PP P Sbjct: 987 PPPPPPPPGVGGPPPPPPPPPGMGGPPLPPPPPPGMGGPPPPPPPPGMRGPPPPP 1041 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP--PPPPPRPPPPGGGGGPPAP 48 A P PPPP P PPPPP PP P PPPPG GG PP P Sbjct: 983 AGGPPPPPPPPPGVGGPPPPPPPPPGMGGPPLPPPPPPGMGGPPPPP 1029 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/82 (37%), Positives = 34/82 (41%), Gaps = 6/82 (7%) Frame = -3 Query: 275 RPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPP--- 105 RP P +L SR + D + P P K P PPPPPP Sbjct: 856 RPRMNPMQATGLLGEIASRVQKIDESDDEKDESKKPKPEPTTTPKP---PPPPPPPPAVG 912 Query: 104 ---PPPPPRPPPPGGGGGPPAP 48 PPPPP PPPP G G PP P Sbjct: 913 GPLPPPPPPPPPPPGVGLPPPP 934 [53][TOP] >UniRef100_C5GLX8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GLX8_AJEDR Length = 1750 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/54 (55%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAPRDIGGV 30 AP P PPPP P PPPPPP PPPP PPPPG GG PP P GV Sbjct: 1015 APPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGV 1068 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 P PPPP AP PPPPPPP PPPP PPPPG GG PP P Sbjct: 1030 PPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPP 1075 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAPRDIGGV 30 P P PPPP A P PPPPPPP PPPP PPPPG G PP P G+ Sbjct: 973 PPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGI 1026 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/48 (58%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPP PPPP PPPPG GG PP P Sbjct: 986 PLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGIGGPPPPP 1033 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/49 (55%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPP PPP PPPP G G PP P Sbjct: 971 PKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPP 1019 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/50 (56%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 48 P P PPPP AP PPPPPPP PPPP PPPP G G PP P Sbjct: 1004 PPPPPPPPGVG-----APPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPP 1048 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP----PPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPP PPPPPPPP PPPPG G PP P Sbjct: 1003 PPPPPPPPPGVGAPPPPPPPPPGIGGPPPPPPPP-PPPPGVGAPPPPP 1049 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/53 (52%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAPRDIG 36 AP P PPPP A P PPPPPPP PPPP PPPP P A IG Sbjct: 1044 APPPPPPPPPGA----GGPPPPPPPPPGVGGPPPPPPPPPVNDPRPGAGSSIG 1092 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/82 (37%), Positives = 34/82 (41%), Gaps = 6/82 (7%) Frame = -3 Query: 275 RPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPP--- 105 RP P +L SR + D + P P K P PPPPPP Sbjct: 928 RPRMNPMQATGLLGEIASRVQKIDESDDEKDESKKPKPEPTTTPKP---PPPPPPPPAVG 984 Query: 104 ---PPPPPRPPPPGGGGGPPAP 48 PPPPP PPPP G G PP P Sbjct: 985 GPLPPPPPPPPPPPGVGLPPPP 1006 [54][TOP] >UniRef100_A6R7X5 Actin cytoskeleton-regulatory complex protein PAN1 n=1 Tax=Ajellomyces capsulatus NAm1 RepID=PAN1_AJECN Length = 1481 Score = 65.9 bits (159), Expect = 1e-09 Identities = 32/61 (52%), Positives = 35/61 (57%), Gaps = 8/61 (13%) Frame = -3 Query: 206 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGG--GGPPA 51 D Q+ S P P PPP A D+ +PPPPPPP PPPP PPPP GG GGPP Sbjct: 1368 DFQDAPSMPPPPPPPPVPAPFADAPPTAPPPPPPPAFSAAAPPPPPPPPPVGGAPGGPPP 1427 Query: 50 P 48 P Sbjct: 1428 P 1428 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/50 (50%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAPR 45 AP APPPP ++AP PPPPPPP P P PPPP G P P+ Sbjct: 1391 APPTAPPPPPPPAFSAAAPPPPPPPPPVGGAPGGPPPPPPPAGDAPAIPK 1440 [55][TOP] >UniRef100_UPI0000DD9D8A Os12g0127900 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD9D8A Length = 239 Score = 65.5 bits (158), Expect = 2e-09 Identities = 45/106 (42%), Positives = 51/106 (48%) Frame = +1 Query: 79 GGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITA 258 G GGGGGGGG GE + LL +W YL ALD PI TKA+T+ Sbjct: 73 GVAAGGGGGGGGAKGE----------------MDWRLLLAW--YLLALDKHPITTKAVTS 114 Query: 259 GVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 VL GD + Q L + LDL R F F LVL GP H WY Sbjct: 115 AVLTLTGDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWY 159 [56][TOP] >UniRef100_Q2QY93 Mpv17/PMP22 family protein, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q2QY93_ORYSJ Length = 293 Score = 65.5 bits (158), Expect = 2e-09 Identities = 45/106 (42%), Positives = 51/106 (48%) Frame = +1 Query: 79 GGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITA 258 G GGGGGGGG GE + LL +W YL ALD PI TKA+T+ Sbjct: 73 GVAAGGGGGGGGAKGE----------------MDWRLLLAW--YLLALDKHPITTKAVTS 114 Query: 259 GVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 VL GD + Q L + LDL R F F LVL GP H WY Sbjct: 115 AVLTLTGDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWY 159 [57][TOP] >UniRef100_Q2QQ39 Peroxisomal membrane protein 22 kDa, putative, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q2QQ39_ORYSJ Length = 269 Score = 65.5 bits (158), Expect = 2e-09 Identities = 44/140 (31%), Positives = 64/140 (45%), Gaps = 13/140 (9%) Frame = +1 Query: 19 LSSSTPPMSRGAGGPPPPP-------------GGGGRGGGGGGGGGGGEGADESFSAAAG 159 +SSS P + PPPPP G R GGG G G AA G Sbjct: 36 ISSSKRPSPSPSPPPPPPPPLPVAPSTSAFVQTAGRRSGGGAGAG-----------AAVG 84 Query: 160 GGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRL 339 G + +W YL +++ P+ TK++TA + + D +QM+T P +LDL R Sbjct: 85 SG--------VVAW--YLGSIEARPVLTKSVTAAAIFTVADLSSQMITLGPEDSLDLVRT 134 Query: 340 FSFAAFVLVLQGPVGHAWYN 399 A++ L++ GP H W+N Sbjct: 135 LRMASYGLLISGPSLHIWFN 154 [58][TOP] >UniRef100_Q0IN47 Os12g0508100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q0IN47_ORYSJ Length = 240 Score = 65.5 bits (158), Expect = 2e-09 Identities = 44/140 (31%), Positives = 64/140 (45%), Gaps = 13/140 (9%) Frame = +1 Query: 19 LSSSTPPMSRGAGGPPPPP-------------GGGGRGGGGGGGGGGGEGADESFSAAAG 159 +SSS P + PPPPP G R GGG G G AA G Sbjct: 36 ISSSKRPSPSPSPPPPPPPPLPVAPSTSAFVQTAGRRSGGGAGAG-----------AAVG 84 Query: 160 GGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRL 339 G + +W YL +++ P+ TK++TA + + D +QM+T P +LDL R Sbjct: 85 SG--------VVAW--YLGSIEARPVLTKSVTAAAIFTVADLSSQMITLGPEDSLDLVRT 134 Query: 340 FSFAAFVLVLQGPVGHAWYN 399 A++ L++ GP H W+N Sbjct: 135 LRMASYGLLISGPSLHIWFN 154 [59][TOP] >UniRef100_B9GBN8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9GBN8_ORYSJ Length = 268 Score = 65.5 bits (158), Expect = 2e-09 Identities = 45/106 (42%), Positives = 51/106 (48%) Frame = +1 Query: 79 GGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITA 258 G GGGGGGGG GE + LL +W YL ALD PI TKA+T+ Sbjct: 73 GVAAGGGGGGGGAKGE----------------MDWRLLLAW--YLLALDKHPITTKAVTS 114 Query: 259 GVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 VL GD + Q L + LDL R F F LVL GP H WY Sbjct: 115 AVLTLTGDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWY 159 [60][TOP] >UniRef100_UPI000023F096 hypothetical protein FG08656.1 n=1 Tax=Gibberella zeae PH-1 RepID=UPI000023F096 Length = 611 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 4/49 (8%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 AP P PPPP ++ P PPPP PP PPPP PPPPGG G PP P Sbjct: 459 APPPPPPPPPPPGGPAAPPPPPPPMPPTSGAPPPPPPPPPGGPGAPPPP 507 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/48 (58%), Positives = 30/48 (62%), Gaps = 6/48 (12%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGGPPAP 48 P PPPPAA+ S P+PPP P PPPPPP PPPPGG PP P Sbjct: 435 PIPPPPAAS---SHPPAPPPLPPTTNGAPPPPPPPPPPPGGPAAPPPP 479 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/69 (44%), Positives = 35/69 (50%), Gaps = 14/69 (20%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAE----KDSSAPSPPPPPPPPP--------PPRPPPPGGGGG- 60 Q++ S+ S PPPPA A D + PPPPPPPP PP PP P GG Sbjct: 242 QQKASQPHSTPPPPPAPASPANGNDGRSSRAPPPPPPPPAAGRSQDGPPAPPAPRKGGPP 301 Query: 59 -PPAPRDIG 36 PPAPR G Sbjct: 302 PPPAPRRSG 310 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/63 (42%), Positives = 30/63 (47%), Gaps = 4/63 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAPRDIGGVDEERNS 12 P+ PPPP S AP PPPPPP PPP PPP G G PAP G Sbjct: 473 PAAPPPPPPPMPPTSGAPPPPPPPPPGGPGAPPPPPPPMPPGSGAPAPPVTGDPSRSAVL 532 Query: 11 SGV 3 +G+ Sbjct: 533 AGI 535 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/65 (44%), Positives = 30/65 (46%), Gaps = 16/65 (24%) Frame = -3 Query: 194 RRSRAPSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPR------------PPPPGGGG 63 R SRAP P PPPPAA P+PP P PPPPP PR P PP Sbjct: 268 RSSRAPPPPPPPPAAGRSQDGPPAPPAPRKGGPPPPPAPRRSGKAETAPERAPSPPRPKF 327 Query: 62 GPPAP 48 G P P Sbjct: 328 GVPPP 332 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/52 (46%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPP-----PPPPPPRPPPPGGGGGPPAPRD 42 A P PPPP + P PPPPP PPPPPP PP G PP D Sbjct: 474 AAPPPPPPPMPPTSGAPPPPPPPPPGGPGAPPPPPPPMPPGSGAPAPPVTGD 525 [61][TOP] >UniRef100_UPI0000DC1294 UPI0000DC1294 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DC1294 Length = 90 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/45 (66%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP-PPRPPPPGGGGGPPAP 48 P PAPPPPAAA S AP PPP PPPPP PP PP P PPAP Sbjct: 39 PPPAPPPPAAAPAASPAPPPPPDPPPPPAPPPPPAPPAPPPPPAP 83 [62][TOP] >UniRef100_C3ZSY2 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3ZSY2_BRAFL Length = 2637 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/67 (46%), Positives = 35/67 (52%), Gaps = 20/67 (29%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSA----------------PSPPPPPPPPP----PPRPPPPGG 69 + P+P+PPPP E+D S P PPPPPPPPP PP PPPP Sbjct: 665 THTPTPSPPPPPPGEEDVSPFSTPLSSEGEGEGAPPPGPPPPPPPPPGSGGPPPPPPPPP 724 Query: 68 GGGPPAP 48 GGGPP P Sbjct: 725 GGGPPPP 731 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 AP P PPPP S P PPPPPPP P PPPP G PP Sbjct: 698 APPPGPPPPPPPPPGSGGPPPPPPPPPGGGPPPPPPPGAPPPP 740 [63][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/47 (57%), Positives = 28/47 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 P P PPPP P PPPPPPPPPPP PPPP PP PR+I Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNI 105 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/46 (56%), Positives = 26/46 (56%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 99 [64][TOP] >UniRef100_Q5ASL5 Putative uncharacterized protein n=1 Tax=Emericella nidulans RepID=Q5ASL5_EMENI Length = 1186 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/50 (62%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP---PPPPRPPPPGGGGGPPAP 48 S P P PPPP A SSAP PPPPPPP PPP PPPPG G PP P Sbjct: 492 SGPPMPPPPPPPAP--GSSAPPPPPPPPPGAGAPPPPPPPPGAGAPPPPP 539 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/50 (58%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 48 P P PPPPA+ S P PPPPPPP PPPP PPPPG G PP P Sbjct: 482 PPPPPPPPAS----SGPPMPPPPPPPAPGSSAPPPPPPPPPGAGAPPPPP 527 Score = 64.3 bits (155), Expect = 4e-09 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 9/59 (15%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP----PPPPP-----RPPPPGGGGGPPAPRDIGG 33 AP P PPPP A AP PPPPPP PPPPP PPPP GG PP P+ GG Sbjct: 522 APPPPPPPPGAG-----APPPPPPPPGAGAPPPPPPPGAGAPPPPPGGAAPPLPQPSGG 575 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 48 S AP P PPPP A +PPPPPPPP PPP PPPPG G PP P Sbjct: 507 SSAPPPPPPPPPGAG------APPPPPPPPGAGAPPPPPPPPGAGAPPPPP 551 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSP----PPPPPPPP----PPRPPPPGGGGGPPAP 48 S P P PPPP A P P PPPPPPPP PP PPPPG G PP P Sbjct: 508 SAPPPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPGAGAPPPPP 562 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/47 (51%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 48 P PPPPA + P PPPPPPP P PP PPPP G P P Sbjct: 466 PPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPPAPGSSAPPP 512 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/63 (46%), Positives = 30/63 (47%), Gaps = 15/63 (23%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPP----PPPPPP-----------PPRPPPPGGGGGP 57 RS A P PPPP +S P PPP PPPPPP PP PPPP GP Sbjct: 438 RSPASQPPPPPPVPG---ASRPVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGP 494 Query: 56 PAP 48 P P Sbjct: 495 PMP 497 [65][TOP] >UniRef100_Q4WCV2 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus fumigatus RepID=Q4WCV2_ASPFU Length = 643 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/48 (56%), Positives = 30/48 (62%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPP----PPPPPPRPPPPGGGGGPPAP 48 PSP PPPP ++ + P PPPPP PPPPPP PP PGG PP P Sbjct: 487 PSPPPPPPVSSGPPAPPPPPPPPPSIGGPPPPPPPPPAPGGSAPPPPP 534 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/51 (52%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 S + P+PPPP AP PPPPPPP PPPP PPPP GG P P Sbjct: 482 STSVPPSPPPPPPVSSGPPAPPPPPPPPPSIGGPPPPPPPPPAPGGSAPPP 532 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/52 (51%), Positives = 30/52 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGVDE 24 P P PPPPA SAP PPPPPP P PPPP G PP P+ GG ++ Sbjct: 516 PPPPPPPPAPG---GSAPPPPPPPPGAGAPPPPPPASGAAPPLPKPTGGRED 564 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/51 (52%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPRDIGG 33 PAPPPP P PPPPPPP P PP PPPP G G PP P G Sbjct: 500 PAPPPPPPPPPSIGGPPPPPPPPPAPGGSAPPPPPPPPGAGAPPPPPPASG 550 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/51 (52%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAP 48 S P P PPPP + +P PPPP PP PPPP PPPP GG PP P Sbjct: 469 SAVPPPPPPPPPPSTSVPPSPPPPPPVSSGPPAPPPPPPPPPSIGGPPPPP 519 Score = 60.5 bits (145), Expect = 6e-08 Identities = 41/105 (39%), Positives = 46/105 (43%), Gaps = 11/105 (10%) Frame = -3 Query: 329 RSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAA 150 RS P G P S + P P V + TS A R+ P P PPP A Sbjct: 402 RSSAPPGPPPPPPRSPATPPQLPPKVPHV----PTSAAGPPPPPPARNPVPPPPPPPVPA 457 Query: 149 AEKD-------SSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 48 A + S+ P PPPPPPPP PP PPPP GPPAP Sbjct: 458 ASRPTPPPPVTSAVPPPPPPPPPPSTSVPPSPPPPPPVSSGPPAP 502 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/49 (55%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 48 AP P PPPP + P PPPPPP P PPP PPPPG G PP P Sbjct: 501 APPPPPPPPPSI---GGPPPPPPPPPAPGGSAPPPPPPPPGAGAPPPPP 546 [66][TOP] >UniRef100_C8VA31 Putative uncharacterized protein n=1 Tax=Aspergillus nidulans FGSC A4 RepID=C8VA31_EMENI Length = 657 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/50 (62%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP---PPPPRPPPPGGGGGPPAP 48 S P P PPPP A SSAP PPPPPPP PPP PPPPG G PP P Sbjct: 492 SGPPMPPPPPPPAP--GSSAPPPPPPPPPGAGAPPPPPPPPGAGAPPPPP 539 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/50 (58%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 48 P P PPPPA+ S P PPPPPPP PPPP PPPPG G PP P Sbjct: 482 PPPPPPPPAS----SGPPMPPPPPPPAPGSSAPPPPPPPPPGAGAPPPPP 527 Score = 64.3 bits (155), Expect = 4e-09 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 9/59 (15%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP----PPPPP-----RPPPPGGGGGPPAPRDIGG 33 AP P PPPP A AP PPPPPP PPPPP PPPP GG PP P+ GG Sbjct: 522 APPPPPPPPGAG-----APPPPPPPPGAGAPPPPPPPGAGAPPPPPGGAAPPLPQPSGG 575 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 48 S AP P PPPP A +PPPPPPPP PPP PPPPG G PP P Sbjct: 507 SSAPPPPPPPPPGAG------APPPPPPPPGAGAPPPPPPPPGAGAPPPPP 551 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSP----PPPPPPPP----PPRPPPPGGGGGPPAP 48 S P P PPPP A P P PPPPPPPP PP PPPPG G PP P Sbjct: 508 SAPPPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPGAGAPPPPP 562 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/47 (51%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 48 P PPPPA + P PPPPPPP P PP PPPP G P P Sbjct: 466 PPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPPAPGSSAPPP 512 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/63 (46%), Positives = 30/63 (47%), Gaps = 15/63 (23%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPP----PPPPPP-----------PPRPPPPGGGGGP 57 RS A P PPPP +S P PPP PPPPPP PP PPPP GP Sbjct: 438 RSPASQPPPPPPVPG---ASRPVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGP 494 Query: 56 PAP 48 P P Sbjct: 495 PMP 497 [67][TOP] >UniRef100_C4JPD7 Putative uncharacterized protein n=1 Tax=Uncinocarpus reesii 1704 RepID=C4JPD7_UNCRE Length = 624 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/55 (54%), Positives = 32/55 (58%), Gaps = 6/55 (10%) Frame = -3 Query: 194 RRSRAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPPPRPPPPGGGGGPPAP 48 + S P P PPPPA+A AP PPP PP PPPP PPP G GG PPAP Sbjct: 475 QNSGPPPPPPPPPASAAPIPVAPPPPPLPPSYGAPPAPPPPPPPPSGAGGAPPAP 529 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/58 (48%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP------PPRPPPPGGGGGPPAPRDIGG 33 S AP P PPP AP PPPPPPPP PP PPPP GG P P+ + G Sbjct: 489 SAAPIPVAPPPPPLPPSYGAPPAPPPPPPPPSGAGGAPPAPPPPPPGGA-PTPKAVPG 545 [68][TOP] >UniRef100_B6HQ39 Pc22g23920 protein n=1 Tax=Penicillium chrysogenum Wisconsin 54-1255 RepID=B6HQ39_PENCW Length = 662 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/53 (52%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPP---PPRPPPPGGGGGPPAPRDIGGVDE 24 P PPPPA A + P PPPPPP P P PPPP GG PP P+ GG D+ Sbjct: 525 PPPPPPAPASRAPGGPPPPPPPPGAPGGGAPPPPPPAGGAAPPLPKPSGGRDD 577 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/72 (43%), Positives = 32/72 (44%), Gaps = 22/72 (30%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPP--------PPPPPPPR------------PPPPG--G 69 +PS PPPP P PPPP PPPPPPP PPPPG G Sbjct: 492 SPSVPPPPPPPGAAAPGGPPPPPPPGRGGPSIPPPPPPPAPASRAPGGPPPPPPPPGAPG 551 Query: 68 GGGPPAPRDIGG 33 GG PP P GG Sbjct: 552 GGAPPPPPPAGG 563 Score = 54.3 bits (129), Expect = 4e-06 Identities = 43/125 (34%), Positives = 48/125 (38%), Gaps = 13/125 (10%) Frame = -3 Query: 383 PTGPWRTSTNAAKLNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*D 204 P P RT++ AA +LP VP + P P P L A Sbjct: 411 PPPPPRTASPAAP------PQLPPKVPPMSTTTGPPPPARGPVSPPLPPPPAPR-----P 459 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAP------SPPPPPPPPPP-------PRPPPPGGGG 63 V S +P PPPP AP SP PPPPPPP P PPPP G G Sbjct: 460 VPAAPSSPAAPPPPPPRGPVSPPPAPPSAPTYSPSVPPPPPPPGAAAPGGPPPPPPPGRG 519 Query: 62 GPPAP 48 GP P Sbjct: 520 GPSIP 524 [69][TOP] >UniRef100_A8NN84 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NN84_COPC7 Length = 550 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/50 (56%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPPAP 48 P P PPPP AP PPPPPP PPPPP PPPP GG PP P Sbjct: 386 PPPPPPPPGPPAATGGAPPPPPPPPPPGGAAPPPPPPPPPPPGGAVPPPP 435 Score = 64.7 bits (156), Expect = 3e-09 Identities = 42/99 (42%), Positives = 48/99 (48%), Gaps = 13/99 (13%) Frame = -3 Query: 305 PVSICASVSP-RPTNTPAVMALVLMGATSR------ALR*DVQERRSRAPSPAPPPP--- 156 PVS AS P P PAV + SR A RR +PAPPP Sbjct: 307 PVSSVASAPPPAPPRRPAVSSPNPPPPPSRPQPNGAAATPPPPPRRPALSNPAPPPRPPV 366 Query: 155 ---AAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 A AE+D+++ S PPPPPPPPPP P PP GG P P Sbjct: 367 PTRAVAEEDTTSVSTPPPPPPPPPPPPGPPAATGGAPPP 405 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/50 (56%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPP------PPRPPPPGGGGGPPA 51 AP P PPPP +AP PPPPPPPPP PP PPPP GG G P+ Sbjct: 402 APPPPPPPPPPG---GAAPPPPPPPPPPPGGAVPPPPPPPPPAGGSGAPS 448 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPA 51 P P PPPP P PPPPP PPPPP PPP GG G P A Sbjct: 404 PPPPPPPPPGGAAPPPPPPPPPPPGGAVPPPPPPPPPAGGSGAPSA 449 [70][TOP] >UniRef100_Q4S986 Chromosome 3 SCAF14700, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4S986_TETNG Length = 1204 Score = 65.1 bits (157), Expect = 2e-09 Identities = 40/107 (37%), Positives = 45/107 (42%), Gaps = 11/107 (10%) Frame = -3 Query: 305 PVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAP 126 P V P P P AL MGA P P PPPP+AA P Sbjct: 600 PPPALGGVPPPPPPPPPPPALGAMGAP---------------PPPPPPPPSAAGLPPPPP 644 Query: 125 ------SPPPPPPPP-----PPPRPPPPGGGGGPPAPRDIGGVDEER 18 PPPPPPPP PPP PPPP G GPP P + G+ ++ Sbjct: 645 PPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPPPPMPGLKTKK 691 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/63 (46%), Positives = 31/63 (49%), Gaps = 16/63 (25%) Frame = -3 Query: 188 SRAPSPAPPPP-----------AAAEKDSSAPSPPP-----PPPPPPPPRPPPPGGGGGP 57 S P P PPPP A++ SAP PPP PPPPPPPP PP G G P Sbjct: 567 SSPPPPPPPPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPPPPPALGAMGAP 626 Query: 56 PAP 48 P P Sbjct: 627 PPP 629 Score = 54.7 bits (130), Expect = 3e-06 Identities = 38/97 (39%), Positives = 42/97 (43%), Gaps = 7/97 (7%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P+ VS+ S P P P + G S A DV + S PPPPA Sbjct: 557 PNSPQVSLPTSSPPPPPPPPP--PCIPGGNLSPAPASDVCD------SAPPPPPALG--G 606 Query: 137 SSAPSPPPPPPP-------PPPPRPPPPGGGGGPPAP 48 P PPPPPPP PPPP PPPP G PP P Sbjct: 607 VPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPP 643 [71][TOP] >UniRef100_A9UVG5 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9UVG5_MONBE Length = 1181 Score = 65.1 bits (157), Expect = 2e-09 Identities = 31/56 (55%), Positives = 33/56 (58%), Gaps = 5/56 (8%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAPRDIGGV 30 AP AP PP S AP+PPPPPPPP PPP PPPPG GG PP P G+ Sbjct: 539 APGSAPAPP------SGAPAPPPPPPPPGGAAAPPPPPPPPGPGGAPPPPPPPPGI 588 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/51 (56%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGGGGGPPAPRDIGG 33 +PAPPPP ++AP PPPPPP P PPP PPPPG G PP P I G Sbjct: 550 APAPPPPPPPPGGAAAPPPPPPPPGPGGAPPPPPPPPGIPGAPPPPPGIPG 600 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 10/55 (18%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP-----PPPPP-----RPPPPGGGGGPPAP 48 AP P PPPP AP PPPPPP PPPPP PPPPG G PP P Sbjct: 565 APPPPPPPPGPG----GAPPPPPPPPGIPGAPPPPPGIPGAPPPPPGAPGAPPPP 615 [72][TOP] >UniRef100_A7SLQ1 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SLQ1_NEMVE Length = 1027 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPP PPPP PPPPG GGGPP P Sbjct: 416 PPPPPPPPGGV------PPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPP 458 Score = 63.2 bits (152), Expect = 9e-09 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 5/47 (10%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAP 48 P PPPP + P PPPPPP PPPPP PPPPG GGGPP P Sbjct: 427 PPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPP-PPPPGPGGGPPPP 472 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 5/52 (9%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPP-----PPPPPPRPPPPGGGGGPPAPRDIGG 33 P PPPP + P PPPPP PPPPPP PP PGGG PP P GG Sbjct: 428 PPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGG 479 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPP---PPRPPPPGGGG--GPPAP 48 AP P PPPP P PPPPPPP P PP PPPP GGG GPP P Sbjct: 440 APPPPPPPPPGM---GGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPPPP 486 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/56 (50%), Positives = 28/56 (50%), Gaps = 12/56 (21%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP-------PPPPPPP-----PRPPPPGGGGGPPAP 48 P P PPPP P PPP PPPPPPP P PPPP GGGPP P Sbjct: 428 PPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGP 483 [73][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/65 (49%), Positives = 36/65 (55%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGVDEER 18 E RS PSP PPA + +P PPPPPPPPPPP PPPP PP P G Sbjct: 962 EDRSPLPSPGLLPPAEEVPNGLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGFKGIIP 1021 Query: 17 NSSGV 3 +SSG+ Sbjct: 1022 SSSGI 1026 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/62 (41%), Positives = 27/62 (43%), Gaps = 15/62 (24%) Frame = -3 Query: 206 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP---------------PPPRPPPPG 72 +V S P P PPPP P PPPPPPPP PPP PPPPG Sbjct: 978 EVPNGLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGFKGIIPSSSGIPLPPPPPPPPG 1037 Query: 71 GG 66 G Sbjct: 1038 PG 1039 [74][TOP] >UniRef100_B4FYT6 Mpv17 / PMP22 family protein n=1 Tax=Zea mays RepID=B4FYT6_MAIZE Length = 263 Score = 64.7 bits (156), Expect = 3e-09 Identities = 45/128 (35%), Positives = 59/128 (46%) Frame = +1 Query: 16 FLSSSTPPMSRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLR 195 F+SS PP + P PPP R G G S A G GAG G + Sbjct: 36 FISSKPPPST-----PLPPPVPPARLSPVGSAFG-----PPSRKTGAVGAGAGAGVV--- 82 Query: 196 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQG 375 W YL LD P+ TK++TA V+ D +QMLT P +LD R A++ ++ G Sbjct: 83 GW--YLGLLDARPVLTKSVTAAVIFTAADVSSQMLTLGPEDSLDFLRTMRMASYGFLISG 140 Query: 376 PVGHAWYN 399 P H W+N Sbjct: 141 PSLHLWFN 148 [75][TOP] >UniRef100_UPI00019829F7 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019829F7 Length = 610 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P+PPPP + +S P+PPPP P PPPP PPPP G GPP P Sbjct: 62 SNTSPPSPPPP---KSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKP 105 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/67 (43%), Positives = 34/67 (50%), Gaps = 5/67 (7%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPGGGGGPPAPRDIGGVD 27 +S +P P PPPP+ PSPPPPPPPPP PP+PPPP P P Sbjct: 73 KSESPPPTPPPPS--------PSPPPPPPPPPSSGSGPPKPPPPSHSNSSPPPPPTSPPP 124 Query: 26 EERNSSG 6 + SSG Sbjct: 125 KSSQSSG 131 [76][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/53 (50%), Positives = 29/53 (54%) Frame = -3 Query: 206 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 DV++ P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 317 DVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQP 369 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/46 (54%), Positives = 25/46 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 42 P P PPPP P PPPPPPPPPPP PPPP PP D Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPD 370 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/61 (45%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIG--GVDEERNSSG 6 P P PPPP P PPPPPPPPPPP PP P PP G V+ R +G Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPPVTTAPGSNSVEGGRPHAG 390 Query: 5 V 3 V Sbjct: 391 V 391 [77][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAP-SPPPPPPPPPPPRPPPPGGGGGPPAP 48 ++R +PSP PPPP P SPPPPPPPPPPP PPPP PP+P Sbjct: 216 RDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P APPPP ++ ++PSPPPPPPPPPPP PPPP PP P Sbjct: 207 PVSAPPPPFR-DRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPP 249 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 P P PPPP P PPPPPPPPPPP PPPP PP Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPP 272 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP P PP PP P+ Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPK 273 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/48 (50%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPP------PRPPPPGGGGGPP 54 P P PPPP + P PPPPPPPPPP P PPPP G P Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTP 279 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP--PPPPRPPPPGGGGGPPAPRD 42 P P PPPP+ P PPPPPPP PPPP P PP G P P + Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTPNN 281 [78][TOP] >UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9EXV1_ORYSJ Length = 532 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP+PPPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 377 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 420 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 360 PSPPPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 403 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/46 (54%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG--GGGPPAP 48 PSP+PPPP+ PSP PPPP PPPP PPPP PP P Sbjct: 394 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPP 439 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 365 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 408 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 382 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 425 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P+ PSPPPP P PPPP PPPP P+P Sbjct: 372 PSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSP 415 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ + S P P PPPP P PP P PP PP+P Sbjct: 387 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 430 [79][TOP] >UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa RepID=Q8L3T8_ORYSJ Length = 570 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP+PPPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 415 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 458 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 398 PSPPPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 441 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/46 (54%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG--GGGPPAP 48 PSP+PPPP+ PSP PPPP PPPP PPPP PP P Sbjct: 432 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPP 477 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 403 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 446 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 420 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 463 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P+ PSPPPP P PPPP PPPP P+P Sbjct: 410 PSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSP 453 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ + S P P PPPP P PP P PP PP+P Sbjct: 425 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 468 [80][TOP] >UniRef100_A9TWA3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWA3_PHYPA Length = 2209 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPP------PPRPPPPGGGGGPPAPRDIGG 33 RA P PPPP +AP PPPPPP PP PP PPPPGG PP P GG Sbjct: 1635 RAAPPPPPPPPLPPGGRAAPPPPPPPPLPPGGRAAPPPPPPPPGGRAAPPPPPPPGG 1691 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/61 (50%), Positives = 31/61 (50%), Gaps = 11/61 (18%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSP-----PPPPPPPP------PPRPPPPGGGGGPPAPRDIG 36 AP P PPPP P P PPPPPPPP PP PPPPGG G PP P G Sbjct: 1669 APPPPPPPPGGRAAPPPPPPPGGRGAPPPPPPPPGGRGVAPPPPPPPGGRGAPPPPPPPG 1728 Query: 35 G 33 G Sbjct: 1729 G 1729 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/61 (49%), Positives = 31/61 (50%), Gaps = 11/61 (18%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPP------PPPPPPP-----PPRPPPPGGGGGPPAPRDI 39 RA P PPPP P PP PPPPPPP PP PPPPGG G PP P + Sbjct: 1680 RAAPPPPPPPGGRGAPPPPPPPPGGRGVAPPPPPPPGGRGAPPPPPPPGGRGAPPPPPPL 1739 Query: 38 G 36 G Sbjct: 1740 G 1740 Score = 60.8 bits (146), Expect = 4e-08 Identities = 38/88 (43%), Positives = 46/88 (52%), Gaps = 3/88 (3%) Frame = -3 Query: 287 SVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPP 108 SVSP P PA + V+ A + +L + R P P P PP+ K + P PPPPP Sbjct: 1533 SVSPAPP--PASSSPVVEEAEASSLPPPGKSAPPRRPPP-PLPPSLPGKSAPPPPPPPPP 1589 Query: 107 PPPPPP---RPPPPGGGGGPPAPRDIGG 33 PPPPPP PPPP PP P +GG Sbjct: 1590 PPPPPPGRSAPPPP---PPPPPPLPLGG 1614 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPP--PPPPRPPPPGGGGGPPAP 48 RA P PPPP +AP PPPPPP PP PPPPGG G PP P Sbjct: 1651 RAAPPPPPPPPLPPGGRAAPPPPPPPPGGRAAPPPPPPPGGRGAPPPP 1698 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/57 (47%), Positives = 29/57 (50%), Gaps = 13/57 (22%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP--------PPPPP-----RPPPPGGGGGPPAP 48 P P PPPP + + P PPPPPP PPPPP PPPPGG PP P Sbjct: 1585 PPPPPPPPPPPGRSAPPPPPPPPPPLPLGGRAAPPPPPGGRAAPPPPPGGRAAPPPP 1641 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/61 (47%), Positives = 31/61 (50%), Gaps = 13/61 (21%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAP--------SPPPPP-----PPPPPPRPPPPGGGGGPPA 51 RS P P PPPP +AP +PPPPP PPPPPP P PPGG PP Sbjct: 1597 RSAPPPPPPPPPPLPLGGRAAPPPPPGGRAAPPPPPGGRAAPPPPPPPPLPPGGRAAPPP 1656 Query: 50 P 48 P Sbjct: 1657 P 1657 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/54 (46%), Positives = 27/54 (50%), Gaps = 8/54 (14%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPP--------RPPPPGGGGGPPAP 48 ++ P PPPP S PPPPPPPPPP PPPPGG PP P Sbjct: 1578 KSAPPPPPPPPPPPPPPPGRSAPPPPPPPPPPLPLGGRAAPPPPPGGRAAPPPP 1631 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/57 (45%), Positives = 28/57 (49%), Gaps = 12/57 (21%) Frame = -3 Query: 182 APSPAP-----PPPAAAEKDSSAPSPPPP-------PPPPPPPRPPPPGGGGGPPAP 48 AP P P PPP + + P PPPP PPPPPP P PPGG PP P Sbjct: 1617 APPPPPGGRAAPPPPPGGRAAPPPPPPPPLPPGGRAAPPPPPPPPLPPGGRAAPPPP 1673 [81][TOP] >UniRef100_A8J9H7 Mastigoneme-like flagellar protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J9H7_CHLRE Length = 1987 Score = 64.7 bits (156), Expect = 3e-09 Identities = 34/71 (47%), Positives = 38/71 (53%), Gaps = 11/71 (15%) Frame = -3 Query: 185 RAPSPAPP---PPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAPRDI----- 39 R PSPAPP PP + S PSPPPP PPPPPPP PPPP PP P Sbjct: 1881 RPPSPAPPSPNPPPTSPPPSPPPSPPPPRPPPPPPPPPSPPPPNRSPPPPPPASSAINPG 1940 Query: 38 GGVDEERNSSG 6 GGV++ + G Sbjct: 1941 GGVNQNGDPVG 1951 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAP 48 PSP PP PA + SPPP PPP PPPPRPPPP PP P Sbjct: 1878 PSPRPPSPAPPSPNPPPTSPPPSPPPSPPPPRPPPP-----PPPP 1917 [82][TOP] >UniRef100_A7QNX2 Chromosome chr1 scaffold_135, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QNX2_VITVI Length = 673 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P+PPPP + +S P+PPPP P PPPP PPPP G GPP P Sbjct: 62 SNTSPPSPPPP---KSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKP 105 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 6/54 (11%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPG-GGGGPPAP 48 +S +P P PPPP+ PSPPPPPPPPP PP+PPPP PP P Sbjct: 73 KSESPPPTPPPPS--------PSPPPPPPPPPSSGSGPPKPPPPSHSNSSPPPP 118 [83][TOP] >UniRef100_Q1HMI6 Formin A n=2 Tax=Trypanosoma cruzi RepID=Q1HMI6_TRYCR Length = 1178 Score = 64.7 bits (156), Expect = 3e-09 Identities = 31/61 (50%), Positives = 32/61 (52%), Gaps = 13/61 (21%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPP----------PPPPPPPRPPPPGGG---GGPPA 51 +S P P PPPP A K P PPPP PPPPPPP PPPPG G G PP Sbjct: 630 KSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPPPPPPPPPGAGAKSGLPPP 689 Query: 50 P 48 P Sbjct: 690 P 690 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/57 (47%), Positives = 29/57 (50%), Gaps = 10/57 (17%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP----------PPPRPPPPGGGGGPPA 51 +S P P PPPP A K +P PPPPPPPP PPP PPPP PA Sbjct: 646 KSGLPPPPPPPPGAGAKSGLSPPPPPPPPPPPPGAGAKSGLPPPPPPPPPKAKSRPA 702 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 11/59 (18%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP--------PPPRPPPPGGG---GGPPAP 48 +S P P PPPP A K PPPPPPPP PPP PPPPG G G PP P Sbjct: 534 KSGLPPPPPPPPGAGAKSG---LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 589 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 11/59 (18%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP--------PPPRPPPPGGG---GGPPAP 48 +S P P PPPP A K PPPPPPPP PPP PPPPG G G PP P Sbjct: 566 KSGLPPPPPPPPGAGAKSG---LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 621 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 11/59 (18%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP--------PPPRPPPPGGG---GGPPAP 48 +S P P PPPP A K PPPPPPPP PPP PPPPG G G PP P Sbjct: 598 KSGLPPPPPPPPGAGAKSG---LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 653 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/56 (51%), Positives = 29/56 (51%), Gaps = 9/56 (16%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGG---GGPPAP 48 S P P PPPP A S P PPPPPP PPP PPPPG G G PP P Sbjct: 518 SGLPPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 573 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/58 (51%), Positives = 31/58 (53%), Gaps = 10/58 (17%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGG---GGPPAP 48 +S P P PPPP A K S PPPPPPP PPP PPPPG G G PP P Sbjct: 550 KSGLPPPPPPPPGAGAK--SGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 605 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/58 (51%), Positives = 31/58 (53%), Gaps = 10/58 (17%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGG---GGPPAP 48 +S P P PPPP A K S PPPPPPP PPP PPPPG G G PP P Sbjct: 582 KSGLPPPPPPPPGAGAK--SGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 637 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/59 (49%), Positives = 30/59 (50%), Gaps = 11/59 (18%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGGG----GPPAP 48 +S P P PPPP A K S PPPPPPP PPP PPPPG G PP P Sbjct: 614 KSGLPPPPPPPPGAGAK--SGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPP 670 [84][TOP] >UniRef100_Q86ZG7 Probable Cytokinesis protein sepA n=1 Tax=Neurospora crassa RepID=Q86ZG7_NEUCR Length = 1790 Score = 64.7 bits (156), Expect = 3e-09 Identities = 37/95 (38%), Positives = 43/95 (45%), Gaps = 5/95 (5%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPP---PAAA 147 PS + ++P T TP + G ++ A P P PPP P A Sbjct: 992 PSHPSMESQTPITPSDTETPKIQVTDATGPSAPAAASGPPPPPPPPPPPPPPPGFLPGAP 1051 Query: 146 EKDSSAPSPPPPPPPPPPPRPPPPGG--GGGPPAP 48 A PPPPPPPPPPP PPPPGG G PP P Sbjct: 1052 APIPGAGGPPPPPPPPPPP-PPPPGGLPGAAPPMP 1085 [85][TOP] >UniRef100_Q7RWH7 Cytokinesis protein sepA n=1 Tax=Neurospora crassa RepID=Q7RWH7_NEUCR Length = 1817 Score = 64.7 bits (156), Expect = 3e-09 Identities = 37/95 (38%), Positives = 43/95 (45%), Gaps = 5/95 (5%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPP---PAAA 147 PS + ++P T TP + G ++ A P P PPP P A Sbjct: 992 PSHPSMESQTPITPSDTETPKIQVTDATGPSAPAAASGPPPPPPPPPPPPPPPGFLPGAP 1051 Query: 146 EKDSSAPSPPPPPPPPPPPRPPPPGG--GGGPPAP 48 A PPPPPPPPPPP PPPPGG G PP P Sbjct: 1052 APIPGAGGPPPPPPPPPPP-PPPPGGLPGAAPPMP 1085 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/52 (50%), Positives = 27/52 (51%), Gaps = 8/52 (15%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAP--SPP------PPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P +PP PPPPPPPPP PP PG G PP P Sbjct: 1061 PPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGMAGMPPPP 1112 [86][TOP] >UniRef100_Q2KFY0 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea 70-15 RepID=Q2KFY0_MAGGR Length = 669 Score = 64.7 bits (156), Expect = 3e-09 Identities = 41/110 (37%), Positives = 48/110 (43%), Gaps = 19/110 (17%) Frame = -3 Query: 320 LPSGVPVSICASVSPRPTNTPAVMALVLMGATSRA---------LR*DVQERRSRAPSPA 168 LPS VP + A P P+ P + V A + L S P+P Sbjct: 437 LPSKVPAAPTAPPLPPPSTRPPPVLPVRAPAAPQPPPLPSSQAPLAPPPLPASSAPPAPP 496 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPP---------PPRPPPPGG-GGGPPAP 48 P PP ++AP P PPPPPPP PP PPPPGG G PPAP Sbjct: 497 PAPPLPPPSSAAAPPPAPPPPPPPGGLAGAPPAPPPPPPPGGMAGAPPAP 546 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/69 (43%), Positives = 37/69 (53%), Gaps = 13/69 (18%) Frame = -3 Query: 215 LR*DVQERRSRAPS--------PAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPP 75 LR + Q R +P P PPPP + ++ +S +PPPPPP PP PP PPPP Sbjct: 251 LRQEQQSARKESPPARQQAHAHPPPPPPPSNDRSNSLRAPPPPPPAPPVSSNTPPAPPPP 310 Query: 74 GGGGGPPAP 48 G PPAP Sbjct: 311 RRGAAPPAP 319 [87][TOP] >UniRef100_C1GXM9 Cytokinesis protein sepA n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1GXM9_PARBA Length = 1734 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/48 (60%), Positives = 30/48 (62%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 PSP PPPP A + P PPPPPPP PPPP PPPPG G PP P Sbjct: 977 PSPPPPPPPPA---AGGPPPPPPPPPGIGAPPPPPPPPPGAGPPPPPP 1021 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 48 AP P PPPP A PPPPPPPP PPP PPPPG GG PP P Sbjct: 1003 APPPPPPPPPGA-------GPPPPPPPPGVGSPPPPPPPPGMGGPPPPP 1044 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 10/55 (18%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAP------SPPPPPPPPP----PPRPPPPGGGGGPPAP 48 +P P PPPPAA P +PPPPPPPPP PP PPPPG G PP P Sbjct: 978 SPPPPPPPPAAGGPPPPPPPPPGIGAPPPPPPPPPGAGPPPPPPPPGVGSPPPPP 1032 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/59 (45%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAPRDIG 36 +ER P+PPPP P PPPPPP PPPPP PPP G PP P +G Sbjct: 968 KERADATGPPSPPPPPPPPAAGGPPPPPPPPPGIGAPPPPPPPPPGAGPPPPPPPPGVG 1026 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/52 (53%), Positives = 28/52 (53%), Gaps = 8/52 (15%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPP----PPPPPPP----PPRPPPPGGGGGPPAP 48 P P PPPP P PP PPPPPPP PP PPPP G GGPP P Sbjct: 992 PPPPPPPPGIGAPPPPPPPPPGAGPPPPPPPPGVGSPPPPPPPPGMGGPPPP 1043 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 P P PPPP +P PPPPPP PPPPP PP GG PP P Sbjct: 1016 PPPPPPPPGVG-----SPPPPPPPPGMGGPPPPPPPPGAAPGGSPPPP 1058 [88][TOP] >UniRef100_C0NIM8 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NIM8_AJECG Length = 281 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/60 (48%), Positives = 31/60 (51%), Gaps = 16/60 (26%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPP----------------PPGGGGGP 57 S +P P PPPP+ S P PPPPPPPPPPP PP PP GGGGP Sbjct: 117 SYSPPPPPPPPSPPSPSPSPPPPPPPPPPPPPPPPPSPPAPAPSNPSTPPTSPPSGGGGP 176 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/43 (60%), Positives = 27/43 (62%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 SP PPPP + S PPPPPPPPPPP PPPP PPAP Sbjct: 119 SPPPPPPPPSPPSPSPSPPPPPPPPPPPPPPPPP----SPPAP 157 [89][TOP] >UniRef100_A4RBS7 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4RBS7_MAGGR Length = 654 Score = 64.7 bits (156), Expect = 3e-09 Identities = 41/110 (37%), Positives = 48/110 (43%), Gaps = 19/110 (17%) Frame = -3 Query: 320 LPSGVPVSICASVSPRPTNTPAVMALVLMGATSRA---------LR*DVQERRSRAPSPA 168 LPS VP + A P P+ P + V A + L S P+P Sbjct: 437 LPSKVPAAPTAPPLPPPSTRPPPVLPVRAPAAPQPPPLPSSQAPLAPPPLPASSAPPAPP 496 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPP---------PPRPPPPGG-GGGPPAP 48 P PP ++AP P PPPPPPP PP PPPPGG G PPAP Sbjct: 497 PAPPLPPPSSAAAPPPAPPPPPPPGGLAGAPPAPPPPPPPGGMAGAPPAP 546 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/69 (43%), Positives = 37/69 (53%), Gaps = 13/69 (18%) Frame = -3 Query: 215 LR*DVQERRSRAPS--------PAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPP 75 LR + Q R +P P PPPP + ++ +S +PPPPPP PP PP PPPP Sbjct: 251 LRQEQQSARKESPPARQQAHAHPPPPPPPSNDRSNSLRAPPPPPPAPPVSSNTPPAPPPP 310 Query: 74 GGGGGPPAP 48 G PPAP Sbjct: 311 RRGAAPPAP 319 [90][TOP] >UniRef100_Q9FPQ6 Vegetative cell wall protein gp1 n=1 Tax=Chlamydomonas reinhardtii RepID=GP1_CHLRE Length = 555 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/44 (61%), Positives = 28/44 (63%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSPAPP PA AP PPP PPPPPPPRPP P PP+P Sbjct: 247 PSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSP 290 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSPAPP PA S AP PP P PP PP P PP PPAP Sbjct: 200 PSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPP--SPSPPAP 241 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/49 (53%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = -3 Query: 179 PSPAPP---PPAAAEKDSSAPSPPPPPPPPP-PPRPPPPGGGGGPPAPR 45 PSPAPP PPA +P+PP P PP P PP PPPP PP PR Sbjct: 229 PSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPR 277 [91][TOP] >UniRef100_Q54WH2 Formin-A n=1 Tax=Dictyostelium discoideum RepID=FORA_DICDI Length = 1218 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 6/49 (12%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 48 S APPPP AP PPPPPPP PPPP PPPP GGGPP P Sbjct: 647 SVAPPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPP 695 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 5/48 (10%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 48 +P PPPP P PPPPPPP PPPP PPPP GGGPP P Sbjct: 662 APPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPP 709 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPP PPP PPPPGGG PP P Sbjct: 679 PPPPPPPPMTG----GGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPPP 722 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 6/44 (13%) Frame = -3 Query: 161 PPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGGPPAP 48 P +AA S AP PPPPP PPPPPP PP GGGG PP P Sbjct: 639 PDSAAASTSVAPPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPP 682 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGG-GGGPPAP 48 P P PPPP + PPPPPPPP PPP PPPPG GGPP P Sbjct: 693 PPPPPPPPM------TGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPPP 734 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/59 (47%), Positives = 28/59 (47%), Gaps = 11/59 (18%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP---PPPPPP--------PPRPPPPGGGGGPPAPRDIG 36 P P PPPP P PPP PPPPPP PP PPPP G G PP P G Sbjct: 692 PPPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPPPGGFG 750 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/45 (55%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Frame = -3 Query: 170 APPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAP 48 A P AAA + P PPPP PPPPP PPP GGGGPP P Sbjct: 637 AKPDSAAASTSVAPPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPP 681 [92][TOP] >UniRef100_B8BLU6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BLU6_ORYSI Length = 269 Score = 64.3 bits (155), Expect = 4e-09 Identities = 43/101 (42%), Positives = 50/101 (49%) Frame = +1 Query: 94 GGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVG 273 GGGGGGGGG +G + LL +W YL ALD PI TKA+T+ VL Sbjct: 77 GGGGGGGGGAKGE--------------MDWRLLLAW--YLLALDKHPITTKAVTSAVLTL 120 Query: 274 LGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 GD + Q L + LDL R F LVL GP H WY Sbjct: 121 TGDLICQ-LAIDKVPKLDLKRTLVFTFLGLVLVGPTLHVWY 160 [93][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP PSPPPPPPPPPPP PPPP PP P Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP S P PPPPPPPPPPP PPPP PP P Sbjct: 364 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP S P PPPPPPPPPPP PPPP PP P Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP +P PPPPPPPPPPP PPPP PP P Sbjct: 363 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/50 (50%), Positives = 30/50 (60%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 E ++ +P+ PPP +A P PPPPPPPPPPP PPPP PP P Sbjct: 335 EMQTGSPNACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPP 384 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -3 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PPPP+A P PPPPPPPPPPP PPPP PP P Sbjct: 346 PPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPP 385 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPP PPPPPP PPPP PP P Sbjct: 356 PCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PP PPPPPPPP PPPP PP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 401 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P P PPPPPPPPP PPPP PP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPP PPPP PP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 403 [94][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP PR Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [95][TOP] >UniRef100_UPI00016E1F9C UPI00016E1F9C related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1F9C Length = 426 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 7/75 (9%) Frame = -3 Query: 206 DVQERRSRAPSPAPPPP----AAAEKDSSAPSPPPPPPP---PPPPRPPPPGGGGGPPAP 48 ++QE+ ++A +PAPPPP AAA S+A PPPPPPP PPP PPPP PP P Sbjct: 161 ELQEKEAQAETPAPPPPNLSSAAASPTSTAGHPPPPPPPRPAPPPGAPPPP---PAPPLP 217 Query: 47 RDIGGVDEERNSSGV 3 + ++R SG+ Sbjct: 218 AGLFSPADDRPVSGL 232 [96][TOP] >UniRef100_A2A655 Bromodomain PHD finger transcription factor n=1 Tax=Mus musculus RepID=A2A655_MOUSE Length = 2973 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/62 (50%), Positives = 34/62 (54%) Frame = -3 Query: 194 RRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGVDEERN 15 R R P P AAE+ + AP PPPPPPPPPPP PPPP PPA IGG+ Sbjct: 2 RGRRGRPPKQPAAPAAERCAPAPPPPPPPPPPPPPPPPPP-----PPASGPIGGLRSRHR 56 Query: 14 SS 9 S Sbjct: 57 GS 58 [97][TOP] >UniRef100_A2A654 Bromodomain PHD finger transcription factor n=1 Tax=Mus musculus RepID=A2A654_MOUSE Length = 3036 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/62 (50%), Positives = 34/62 (54%) Frame = -3 Query: 194 RRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGVDEERN 15 R R P P AAE+ + AP PPPPPPPPPPP PPPP PPA IGG+ Sbjct: 2 RGRRGRPPKQPAAPAAERCAPAPPPPPPPPPPPPPPPPPP-----PPASGPIGGLRSRHR 56 Query: 14 SS 9 S Sbjct: 57 GS 58 [98][TOP] >UniRef100_B9LBU3 Putative uncharacterized protein n=1 Tax=Chloroflexus sp. Y-400-fl RepID=B9LBU3_CHLSY Length = 340 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/94 (36%), Positives = 41/94 (43%), Gaps = 8/94 (8%) Frame = -3 Query: 326 SRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRA--------PSP 171 +R P P +V+P PT +P A+ A + A P P Sbjct: 231 TRQPVSTPSPTVVTVTPSPTTSPTASPTASPTASPTASPTASPTASATASPTEPPPPPPP 290 Query: 170 APPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG 69 PPPP A +PPPPPPPPPPP PPPP G Sbjct: 291 PPPPPTVAPPPPPTVAPPPPPPPPPPPPPPPPPG 324 [99][TOP] >UniRef100_B6INW7 R body protein, putative n=1 Tax=Rhodospirillum centenum SW RepID=B6INW7_RHOCS Length = 157 Score = 64.3 bits (155), Expect = 4e-09 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGG 66 AP PAPP P + P+PP PPPPPPPP PPPPGGG Sbjct: 119 APPPAPPAPPPPPPPAPPPAPPAPPPPPPPPPPPPPGGG 157 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PAPPPP A + P PP PPPPPPP PPP PP P Sbjct: 104 PPPAPPPPPAPPPPPAPPPAPPAPPPPPPPAPPPAPPAPPPPPP 147 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P PPPPA + P P PPP PP PP PPPP PPAP Sbjct: 100 TPQPPPPAPPPPPAPPPPPAPPPAPPAPPPPPPPAPPPAPPAP 142 [100][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 P P PPPP P PPPPPPPPPPP PPPP PP P +I Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 72 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -3 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [101][TOP] >UniRef100_C7BGM8 Formin 2A n=1 Tax=Physcomitrella patens RepID=C7BGM8_PHYPA Length = 1238 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/59 (49%), Positives = 30/59 (50%), Gaps = 11/59 (18%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGGGGPPAPRDIG 36 P P PPPP S AP+PPPPPPPP PPP PPPP G PP P G Sbjct: 594 PPPPPPPPFGGRPASGAPAPPPPPPPPPPFGGRSNSGAPPPPPPPPSRPGAPPPPSPPG 652 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/63 (52%), Positives = 33/63 (52%), Gaps = 10/63 (15%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGG---GGGPPAPRD 42 RS AP P PP PA A PPPPPPPP PPP P PPGG GG PP P Sbjct: 667 RSNAPPPPPPLPAPPGGARPAGPPPPPPPPPGGARPAGPPPPPSPPGGRGRGGPPPPPPP 726 Query: 41 IGG 33 GG Sbjct: 727 PGG 729 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/60 (50%), Positives = 31/60 (51%), Gaps = 15/60 (25%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP------------PPPPRPPPPGGG---GGPPAP 48 AP P PPPP S+A PPPPPPP PPPP PPPP GG G PAP Sbjct: 554 APPPPPPPPFGGRSHSAAVPPPPPPPPPPFGGRPSSGAVPPPPPPPPPFGGRPASGAPAP 613 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/74 (43%), Positives = 34/74 (45%), Gaps = 21/74 (28%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPP-----------PPPPPPP-------PPRPPPPGG- 69 R P P PPPP + + P PP PPPPPPP PP PPPPGG Sbjct: 685 RPAGPPPPPPPPPGGARPAGPPPPPSPPGGRGRGGPPPPPPPPGGARPAVPPPPPPPGGR 744 Query: 68 --GGGPPAPRDIGG 33 GG PP P GG Sbjct: 745 GPGGPPPPPPPPGG 758 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 10/59 (16%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGG---GGGPPAPRDIGG 33 P P PPPP A P+ PPPPPPP PPP PPPPGG G PP P GG Sbjct: 720 PPPPPPPPGGAR-----PAVPPPPPPPGGRGPGGPPPPPPPPGGARPAGAPPPPPPPGG 773 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/49 (53%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 48 AP P PPPP S++ +PPPPPPPP PP P PPG G PP P Sbjct: 612 APPPPPPPPPPFGGRSNSGAPPPPPPPPSRPGAPPPPSPPGRSGAPPPP 660 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/61 (49%), Positives = 30/61 (49%), Gaps = 17/61 (27%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSA--PSPPPPPP-----------PPPPPRPPPPGGG----GGPPA 51 P P PPPP S A P PPPPPP PPPPP PPPP GG G PP Sbjct: 575 PPPPPPPPFGGRPSSGAVPPPPPPPPPFGGRPASGAPAPPPPPPPPPPFGGRSNSGAPPP 634 Query: 50 P 48 P Sbjct: 635 P 635 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/62 (45%), Positives = 33/62 (53%), Gaps = 11/62 (17%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPP--------PPPPRPPPPGG---GGGPPAPRDI 39 R+ +P PPPP + ++ P PPP P P PPPP PPPPGG G PP P Sbjct: 653 RSGAPPPPPPLPPGRSNAPPPPPPLPAPPGGARPAGPPPPPPPPPGGARPAGPPPPPSPP 712 Query: 38 GG 33 GG Sbjct: 713 GG 714 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/50 (56%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPP---PPPPPPRPPPPGGG---GGPPAP 48 P P PPPP A + + AP PPPPP P PP PPPPG G GGPP P Sbjct: 749 PPPPPPPPGGA-RPAGAPPPPPPPGGKGPGGPPPPPPPGAGRGRGGPPGP 797 Score = 55.1 bits (131), Expect = 2e-06 Identities = 33/77 (42%), Positives = 36/77 (46%), Gaps = 18/77 (23%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP---------PPPRPPPPGGGGG---------P 57 AP P PPPP + + +PPPPPPPP PPP PPPP GG P Sbjct: 519 APPPPPPPPPFGGRPAGG-APPPPPPPPFGGRPAGGAPPPPPPPPFGGRSHSAAVPPPPP 577 Query: 56 PAPRDIGGVDEERNSSG 6 P P GG R SSG Sbjct: 578 PPPPPFGG----RPSSG 590 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/64 (46%), Positives = 32/64 (50%), Gaps = 17/64 (26%) Frame = -3 Query: 188 SRAPSPAPPPPA--------AAEKDSSAPSPPPP-------PPPPPPPRPPPPGGG--GG 60 S AP P PPPP+ + S AP PPPP PPPPPP P PPGG G Sbjct: 629 SGAPPPPPPPPSRPGAPPPPSPPGRSGAPPPPPPLPPGRSNAPPPPPPLPAPPGGARPAG 688 Query: 59 PPAP 48 PP P Sbjct: 689 PPPP 692 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 P P PPP + SS + PPPPPPPPP P GG PP P GG Sbjct: 500 PPPPPPPTPFGGRPSSGIAAPPPPPPPPPFGGRPAGGAPPPPPPPPFGG 548 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/55 (50%), Positives = 28/55 (50%), Gaps = 10/55 (18%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPP--------PPRPPPPG--GGGGPPAP 48 A P PPPP P PPPPPPPP PP PPPPG G GGPP P Sbjct: 733 AVPPPPPPPG-----GRGPGGPPPPPPPPGGARPAGAPPPPPPPGGKGPGGPPPP 782 [102][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 P P PPPP P PPPPPPPPPPP PPPP PP P +I Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEI 49 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PAP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILPAP 53 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/50 (50%), Positives = 25/50 (50%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPG------GGGGPPAP 48 P P PPPP P PPPPPPPPPPP PP P PPAP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILPAPANRAPPAP 61 [103][TOP] >UniRef100_C5XD76 Putative uncharacterized protein Sb02g038276 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XD76_SORBI Length = 869 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/64 (51%), Positives = 35/64 (54%), Gaps = 14/64 (21%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPP-------PPPPPP------PPRPPPPGGGG-GPPAPR 45 A +P PPPP A + P PPP PPPPPP PP PPPPGGGG GPP P Sbjct: 718 ASAPPPPPPPGARPGAPPPPPPPGSRPGAPPPPPPPGARPGAPPPPPPPGGGGRGPPPPP 777 Query: 44 DIGG 33 GG Sbjct: 778 APGG 781 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/76 (39%), Positives = 37/76 (48%), Gaps = 10/76 (13%) Frame = -3 Query: 245 LVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPP----PPPPPPP------ 96 +VL +A + + +++ P P PPPP A P PP PPPPPPP Sbjct: 674 VVLPATEIKAKQEGLGDKQDFGPPPPPPPPGARSGPPPPPPPPGASAPPPPPPPGARPGA 733 Query: 95 PPRPPPPGGGGGPPAP 48 PP PPPPG G P P Sbjct: 734 PPPPPPPGSRPGAPPP 749 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/67 (46%), Positives = 33/67 (49%), Gaps = 14/67 (20%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPP-------PRPPPPGG-GGGPPA 51 SR +P PPPP A + P PPP PPPPP P P PPPPGG G PA Sbjct: 742 SRPGAPPPPPPPGARPGAPPPPPPPGGGGRGPPPPPAPGGRLGGHPPPPPPGGRAPGAPA 801 Query: 50 PRDIGGV 30 P GV Sbjct: 802 PPRAPGV 808 [104][TOP] >UniRef100_C1EC31 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EC31_9CHLO Length = 939 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/47 (55%), Positives = 31/47 (65%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG---GGGPPAP 48 P P+PPPP++ S+PSPPPPPPPP PP PPPP PP+P Sbjct: 468 PLPSPPPPSSPSPPPSSPSPPPPPPPPSPPSPPPPPSPPPSSPPPSP 514 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/52 (50%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEK-DSSAPSPPPPPP-PPPPPRPPPPGGGGGPPAPRDI 39 S+ P P PPPPAA P+PP PPP PPPPP PPP PP+P + Sbjct: 685 SQVPFPPPPPPAAPFPFPPPVPAPPSPPPSPPPPPSPPPSPPPSPPPSPLSV 736 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/46 (52%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP----PPPPPPPPRPPPPGGGGGPP 54 P P PPP + S+PSPPP PPPPPPPP PP P PP Sbjct: 461 PPPPQPPPLPSPPPPSSPSPPPSSPSPPPPPPPPSPPSPPPPPSPP 506 [105][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 P P PPPP P PPPPPPPPPPP PPPP PP P +I Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 69 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -3 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [106][TOP] >UniRef100_A3CE59 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3CE59_ORYSJ Length = 929 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/53 (52%), Positives = 33/53 (62%) Frame = -3 Query: 206 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 ++++R R P P P P A A S+ P PPP PP PPP PPPPG GGPP P Sbjct: 588 NIEKRAPRVPRPPPAPSATANTASALPPPPPRPPGAPPP-PPPPGKPGGPPPP 639 [107][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 V R P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 VASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/49 (53%), Positives = 27/49 (55%) Frame = -3 Query: 194 RRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R + P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 14 RETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/53 (49%), Positives = 27/53 (50%) Frame = -3 Query: 206 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 D +R P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 DTPVASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/57 (47%), Positives = 29/57 (50%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGVDEERNSS 9 P P PPPP P PPPPPPPPPPP PPPP A R + V+ SS Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVDAVEVAPRSS 83 [108][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP PR Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 99 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [109][TOP] >UniRef100_B4MWB5 GK14913 n=1 Tax=Drosophila willistoni RepID=B4MWB5_DROWI Length = 1089 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 5/48 (10%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 48 +P PPPP + P PPPPPP P PPP PPPPG GGGPP P Sbjct: 521 APPPPPPPMPGRGPGGPPPPPPPPMPGKAGGPPPPPPPPGMGGGPPPP 568 [110][TOP] >UniRef100_C5FD36 Proline-rich protein LAS17 n=1 Tax=Microsporum canis CBS 113480 RepID=C5FD36_NANOT Length = 633 Score = 64.3 bits (155), Expect = 4e-09 Identities = 39/99 (39%), Positives = 44/99 (44%), Gaps = 9/99 (9%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P P A SP P P+V A S + + P P PPPP Sbjct: 443 PPPPPQRSPAPPSPPPRQAPSV------SAPSHPAPPPLPTINAPVPPPPPPPPLPPTNT 496 Query: 137 SSAPSPPPPPPPPP-----PPRPPPPGG----GGGPPAP 48 +SAP+ PPPPPPPP PP PPPP GGPPAP Sbjct: 497 ASAPAAPPPPPPPPPMSGGPPAPPPPPPPLPVSGGPPAP 535 Score = 60.5 bits (145), Expect = 6e-08 Identities = 41/115 (35%), Positives = 46/115 (40%), Gaps = 18/115 (15%) Frame = -3 Query: 329 RSRLPSGVPVSICASVS----PRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPP 162 RS P P SVS P P P + A V L + AP+ PP Sbjct: 449 RSPAPPSPPPRQAPSVSAPSHPAPPPLPTINAPVPPPPPPPPLP---PTNTASAPAAPPP 505 Query: 161 PPAAAEKDSSAPSPPPPPPP---------PPPPRPPPPGGG-----GGPPAPRDI 39 PP P+PPPPPPP PPPP PPPPGG G PP D+ Sbjct: 506 PPPPPPMSGGPPAPPPPPPPLPVSGGPPAPPPPPPPPPGGSMPSLPGAPPGKDDL 560 Score = 54.7 bits (130), Expect = 3e-06 Identities = 40/108 (37%), Positives = 46/108 (42%), Gaps = 14/108 (12%) Frame = -3 Query: 329 RSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPP--- 159 RSR SG S A+ P P P T R +Q R + +P PPP Sbjct: 361 RSRAASG---SNLANPGPPPPPRPP--------KTPEDNRASIQSNR-KVSAPVPPPSRM 408 Query: 158 --PAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAP 48 P DSS+ SPPP PP PPPPP PPPP PP+P Sbjct: 409 PAPLPLRNDSSSVSPPPLPPKTPQNAHMLPPPPPPPPPPQRSPAPPSP 456 [111][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP PR Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP R Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 [112][TOP] >UniRef100_Q7SAT8 Actin cytoskeleton-regulatory complex protein pan-1 n=1 Tax=Neurospora crassa RepID=PAN1_NEUCR Length = 1533 Score = 64.3 bits (155), Expect = 4e-09 Identities = 36/79 (45%), Positives = 44/79 (55%), Gaps = 6/79 (7%) Frame = -3 Query: 266 NTPAVMALVLMG--ATSRALR*DVQERRSRAP----SPAPPPPAAAEKDSSAPSPPPPPP 105 N+ A +A +L G A R L ++ + P SP+ PPP A + SA SPPPPPP Sbjct: 1374 NSAAALASILFGTMAPPRPLSATGEKPTASTPPVVSSPSSPPPPPAPVEPSAGSPPPPPP 1433 Query: 104 PPPPPRPPPPGGGGGPPAP 48 PPP P PP P GG PP P Sbjct: 1434 PPPGP-PPAPSGGAPPPPP 1451 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/62 (50%), Positives = 33/62 (53%), Gaps = 9/62 (14%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGGGGP--PAPRDIGGV 30 AP P PPPP E + A PPPPPP P PPP PPPPGG P PA R G + Sbjct: 1446 APPPPPPPPPMPESGAPAAPPPPPPPGPPPAPGAVPPPPPPPPGGAPAPSLPAGRPAGLL 1505 Query: 29 DE 24 E Sbjct: 1506 GE 1507 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 10/54 (18%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP----------PPPPRPPPPGGGGGPPA 51 +PS PPPPA E + +P PPPPPPP PPPP PPPP G PA Sbjct: 1410 SPSSPPPPPAPVEPSAGSPPPPPPPPPGPPPAPSGGAPPPPPPPPPMPESGAPA 1463 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/56 (48%), Positives = 30/56 (53%), Gaps = 6/56 (10%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP------PPRPPPPGGGGGPPAP 48 E + +P P PPPP S +PPPPPPPPP P PPPP G PPAP Sbjct: 1422 EPSAGSPPPPPPPPPGPPPAPSGGAPPPPPPPPPMPESGAPAAPPPPPPPGPPPAP 1477 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/60 (45%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-----------PPPPPRPPPPGGGGGPPAPRDIGG 33 P P PP P A + P PPPPPP PPPPP PPP G PP P GG Sbjct: 1431 PPPPPPGPPPAPSGGAPPPPPPPPPMPESGAPAAPPPPPPPGPPPAPGAVPPPPPPPPGG 1490 [113][TOP] >UniRef100_UPI0000DD9AFA Os11g0131200 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD9AFA Length = 274 Score = 63.9 bits (154), Expect = 5e-09 Identities = 43/100 (43%), Positives = 50/100 (50%) Frame = +1 Query: 97 GGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGL 276 GGG GGGG +GA + LL +W YL ALD PI TKA+T+ VL Sbjct: 112 GGGAGGGGAKGA--------------MDWRLLLAW--YLLALDKHPITTKAVTSAVLTLT 155 Query: 277 GDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 GD + Q L + LDL R F F LVL GP H WY Sbjct: 156 GDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWY 194 [114][TOP] >UniRef100_Q2RB03 Mpv17/PMP22 family protein, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q2RB03_ORYSJ Length = 285 Score = 63.9 bits (154), Expect = 5e-09 Identities = 43/100 (43%), Positives = 50/100 (50%) Frame = +1 Query: 97 GGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGL 276 GGG GGGG +GA + LL +W YL ALD PI TKA+T+ VL Sbjct: 77 GGGAGGGGAKGA--------------MDWRLLLAW--YLLALDKHPITTKAVTSAVLTLT 120 Query: 277 GDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 GD + Q L + LDL R F F LVL GP H WY Sbjct: 121 GDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWY 159 [115][TOP] >UniRef100_B9G978 Putative uncharacterized protein n=2 Tax=Oryza sativa RepID=B9G978_ORYSJ Length = 283 Score = 63.9 bits (154), Expect = 5e-09 Identities = 43/100 (43%), Positives = 50/100 (50%) Frame = +1 Query: 97 GGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGL 276 GGG GGGG +GA + LL +W YL ALD PI TKA+T+ VL Sbjct: 77 GGGAGGGGAKGA--------------MDWRLLLAW--YLLALDKHPITTKAVTSAVLTLT 120 Query: 277 GDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGPVGHAWY 396 GD + Q L + LDL R F F LVL GP H WY Sbjct: 121 GDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWY 159 [116][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + S P PPPP PPPPPP PPPP PP P Sbjct: 150 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 193 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPP S P PPPPPPPPPPP PPPP PP P Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/49 (55%), Positives = 28/49 (57%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 42 S P P+PPPP P PPPPPPPPPPP PPPP PP P D Sbjct: 159 SPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP---PPPPPPVD 204 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + S P PPPP PPPPP PPPP PP P Sbjct: 136 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPP 179 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP + PPPPPPPPPPP PPPP PP P Sbjct: 156 PPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 199 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/46 (56%), Positives = 28/46 (60%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 42 PSP PPPP + P PPPPPPPPPPP PPPP PP R+ Sbjct: 164 PSPPPPPPPSPPPP---PPPPPPPPPPPPPPPPPPPPPPPPPVDRN 206 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP+ +P PPP PPPPPPP PPPP PP P Sbjct: 131 PPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPP 172 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/47 (51%), Positives = 25/47 (53%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P+PPPP PPPPPP PPPP PPPP PP P Sbjct: 145 SPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 191 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-PPPPPRPPPPGGGGGPPAP 48 P P+PPPP PPPPPP PPPPP PPPP PP P Sbjct: 134 PPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPP 178 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPP S P PP PPPPPPP PPPP PP P Sbjct: 144 PSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPP 187 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PP P +P PPPPP PPPPP PPPP PP P Sbjct: 123 PPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPP 164 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -3 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PPPP E P PPP PPPPPPP PPPP PP P Sbjct: 122 PPPPPEPE---CPPPPPPSPPPPPPPSPPPPPSPPPPPPP 158 [117][TOP] >UniRef100_UPI00016E8720 UPI00016E8720 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E8720 Length = 882 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 8/53 (15%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP--------PPPPRPPPPGGGGGPPAP 48 AP+P PPPP S P PPPPPPP PPPP PPPP GGGPP P Sbjct: 339 APAPPPPPPPPP-LPSGLPGPPPPPPPPLPGNMGAPPPPPPPPPLPGGGPPPP 390 Score = 63.5 bits (153), Expect = 7e-09 Identities = 32/69 (46%), Positives = 34/69 (49%), Gaps = 17/69 (24%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPG------------GGGG 60 S P P PPPP + AP PPPPPPP PPPP PPPPG G G Sbjct: 353 SGLPGPPPPPPPPLPGNMGAPPPPPPPPPLPGGGPPPPPPPPPGLPGAVPPPPPPPPGCG 412 Query: 59 PPAPRDIGG 33 PP P +GG Sbjct: 413 PPPPPPMGG 421 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/51 (52%), Positives = 28/51 (54%), Gaps = 7/51 (13%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-------PPPPPPPRPPPPGGGGGPPAP 48 P P PPPP + P PPPP PPPPPPP PP PGGG PP P Sbjct: 343 PPPPPPPPLPSGLPGPPPPPPPPLPGNMGAPPPPPPP-PPLPGGGPPPPPP 392 [118][TOP] >UniRef100_UPI00016E871F UPI00016E871F related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E871F Length = 877 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 8/53 (15%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP--------PPPPRPPPPGGGGGPPAP 48 AP+P PPPP S P PPPPPPP PPPP PPPP GGGPP P Sbjct: 343 APAPPPPPPPPP-LPSGLPGPPPPPPPPLPGNMGAPPPPPPPPPLPGGGPPPP 394 Score = 63.5 bits (153), Expect = 7e-09 Identities = 32/69 (46%), Positives = 34/69 (49%), Gaps = 17/69 (24%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPG------------GGGG 60 S P P PPPP + AP PPPPPPP PPPP PPPPG G G Sbjct: 357 SGLPGPPPPPPPPLPGNMGAPPPPPPPPPLPGGGPPPPPPPPPGLPGAVPPPPPPPPGCG 416 Query: 59 PPAPRDIGG 33 PP P +GG Sbjct: 417 PPPPPPMGG 425 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/51 (52%), Positives = 28/51 (54%), Gaps = 7/51 (13%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-------PPPPPPPRPPPPGGGGGPPAP 48 P P PPPP + P PPPP PPPPPPP PP PGGG PP P Sbjct: 347 PPPPPPPPLPSGLPGPPPPPPPPLPGNMGAPPPPPPP-PPLPGGGPPPPPP 396 [119][TOP] >UniRef100_UPI000179CB3D inverted formin 2 isoform 1 n=1 Tax=Bos taurus RepID=UPI000179CB3D Length = 1211 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/60 (50%), Positives = 33/60 (55%), Gaps = 10/60 (16%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP----------PPPRPPPPGGGGGPPAPRDIGGV 30 P P PPPP ++ PSPPPPPPPP PPP PPP G GGPP P + GV Sbjct: 444 PPPPPPPPPLPGMRAAFPSPPPPPPPPLPNSAITIPAPPPPPPPLPGLGGPPPPPPLPGV 503 Score = 60.8 bits (146), Expect = 4e-08 Identities = 36/99 (36%), Positives = 44/99 (44%), Gaps = 1/99 (1%) Frame = -3 Query: 341 NKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSP-AP 165 ++RG S SG P + +P V ++ G A + E R P P AP Sbjct: 367 SQRGSSPQNSGTPTADLGQQPAAALGSPPVASV--QGERGPAPQPTAPEPLERPPPPPAP 424 Query: 164 PPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P P PPPPPPPPPPP PP PG P+P Sbjct: 425 PLPGPTTAPRPPPPPPPPPPPPPPPPPPLPGMRAAFPSP 463 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/62 (45%), Positives = 31/62 (50%), Gaps = 6/62 (9%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGPPAPRDIGGV 30 R+ PSP PPPP + PPPPPPP PPP PP PG G P A G V Sbjct: 457 RAAFPSPPPPPPPPLPNSAITIPAPPPPPPPLPGLGGPPPPPPLPGVSGPPTA----GSV 512 Query: 29 DE 24 +E Sbjct: 513 EE 514 [120][TOP] >UniRef100_C0HAJ0 Wiskott-Aldrich syndrome protein homolog n=1 Tax=Salmo salar RepID=C0HAJ0_SALSA Length = 527 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 8/55 (14%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPR--------PPPPGGGGGPPAPRDIGG 33 PAPPP A + P+PPPPPPPPPPP PPPP G PPAP GG Sbjct: 390 PAPPPLAPSAPSRGGPAPPPPPPPPPPPAQSSGDFPPPPPPCKGPPPPAPASSGG 444 [121][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP+ PSPPPPPPPPPPP PPPP PP P Sbjct: 95 PPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPP----SPPPP 134 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 ++ P P PPPP PSPPPP PPPPPP PPPP PP P Sbjct: 87 NKVPPPPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPP----SPPPP 129 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP S P P PPPP PPPP PPPP PP+P Sbjct: 90 PPPPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPPSP 131 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 P P PPPP + S P P PPPPPPPPP P PP PP Sbjct: 93 PPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPPSPPPP 134 [122][TOP] >UniRef100_B4YB55 BimA n=1 Tax=Burkholderia pseudomallei RepID=B4YB55_BURPS Length = 369 Score = 63.9 bits (154), Expect = 5e-09 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P+ PPPP ++ P PPPPPPPPPPP PPPP PP P Sbjct: 80 PNKVPPPPPPPPSTTTPPPPPPPPPPPPPPPPPPPSTTPSPPPP 123 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/43 (51%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPP-----PRPPPP 75 ++ P P PPPP+ P PPPPPPPPPP P PPPP Sbjct: 81 NKVPPPPPPPPSTTTPPPPPPPPPPPPPPPPPPPSTTPSPPPP 123 [123][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP+ P PPPPPPPPPPP PPPP PP P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP + P PPPPPPPPPPP PPPP PP P Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP S P PPPPPPPPPPP PPPP PP P Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP+P Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP PSPPPPPP PPPP PPPP PP P Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPP 253 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP+P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 P P PPPP PSPPPPPPPPPPP PPPP PP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP S P PPPPPPPPPPP PPPP PP P Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP-----PPPP 701 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P P PPPPPPPPPPP PPPP PP P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P P PPPPPPPPPPP PPPP PP P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P PPP P PPPPPPPPPPP PPPP PP P Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP +P PPPPPPPPPPP PPPP PP P Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP-----PPPP 700 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPP PP P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PP P PP P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP P PP PP P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PP P PP P Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPP PPPP PP P Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/50 (52%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP------PPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP +P PPPP PPPPPPP PPPP PP P Sbjct: 212 PSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPP PP PPPP PP P Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPP PPPP PPPP PP P Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPP PPPPP PPPP PP P Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPP----PPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPP PPPPPP PPPP PP P Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPP PPPPPPP PPPP PP P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 [124][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R P P+PPPP+ +P PPP PPPPPPPRPPPP PP P Sbjct: 319 RPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPP----SPPPP 360 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPPPPP PPPP PP P Sbjct: 236 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 280 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/50 (56%), Positives = 30/50 (60%), Gaps = 4/50 (8%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 R P P+PPPP+ PSPPPPPP PPPPPRPPPP PP P Sbjct: 351 RPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP----SPPPP 396 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPPPPPRPPPP PP P Sbjct: 288 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPP----SPPPP 328 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 PSP PP P S P PPP PPPPPPPRPPPP PP Sbjct: 253 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPP 294 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP P PPPP PP P Sbjct: 231 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 274 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPPPP PPPPP PPPP PP P Sbjct: 241 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPP 288 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPPPPP PPPP PPPP PP P Sbjct: 293 PPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R P P+PPPP+ S P PPP PPPPPPPRPPPP PP P Sbjct: 387 RPPPPSPPPPSPPPP-SPPPPPPPSPPPPPPPRPPPP----SPPPP 427 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAPR 45 PSP PPPP PSPPPP PPPPPPP PPPP PP PR Sbjct: 310 PSPPPPPPPRPPP----PSPPPPSPPPPPPPSPPPPPSPPPPPPPR 351 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAP-SPPPPPPPPPPPRPPPPGGGGGPPAPR 45 PSP PPPP S P SPPPP PPPP P PPPP PP PR Sbjct: 342 PSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPR 387 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP+ PSPPPP PPPPPP PPP PP P Sbjct: 348 PPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 391 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PP PPPP PPPP PP P Sbjct: 226 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 272 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 PSP PPPP PSPPPP PPPP P PPPP PP PR Sbjct: 378 PSPPPPPPPRPPP----PSPPPPSPPPPSPPPPPPPSPPPPPPPR 418 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ P PP PPPPPPP PPPP PP P Sbjct: 246 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPP 289 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAP 48 S P P+PPPP +P PP PPPP PPPP PPPP PP P Sbjct: 337 SPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 384 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP P PP P PP P Sbjct: 221 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 264 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + S P PPPP PPPP PP P PP PP+P Sbjct: 328 PSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSP 372 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 191 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 235 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 196 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 240 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 201 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 245 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 206 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 250 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 211 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 255 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 216 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 260 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP S P PPP PPPPPPP PPPP PP P Sbjct: 266 PSPPPPPPP-----SPPPPPPPRPPPPPPPSPPPP----SPPPP 300 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 S+A P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 183 SQANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 230 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/42 (52%), Positives = 25/42 (59%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 261 PPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSP 302 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP + S P PPPP PPPP PPPP PP+P Sbjct: 282 PRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSP 325 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ +P PPPPP PPPP PPP PP P Sbjct: 363 PPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP 406 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ +P PPPPP PPPP PPP PP P Sbjct: 394 PPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP 437 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PPPPPPP PP P PP PP+P Sbjct: 264 PPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSP 307 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP PPPPPP PPPP PPPP PP P Sbjct: 326 PPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPP----SPPPP 365 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PPPPPPP PP PPPP PP P Sbjct: 256 PPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPP----SPPPP 295 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP +P PP PPPP PPP PPP PP P Sbjct: 376 PPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRP 419 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P S P PPP PPPP PP P PP PP+P Sbjct: 396 PSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSP 439 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/46 (52%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP--PPPPRPPPPGGGGGPPAP 48 PSP PPPP + PPP PPP PPPP PPPP PP P Sbjct: 370 PSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPP 415 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P PPPP +P PP PPPP PPP PPP PP PR Sbjct: 277 PPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPR 319 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/44 (50%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP +P PP PPPP PPP PPP PP P Sbjct: 280 PPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPP 323 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/48 (47%), Positives = 25/48 (52%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R P P PPP + S P PPPP PPPPP P PP PP+P Sbjct: 283 RPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSP 330 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P S P PPP PPPP PP P PP PP P Sbjct: 365 PSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPP 408 [125][TOP] >UniRef100_B8B832 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B832_ORYSI Length = 1521 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP S AP PPPPPP PPPP PPPPG GPP P Sbjct: 934 APPPPPPPPITR---SGAPPPPPPPPGPPPP-PPPPGARPGPPPP 974 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/63 (49%), Positives = 33/63 (52%), Gaps = 14/63 (22%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP------PPPPPP-------PPRPPPPGGGG-GPPAPRD 42 P P PPPP + S+ P PPP PPPPPP PP PPPPG GG PP P Sbjct: 982 PGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPA 1041 Query: 41 IGG 33 GG Sbjct: 1042 PGG 1044 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 9/57 (15%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKD---SSAPSPPPPPPPP-----PPPRPPPPGG-GGGPPAP 48 RS AP P PPPP + P PPPPPPPP PPP PPPPGG PP P Sbjct: 945 RSGAPPPPPPPPGPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLP 1001 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 12/62 (19%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPP------PRPPPPGGGGGPPAPRD 42 RA +P PPPP + + P PPP PPPPP P P PPPP GG PP PR Sbjct: 1006 RASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRG 1065 Query: 41 IG 36 G Sbjct: 1066 PG 1067 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 6/54 (11%) Frame = -3 Query: 191 RSRAPS---PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG---GGGPPAP 48 RS P+ P PPPP + S AP PPPPPPPPPPP P P PP P Sbjct: 831 RSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPP 884 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/67 (44%), Positives = 33/67 (49%), Gaps = 16/67 (23%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP------------PPPPRPPPPG----G 69 Q RR + +PPPP A S+ PPPPPPP PPPP PPPP G Sbjct: 759 QRRRQHTTTLSPPPPPPASSGLSSIPPPPPPPPLMSFGAQTRTFVPPPPPPPPPPRSGVG 818 Query: 68 GGGPPAP 48 G PPAP Sbjct: 819 GNTPPAP 825 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 13/60 (21%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPS-------PPPPPPP------PPPPRPPPPGGGGGPPAP 48 S AP P PPPP SAPS PPPPPPP PPPP PPP PP P Sbjct: 852 SGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPP 911 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSP------PPPPPPPPPPRPPPPGGGGGPPAP 48 R AP P PPP A P+P PPPPPPP PPPP G G PP P Sbjct: 1019 RLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAPPPP 1072 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/57 (47%), Positives = 28/57 (49%), Gaps = 13/57 (22%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP------PPPPPPP--RP-----PPPGGGGGPPAP 48 P P PPPP + P PPPP PPPPPPP RP PPPGG P P Sbjct: 956 PGPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPP 1012 [126][TOP] >UniRef100_A7S4U2 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S4U2_NEMVE Length = 448 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/50 (60%), Positives = 32/50 (64%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 48 PS AP P +D SAP+PPPPPPP PPPP PPPPG GG PP P Sbjct: 257 PSIAPSVP----QDGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 302 [127][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 Q+++ + P P PPPP A S P PPPPPPPPPPP PPPP PAP Sbjct: 35 QKQQQQQPPPPPPPPPA----SPPPPPPPPPPPPPPPPPPPPPEPEPQPAP 81 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/51 (47%), Positives = 29/51 (56%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 ++++ + P PPPP A P PPPPPPPPPPP PP P PP P Sbjct: 34 EQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 [128][TOP] >UniRef100_C6HS16 Actin associated protein Wsp1 n=1 Tax=Ajellomyces capsulatus H143 RepID=C6HS16_AJECH Length = 610 Score = 63.9 bits (154), Expect = 5e-09 Identities = 43/114 (37%), Positives = 49/114 (42%), Gaps = 19/114 (16%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPA----A 150 P VPV + +P PT+TPA A A S +P+P PPPP A Sbjct: 386 PQTVPVPLPVRPAPPPTSTPAPPPPPPAPAPGPA--------PSSSPTPPPPPPPLPAPA 437 Query: 149 AEKDSSAPSPPPPPPP-------PP--------PPRPPPPGGGGGPPAPRDIGG 33 S+ P PPPPPPP PP PP PPPP GG PP P G Sbjct: 438 PAPASTGPVPPPPPPPTTGLPRPPPRSAPSNSVPPPPPPPSGGAPPPPPPPSAG 491 Score = 55.5 bits (132), Expect = 2e-06 Identities = 36/96 (37%), Positives = 40/96 (41%), Gaps = 6/96 (6%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P P AS P P P T+ R + S + P PPPP+ Sbjct: 432 PLPAPAPAPASTGPVPPPPPP--------PTTGLPRPPPRSAPSNSVPPPPPPPSGG--- 480 Query: 137 SSAPSPPPPPP---PPPPPRPPPPG---GGGGPPAP 48 AP PPPPP PPPPP PPPPG GPP P Sbjct: 481 --APPPPPPPSAGAPPPPPPPPPPGSAANSAGPPPP 514 [129][TOP] >UniRef100_C0SGP4 Cytokinesis protein sepA n=1 Tax=Paracoccidioides brasiliensis Pb03 RepID=C0SGP4_PARBP Length = 1805 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/59 (49%), Positives = 34/59 (57%), Gaps = 4/59 (6%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAPRDIG 36 +E+ P+PPPPA + P PPPPPPP PPPP PPPPG G PP P +G Sbjct: 1044 KEKVDATGPPSPPPPA-----TGGPPPPPPPPPGIGTPPPPPPPPPGAGPPPPPPPGVG 1097 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/58 (48%), Positives = 28/58 (48%), Gaps = 14/58 (24%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP--------------PPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPP PPPP PPPPG GG PP P Sbjct: 1064 PPPPPPPPGIG-----TPPPPPPPPPGAGPPPPPPPGVGSPPPPPPPPPGMGGPPPPP 1116 [130][TOP] >UniRef100_C0NQ83 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NQ83_AJECG Length = 642 Score = 63.9 bits (154), Expect = 5e-09 Identities = 37/95 (38%), Positives = 44/95 (46%), Gaps = 4/95 (4%) Frame = -3 Query: 320 LPSGVPVSICASVSPRP----TNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPA 153 LP +P + PRP T+TP L+ L + AP+P PPPPA Sbjct: 388 LPPKIPHATPPPPPPRPQASPTSTPQSQHLLPPQTVPVPLPVRPAPPPTSAPAPPPPPPA 447 Query: 152 AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 A + SP PPPPPPPPP P P G PP P Sbjct: 448 PAPGPVPSSSPTPPPPPPPPPAPAPASTGPVPPPP 482 Score = 59.7 bits (143), Expect = 1e-07 Identities = 42/129 (32%), Positives = 47/129 (36%), Gaps = 25/129 (19%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P VPV + +P PT+ PA A S P P PPPP A Sbjct: 420 PQTVPVPLPVRPAPPPTSAPAPPPPPPAPAPGPV------PSSSPTPPPPPPPPPAPAPA 473 Query: 137 SSAPSPPPPPPP--------------------PPPPR-----PPPPGGGGGPPAPRDIGG 33 S+ P PPPPPPP PPPP PPPP G PP P Sbjct: 474 STGPVPPPPPPPTTGLPRPPPRSAPSNSVPPPPPPPSGGAPPPPPPPSAGAPPPPPPPPP 533 Query: 32 VDEERNSSG 6 NS+G Sbjct: 534 PGSAANSAG 542 Score = 55.1 bits (131), Expect = 2e-06 Identities = 36/96 (37%), Positives = 40/96 (41%), Gaps = 6/96 (6%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P P AS P P P T+ R + S + P PPPP+ Sbjct: 464 PPPPPAPAPASTGPVPPPPPP--------PTTGLPRPPPRSAPSNSVPPPPPPPSGG--- 512 Query: 137 SSAPSPPPPPP---PPPPPRPPPPG---GGGGPPAP 48 AP PPPPP PPPPP PPPPG GPP P Sbjct: 513 --APPPPPPPSAGAPPPPPPPPPPGSAANSAGPPPP 546 [131][TOP] >UniRef100_B6Q8P3 Actin cortical patch assembly protein Pan1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q8P3_PENMQ Length = 1446 Score = 63.9 bits (154), Expect = 5e-09 Identities = 36/76 (47%), Positives = 36/76 (47%), Gaps = 17/76 (22%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSS-------------APSPPPPPPPP----PPPRPPPP 75 VQE A P PPPP A E S AP PPPPPPPP PPP PPPP Sbjct: 1339 VQESSPTALPPPPPPPPAEEAPISPESETPVTVAAPAAPPPPPPPPPPGAAAPPPPPPPP 1398 Query: 74 GGGGGPPAPRDIGGVD 27 GGPP GG D Sbjct: 1399 PPTGGPPPALGGGGTD 1414 [132][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 Q+++ + P P PPPP A S P PPPPPPPPPPP PPPP PAP Sbjct: 35 QKQQQQQPPPPPPPPPA----SPPPPPPPPPPPPPPPPPPPPPEPEPQPAP 81 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/51 (47%), Positives = 29/51 (56%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 ++++ + P PPPP A P PPPPPPPPPPP PP P PP P Sbjct: 34 EQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 [133][TOP] >UniRef100_A5DKC7 Putative uncharacterized protein n=1 Tax=Pichia guilliermondii RepID=A5DKC7_PICGU Length = 270 Score = 63.9 bits (154), Expect = 5e-09 Identities = 39/98 (39%), Positives = 43/98 (43%), Gaps = 5/98 (5%) Frame = -3 Query: 326 SRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPS-----PAPP 162 +R PS VP S V P P VL G + + S APS APP Sbjct: 97 NRAPSPVPTSPAPPVPSAPPPLPGAPPPVLGGGS----------KSSAAPSVPSFPSAPP 146 Query: 161 PPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P A AP+P PP PPPPP PP PG PPAP Sbjct: 147 PAPKATPALKAPAPAAPPAPPPPPAPPAPGMSSAPPAP 184 [134][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/47 (59%), Positives = 29/47 (61%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 SR PSP PP P +PSPPPPPPPPPPP PPPP PP P Sbjct: 239 SRPPSP-PPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP S P PPPPPPPPPPP PP P PP+P Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/93 (37%), Positives = 42/93 (45%), Gaps = 5/93 (5%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAP-----PPPA 153 P+G+ + P P N+P + A+SR R P P+P PPP Sbjct: 209 PTGLSGPNVNPIGPAPNNSPLPPS-PQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPP 267 Query: 152 AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 PSPPPPPPPPPPP PPPP PP Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/48 (52%), Positives = 28/48 (58%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R +P P+P PP+ S P PPPPPPPPPPP PP P PP P Sbjct: 240 RPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPP-PPPPPPPPPRPPPPGGGGGPPAPR 45 PSP+PPPP P PP PPPPPPPPP PPPP P PR Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPR 301 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/47 (51%), Positives = 25/47 (53%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S +P P PPPP PPPPPPPPPPP PPPP P P Sbjct: 257 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKP 303 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP + P PPPPPPPPP P PP PP P Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVP 311 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/45 (51%), Positives = 24/45 (53%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 A S P PP + S P P PPPPPPPP PPPP PP P Sbjct: 237 ASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPP 281 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/42 (52%), Positives = 25/42 (59%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P+P P A++ S PSP PP PPPP P PPPP PP P Sbjct: 231 PSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPP 272 [135][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/51 (52%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 + + + PSP PPPP + S PSPPPP PPPPPPP PPPP P+P Sbjct: 144 QSQCKLPSPPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSP 194 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP PSPPPP PPPP P PPPP PP P Sbjct: 172 PSPPPPPP---------PSPPPPSPPPPSPSPPPPPASPPPPPP 206 [136][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 63.5 bits (153), Expect = 7e-09 Identities = 36/87 (41%), Positives = 40/87 (45%), Gaps = 10/87 (11%) Frame = -3 Query: 278 PRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP- 102 P P P L + ++S R P P PPPP+ A K SAP PPPPPPP Sbjct: 659 PPPPPPPPAPPLPMFSSSSSTSR-SSSSHGVPPPHPPPPPPSLAPKPPSAPPPPPPPPPA 717 Query: 101 ------PPPPRPPPPGG---GGGPPAP 48 PPPP PPPP G PP P Sbjct: 718 PKPPGAPPPPPPPPPTTKPLGAHPPPP 744 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/114 (32%), Positives = 51/114 (44%), Gaps = 28/114 (24%) Frame = -3 Query: 305 PVSICASVSPR----PTNTPAVMALVLMGAT-----SRALR*DVQERRSRAPSPAPPPPA 153 P +I +++P+ P++ P + L G+ S A ++ + P P PPPP Sbjct: 512 PFAISGTIAPQAASLPSSAPPPLPPPLPGSALSMSQSYASNRNLLPPSTSTPPPPPPPPI 571 Query: 152 AAEKDSSAPSPPPPPP-------------------PPPPPRPPPPGGGGGPPAP 48 ++ K S P PPPPPP PPPPP PPPP G PP P Sbjct: 572 SSNKAPSPPPPPPPPPLPNVSNGNPLMPPTPASRGPPPPPPPPPPLPGPSPPPP 625 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP A K AP PPP PP PPP PP P G PP P+ Sbjct: 742 PPPPPPPPPPAPKPPGAPPPPPKPPSAPPPPPPKPPGAPPPPPPK 786 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP + + PPPPPPPPPPP P PPG PP P Sbjct: 723 APPPPPPPPPTTKPLGA--HPPPPPPPPPPPAPKPPGAPPPPPKP 765 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/57 (47%), Positives = 28/57 (49%), Gaps = 10/57 (17%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPP----------PPPPPPPRPPPPGGGGGPPAP 48 S P P PPPPA + P PPPP PPPPPPP PP P G PP P Sbjct: 706 SAPPPPPPPPPAPKPPGAPPPPPPPPPTTKPLGAHPPPPPPPPPPPAPKPPGAPPPP 762 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/58 (44%), Positives = 29/58 (50%), Gaps = 12/58 (20%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP------------PPPPPRPPPPGGGGGPPAPR 45 AP P PPPP A + + P PPPPPP PPPPP P P G PP P+ Sbjct: 707 APPPPPPPPPAPKPPGAPPPPPPPPPTTKPLGAHPPPPPPPPPPPAPKPPGAPPPPPK 764 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/69 (42%), Positives = 31/69 (44%), Gaps = 12/69 (17%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP------------PPPRPPPPGGGGGPPAPRDIG 36 PSP PPPP S+ PPPPPPPP PPP PPPP PP P Sbjct: 620 PSPPPPPPPPPPTSISSKGPPPPPPPPDFSSSSSNKPTLPPPPPPPP----APPLPMFSS 675 Query: 35 GVDEERNSS 9 R+SS Sbjct: 676 SSSTSRSSS 684 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/59 (44%), Positives = 28/59 (47%), Gaps = 15/59 (25%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP---------PPPPPR------PPPPGGGGGPPAP 48 P P PPPP + P PPPPPP PPPPP+ PPPP G PP P Sbjct: 725 PPPPPPPPTTKPLGAHPPPPPPPPPPPAPKPPGAPPPPPKPPSAPPPPPPKPPGAPPPP 783 Score = 53.9 bits (128), Expect = 5e-06 Identities = 34/88 (38%), Positives = 37/88 (42%), Gaps = 7/88 (7%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P P+S + SP P P + V G L R P P PPPP Sbjct: 566 PPPPPISSNKAPSPPPPPPPPPLPNVSNG---NPLMPPTPASRGPPPPPPPPPPLPG--- 619 Query: 137 SSAPSPPPPPPPPPP-------PRPPPP 75 PSPPPPPPPPPP P PPPP Sbjct: 620 ---PSPPPPPPPPPPTSISSKGPPPPPP 644 [137][TOP] >UniRef100_UPI0001796B35 PREDICTED: formin-like 1 n=1 Tax=Equus caballus RepID=UPI0001796B35 Length = 1136 Score = 63.5 bits (153), Expect = 7e-09 Identities = 40/109 (36%), Positives = 47/109 (43%), Gaps = 5/109 (4%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P+ PV A P P + P + +L QE AP PAPP P + E Sbjct: 567 PAAEPVPGAAPPPPPPPSPPPLPSLPSQ-----------QEAPPLAPPPAPPLPGSPE-- 613 Query: 137 SSAPSPPPP-----PPPPPPPRPPPPGGGGGPPAPRDIGGVDEERNSSG 6 P PPPP PPPPPPP PPP G PP P +GG + G Sbjct: 614 ---PPPPPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPLGGPSDALGRPG 659 [138][TOP] >UniRef100_UPI0000F2E99A PREDICTED: similar to diaphanous homolog 2 (Drosophila), n=1 Tax=Monodelphis domestica RepID=UPI0000F2E99A Length = 1133 Score = 63.5 bits (153), Expect = 7e-09 Identities = 31/68 (45%), Positives = 34/68 (50%), Gaps = 15/68 (22%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGG--------GGPP 54 S P P PPPP + P PPPPPPP PPPP PP PGG GGPP Sbjct: 547 SPPPPPPPPPPPLVPGGAVPPPPPPPPPPPPLPGGIPPPPPPPLPGGAVPPPPPLFGGPP 606 Query: 53 APRDIGGV 30 P +GG+ Sbjct: 607 PPPPLGGI 614 [139][TOP] >UniRef100_UPI0000E2C133 conserved hypothetical protein n=1 Tax=Aspergillus terreus NIH2624 RepID=UPI0000E2C133 Length = 1608 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = -3 Query: 182 APSPAPPPPA-AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP AA + SA +PPPPPPPP PP PPP G PP P Sbjct: 1519 APPPPPPPPVPAAAPNGSAGAPPPPPPPPAPPMAPPPPPAGVPPPP 1564 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSA--PSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PP PAAA S+ P PPPPP PP P PPPP G PPAP Sbjct: 1522 PPPPPPVPAAAPNGSAGAPPPPPPPPAPPMAP-PPPPAGVPPPPAP 1566 [140][TOP] >UniRef100_UPI00016E10B6 UPI00016E10B6 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B6 Length = 1270 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP + + PPPPPPPPPP PPPPG G PP P Sbjct: 682 APPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPP 726 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPP------RPPPPGGGGGPPAP 48 P P PPPP ++P PPPPPPPPPPP PPPP G P AP Sbjct: 686 PPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAP 735 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPR 45 P P PPPPA P PPPPPPPPP PP PPPP G P + Sbjct: 690 PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQK 738 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 9/53 (16%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPP---------PPPPPPPPPRPPPPGGGGGPPAP 48 P+P PPPP P PP PPPPPPPPP PPPP G GPP P Sbjct: 681 PAPPPPPPP--------PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPP 725 [141][TOP] >UniRef100_UPI00016E10B5 UPI00016E10B5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B5 Length = 1246 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP + + PPPPPPPPPP PPPPG G PP P Sbjct: 658 APPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPP 702 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPP------RPPPPGGGGGPPAP 48 P P PPPP ++P PPPPPPPPPPP PPPP G P AP Sbjct: 662 PPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAP 711 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPR 45 P P PPPPA P PPPPPPPPP PP PPPP G P + Sbjct: 666 PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQK 714 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P+P P PP A AP PPPPPPPPPP PPPP PP P Sbjct: 642 PAPPPLPPGAG---LGAPPAPPPPPPPPPPPPPPPALLASPPPP 682 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 9/53 (16%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPP---------PPPPPPPPPRPPPPGGGGGPPAP 48 P+P PPPP P PP PPPPPPPPP PPPP G GPP P Sbjct: 657 PAPPPPPPP--------PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPP 701 [142][TOP] >UniRef100_UPI00016E10B4 UPI00016E10B4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B4 Length = 1323 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP + + PPPPPPPPPP PPPPG G PP P Sbjct: 735 APPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPP 779 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPP------RPPPPGGGGGPPAP 48 P P PPPP ++P PPPPPPPPPPP PPPP G P AP Sbjct: 739 PPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAP 788 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPR 45 P P PPPPA P PPPPPPPPP PP PPPP G P + Sbjct: 743 PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQK 791 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P+P P PP A AP PPPPPPPPPP PPPP PP P Sbjct: 719 PAPPPLPPGAG---LGAPPAPPPPPPPPPPPPPPPALLASPPPP 759 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 9/53 (16%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPP---------PPPPPPPPPRPPPPGGGGGPPAP 48 P+P PPPP P PP PPPPPPPPP PPPP G GPP P Sbjct: 734 PAPPPPPPP--------PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPP 778 [143][TOP] >UniRef100_UPI00016E10A1 UPI00016E10A1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10A1 Length = 1396 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP + + PPPPPPPPPP PPPPG G PP P Sbjct: 808 APPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPP 852 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPP------RPPPPGGGGGPPAP 48 P P PPPP ++P PPPPPPPPPPP PPPP G P AP Sbjct: 812 PPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAP 861 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPR 45 P P PPPPA P PPPPPPPPP PP PPPP G P + Sbjct: 816 PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQK 864 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 9/53 (16%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPP---------PPPPPPPPPRPPPPGGGGGPPAP 48 P+P PPPP P PP PPPPPPPPP PPPP G GPP P Sbjct: 807 PAPPPPPPP--------PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPP 851 [144][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP + P PPPPPPPPPPP PPPP PP P Sbjct: 53 PPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 51 PPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 57 PPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 71 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPP 72 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPP 73 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 52 PPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 54 PPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 66 PCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 109 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP PR Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP----PPPPPR 65 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 55 PPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPPRP PP PP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPP 78 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 56 PPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PP P P PPPPPPPPPPP PPPP PP PR Sbjct: 59 PPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP R Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPAR 112 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/47 (55%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPR---PPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPPR PPPP PP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCP 119 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPP P PPPPPPPPPPP PPPP PP P Sbjct: 58 PPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPP PP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PP P PP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPP 75 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPP P PPPP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPP 80 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P P PPPPPPPPP PPPP PP P Sbjct: 47 PPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 64 PRPCPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPPPPRP 104 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRP---PPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP P PPP PP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPP 79 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPP PPP PPPP PP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPP---PPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPP PPPPPP PPPP PP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPP 87 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPP PPPPPPP PPPP PP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPP 88 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP---PPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPP PPPPPPPP PPPP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -3 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P A E+ P PPPPPPPPPPP PPPP PP P Sbjct: 13 PYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 [145][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAP---SPPPPPPPPPPPRPPPPGGGGGPPAPR 45 S P P+PPPP + S P SPPPPP PPPPP PPPP PP+PR Sbjct: 536 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPR 586 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/46 (54%), Positives = 27/46 (58%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R P P+PP P PSPPPPP PPPPP PPPP PP+P Sbjct: 516 RPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 561 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/49 (55%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -3 Query: 191 RSRAPSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R PSP PPP P PSPPPPP PPPPP PPPP PP+P Sbjct: 519 RPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 567 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAP---SPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P+PPPP + S P SPPPPP PPPPP PPPP PP+P Sbjct: 524 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 573 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAP---SPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P+PPPP + S P SPPPPP PPPPP PPPP PP+P Sbjct: 542 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSP 591 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/46 (58%), Positives = 28/46 (60%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R PSP PP P S PSPPPPP PPPPP PPPP PP+P Sbjct: 511 RPPSPRPPRP-------SPPSPPPPPSPPPPPSPPPPPSPPPPPSP 549 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAP 48 S P P+PPPP + S P PP PPP PPPPP PPPP PP+P Sbjct: 530 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 579 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/45 (51%), Positives = 25/45 (55%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 S P P+PPPP + S P PP PPPPP PP PP P PP Sbjct: 548 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPP 592 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/48 (47%), Positives = 26/48 (54%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 S P P+PPPP + S P PP PPPPP P PP P PP P+ Sbjct: 554 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQ 601 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/47 (48%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 SP PP P +P PPP PP PPPPP PPPP PP+P Sbjct: 509 SPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 555 [146][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP S P PPPPPPPP PP PPPP PP P Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPP 268 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/44 (61%), Positives = 28/44 (63%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP PSPPPPPPPPPPP PPPP PP+P Sbjct: 215 PSPPPPPPPPPP-----PSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP S P PPPPPPPP PP PPPP PP P Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPP PPPP PPPP PP P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P P PPPP P PPPP PPPPPP PPPP PP P Sbjct: 216 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPP PPPPPP PPPP PP P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP S P PPPPPPP PPP PPPP PP P Sbjct: 227 PSPPPPPPPPPPP-SPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P PPPP + PSP PPPPPP P PPPP PPAP Sbjct: 240 SPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAP 286 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/47 (51%), Positives = 26/47 (55%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P PPPP + P PP PPPPPPPP PP P PP+P Sbjct: 216 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/52 (48%), Positives = 27/52 (51%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 V E + P P PPPP+ P P PPPPPPPPP P PP PP P Sbjct: 200 VVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPP--PRPPPPGGGGGPPAP 48 S P P PPPP + P PP PPPPPPP P PPPP PP P Sbjct: 228 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP PSPPPPPPPP P PPPP PP P Sbjct: 239 PSPPPPPPPPPP-----PSPPPPPPPPSPSPPPPPPSPSPPPPP 277 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP S P PPPPP P PPP PP P PP P Sbjct: 237 PPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPP 280 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSP-PPPPPPPPP---PRPPPPGGGGGPPAP 48 P P PPPP+ P P PPPPPPPPP P PPPP PP P Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPP 75 PSP+PPPP + PSPPPPPPPP PP PPP Sbjct: 260 PSPSPPPPPPS------PSPPPPPPPPSPPPAPPP 288 [147][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/51 (52%), Positives = 30/51 (58%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 Q R+S PSP PP P + S P PPPPP PPPPP PP P PP+P Sbjct: 782 QARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSP 832 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/47 (51%), Positives = 27/47 (57%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P+PPPP P+PP PP PPPPP PPPP PP+P Sbjct: 798 SPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSP 844 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/47 (51%), Positives = 26/47 (55%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P PP P + PSPPPPP PPPPP PPP PP+P Sbjct: 804 SPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSP 850 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPP--PPPPPPRPPPPGGGGGPPAP 48 S P+P+PPPP AP+PPPPP PP PPP PPPP PP+P Sbjct: 849 SPPPAPSPPPPP---NPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSP 894 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/44 (50%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P +PPPP+ + S P+P PPPPP PPP P PP PP+P Sbjct: 835 PPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSP 878 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = -3 Query: 182 APSPAPPP---PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 APSP PPP PA +P P PPP PPPPP PPPP P+P Sbjct: 853 APSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSP 900 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP+ SS P P P PPP PPP P PP PPAP Sbjct: 824 PSP-PPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAP 866 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP+PPP P A P+PPP P PPPPP PPP PP P Sbjct: 842 PSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPP 886 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAP 48 S P P+PPPP ++ S PP PPP PPPPP PPP PP+P Sbjct: 825 SPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSP 874 [148][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP PSPPPPPPPPPPP PPPP PP P Sbjct: 257 PSPPPPPP---------PSPPPPPPPPPPPPPPPPPPSPSPPPP 291 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/50 (54%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAP------SPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP+PPPP + S P SPPPPPPP PPP PPPP PP P Sbjct: 234 PSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPP 283 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 PSP PP P P PPPPPPPPPP PPPP P P ++ Sbjct: 247 PSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPPPEL 293 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/51 (50%), Positives = 27/51 (52%), Gaps = 7/51 (13%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-------PPPPPPPRPPPPGGGGGPPAP 48 PSP PP P+ S AP PPP PPPPPPP PPPP PP P Sbjct: 229 PSPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPP 279 [149][TOP] >UniRef100_A2F983 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2F983_TRIVA Length = 2086 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/49 (55%), Positives = 30/49 (61%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIG 36 AP+ + P P AE +SAP PPPPPPPP P PPPP GG P P G Sbjct: 1944 APTSSEPAPPPAEVSASAPPPPPPPPPPGTPLPPPPPAAGGAPPPPPSG 1992 [150][TOP] >UniRef100_A0E3T6 Chromosome undetermined scaffold_77, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0E3T6_PARTE Length = 1215 Score = 63.5 bits (153), Expect = 7e-09 Identities = 29/61 (47%), Positives = 36/61 (59%), Gaps = 4/61 (6%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPRDIGGVDE 24 ++ AP P PPPP + + AP PPPPPPPP PP PPPP GG PP P +G + Sbjct: 670 KNGAPPPPPPPPPSR---NGAPPPPPPPPPPSKTGAPPPPPPPRIGGAPPPPPPLGNNQQ 726 Query: 23 E 21 + Sbjct: 727 Q 727 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/56 (50%), Positives = 30/56 (53%), Gaps = 7/56 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAPRDIGG 33 P P PPPP K+ + P PPPPPP PPPPP PP G PP P IGG Sbjct: 658 PPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPPRIGG 713 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/59 (45%), Positives = 29/59 (49%), Gaps = 7/59 (11%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGGGGPPAP 48 VQ + + P PPPP P PPPPPPP PPPP PPPP G PP P Sbjct: 633 VQNQATALLPPPPPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPP 691 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/54 (46%), Positives = 28/54 (51%), Gaps = 7/54 (12%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAP 48 ++ P P PPPP + PPPPPP PPPPP PPPP G PP P Sbjct: 653 TQVPPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPP 706 [151][TOP] >UniRef100_A0BLV2 Chromosome undetermined scaffold_115, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BLV2_PARTE Length = 1084 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPP-----PRPPPPGGGGGPPAP 48 AP P PPPP S +PPPPPPPPPP P PPPP GG PP P Sbjct: 565 APPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPPP 614 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/61 (49%), Positives = 32/61 (52%), Gaps = 11/61 (18%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-----------PPPPPRPPPPGGGGGPPAPRDIGG 33 P P PPPP +AP PPPPPP PPPPP PPPPGG PP P GG Sbjct: 549 PPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGG 608 Query: 32 V 30 + Sbjct: 609 M 609 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/65 (47%), Positives = 32/65 (49%), Gaps = 15/65 (23%) Frame = -3 Query: 182 APSP---APPPPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGG------PPAP 48 AP+P APPPP P PPPPP PPPPPP PPPP GG PP P Sbjct: 540 APNPPQIAPPPPP--------PPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPP 591 Query: 47 RDIGG 33 GG Sbjct: 592 PPPGG 596 [152][TOP] >UniRef100_Q5KG31 Putative uncharacterized protein n=1 Tax=Filobasidiella neoformans RepID=Q5KG31_CRYNE Length = 464 Score = 63.5 bits (153), Expect = 7e-09 Identities = 41/124 (33%), Positives = 46/124 (37%), Gaps = 7/124 (5%) Frame = -3 Query: 383 PTGPWRTSTNAAKLNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*D 204 P P + A RS PS V SV P P P G + Sbjct: 244 PPAPPTSRRKPAPPPPASRSARPSSVAQPSAPSVPPPPPPPPPP------GRPAAPPSAP 297 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGGGGPPAPR 45 + P P PPPP ++ AP PPPPPPP PPPP PPP PP P Sbjct: 298 PSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPPPPPTSAPSAPPLPT 357 Query: 44 DIGG 33 GG Sbjct: 358 ASGG 361 [153][TOP] >UniRef100_C5PBJ8 WH2 motif family protein n=1 Tax=Coccidioides posadasii C735 delta SOWgp RepID=C5PBJ8_COCP7 Length = 1486 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 P P PPP E + AP PPPPPPPPP PPPPGG PP Sbjct: 1392 PPPPPPPMPGMEASTGAPPPPPPPPPPPGDAPPPPGGAPPPP 1433 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP ++S +PPPPPPPPPPP PP GG PP P Sbjct: 1392 PPPPPPPMPGMEASTGAPPPPPPPPPPPGDAPPPPGGAPPPP 1433 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/47 (51%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRP---PPPGGGGGPPAP 48 P PPPP A + PPPPPPPPP P PPP GG PP P Sbjct: 1388 PPSIPPPPPPPMPGMEASTGAPPPPPPPPPPPGDAPPPPGGAPPPPP 1434 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/49 (48%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAP 48 P P PP P + P PPPPPP PPPP PPP G PPAP Sbjct: 1393 PPPPPPMPGMEASTGAPPPPPPPPPPPGDAPPPPGGAPPPPPGPPPPAP 1441 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/50 (52%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPP--PPPPPPPPPRPPPPGGGGGPP 54 E + AP P PPPP AP PP PPPPP PP P PPG GPP Sbjct: 1403 EASTGAPPPPPPPPPPP---GDAPPPPGGAPPPPPGPPPPAPPGPAPGPP 1449 [154][TOP] >UniRef100_C0NWN6 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NWN6_AJECG Length = 1535 Score = 63.5 bits (153), Expect = 7e-09 Identities = 31/61 (50%), Positives = 35/61 (57%), Gaps = 8/61 (13%) Frame = -3 Query: 206 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGG--GGPPA 51 D Q+ S P P PPP A+ D+ +PPPPPPP PPPP PPP GG GGPP Sbjct: 1422 DFQDAPSMPPPPPPPPVPASFADAPPTAPPPPPPPAFSAAAPPPPPPPPSVGGAPGGPPP 1481 Query: 50 P 48 P Sbjct: 1482 P 1482 [155][TOP] >UniRef100_A1DC51 Actin cytoskeleton-regulatory complex protein pan1 n=1 Tax=Neosartorya fischeri NRRL 181 RepID=PAN1_NEOFI Length = 1470 Score = 63.5 bits (153), Expect = 7e-09 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 9/58 (15%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP---------PPPRPPPPGGGGGPPAPRDIGG 33 P P PPPPAA S+ +PPPPP PP PPP PPPP G PPAP GG Sbjct: 1371 PPPPPPPPAAVPSYDSSVAPPPPPAPPMAPPMAPPAPPPGPPPPPGPPPPPAPPAAGG 1428 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 27/47 (57%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S AP P P PP A AP P PPPPP PPP PP P GGPP P Sbjct: 1387 SVAPPPPPAPPMAPPMAPPAPPPGPPPPPGPPP-PPAPPAAGGPPTP 1432 [156][TOP] >UniRef100_Q0CPW4 Actin cytoskeleton-regulatory complex protein pan1 n=1 Tax=Aspergillus terreus NIH2624 RepID=PAN1_ASPTN Length = 1469 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = -3 Query: 182 APSPAPPPPA-AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP AA + SA +PPPPPPPP PP PPP G PP P Sbjct: 1380 APPPPPPPPVPAAAPNGSAGAPPPPPPPPAPPMAPPPPPAGVPPPP 1425 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSA--PSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PP PAAA S+ P PPPPP PP P PPPP G PPAP Sbjct: 1383 PPPPPPVPAAAPNGSAGAPPPPPPPPAPPMAP-PPPPAGVPPPPAP 1427 [157][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/46 (56%), Positives = 26/46 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 42 P P PPPP P PPPPPPPPPPP PPPP PP RD Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRD 104 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 V E P PPPP P PPPPPPPPPP PPPP PP P Sbjct: 52 VGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP-----PPPP 98 [158][TOP] >UniRef100_UPI0000E47171 PREDICTED: similar to conserved hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E47171 Length = 2383 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPP P PPP PPPPG GG PP P Sbjct: 521 PPPPPPPPPPPGMGGGPPPPPPPPPGPGGIPPPPPPPPGPGGPPPPP 567 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP---PPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPP P PP PPPP G GGPP P Sbjct: 520 PPPPPPPPPPPPGMGGGPPPPPPPPPGPGGIPPPPPPPPGPGGPPPP 566 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/49 (57%), Positives = 28/49 (57%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 48 PSP PPP P PPPPPPP PPPP PPPPG GG PP P Sbjct: 515 PSPIVPPP---------PPPPPPPPPGMGGGPPPPPPPPPGPGGIPPPP 554 [159][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP +P PPPPPPPPPPP PPPP PP P Sbjct: 94 PVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPP 137 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +PSP PPPP P PPPPPP PPPP PPPP PP P Sbjct: 84 SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPP 128 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 PSP PPPP S P PPPPPPP PPPP PPPP PP+P Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSP 156 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S +P P PPPP P PPPP PPPPPP PPPP PP P Sbjct: 84 SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPP 130 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP PSPPPPPPPPPPP P PP PP P Sbjct: 92 PPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPP 135 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP +PSPPPPPPPP PP PPPP PP+P Sbjct: 68 PPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSP 111 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP S P PPPPPPPPP P PPPP PP P Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNP 139 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP + P PPPPP PPPPP PPPP PP P Sbjct: 100 PPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP + P PPPP PPPPPP PPPP PP P Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPP 144 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP+ P PPP PPPPPPP PPPP PP P Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-PPPPPRPPPPGGGGGPPAP 48 P P PPPP S +P PPPPPP PPPPP PPPP PP P Sbjct: 70 PPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPP 114 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPP PPPP PPPP PP P Sbjct: 99 PPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP+ + S PSPPP PPP PPP PPP PP+P Sbjct: 141 PPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 184 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P+P PPPP S PSPPP PPP PPP PPP PP+P Sbjct: 137 PNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 180 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = -3 Query: 182 APSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P P+PPP P + S PSPPP PPP PPPRPPP PP+P Sbjct: 155 SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSP 200 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP + PSP PPPPPPPP PPPP PP P Sbjct: 66 PPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPP 109 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/47 (51%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPS--PPPPPPPPPPPRPPPPGGGGGPPAP 48 +P P PPP S P PPPPPPPPPPP+PP P PP P Sbjct: 45 SPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPP 91 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP PPPPPPPPPPP PPP PP+P Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSP 150 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -3 Query: 182 APSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 +P P+PPP P S PSPPP PPP PPPRPPP PP+PR Sbjct: 175 SPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPP---SPNPPSPR 218 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -3 Query: 188 SRAPSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S +P P+PPP P + S PSPPP PPP PPP PPP PP+P Sbjct: 149 SPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSP 196 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/47 (53%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-PPRPPPPGGGGGPPAP 48 R P PAPPPP P PPPP PPPP PP P PP PP+P Sbjct: 245 RPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSP 291 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/45 (48%), Positives = 25/45 (55%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P P PPPP + P PPPPP P PPP PPP PP+P Sbjct: 124 SPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSP 168 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPP S P P PPPP PPPPRPPPP PP P Sbjct: 225 PSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPP----SPPPP 264 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPP + + P PPPPPPPP PP PP P PP P Sbjct: 51 PPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPP 94 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 P P PPPP+ P PPP PPPPPPP PP P PP Sbjct: 116 PPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPP 157 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/46 (52%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -3 Query: 182 APSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P P+PPP P + S PSPPP PPP PPP PPP PP+P Sbjct: 159 SPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSP 204 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/50 (52%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP-----PPPPPPPPRPPPPGGGGGPPAPR 45 PSP PP P +P PPP PPP PPPPRPPPP PP PR Sbjct: 210 PSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPP----APPPPR 255 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/45 (55%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P PPPPA PSPPPP PPPP PP P PP PP+P Sbjct: 242 PPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSP 286 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP PPPPPPPPP P PPP PP+P Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSP 164 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/54 (46%), Positives = 26/54 (48%), Gaps = 8/54 (14%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPP--------PPRPPPPGGGGGPPAP 48 R P P PPPP + P PPPP PPPP PPRPPPP P P Sbjct: 310 RPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPP 363 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/46 (52%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 182 APSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P P+PPP P + S PSPPP PPP PPP PPP PP P Sbjct: 163 SPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRP 208 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/46 (52%), Positives = 26/46 (56%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 R PSP+PP P + P P PPPP PPPP PPPP PP P Sbjct: 218 RPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPP----RPPPP 259 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP+ PSPPPP PP PPPP PPPP PP+PR Sbjct: 252 PPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPP--SPLPPSPR 297 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP+PPP + S PSPPP PPP PPP PPP PP P Sbjct: 148 PSPSPPP---SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRP 188 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/49 (48%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAP 48 R P P+PPPP + P PPPP PP PPPP PPP PP P Sbjct: 330 RPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPPRRPPRP 378 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/50 (50%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 194 RRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-PPRPPPPGGGGGPPAP 48 RR P P+PPPP P PPPP PPPP PP P PP PP+P Sbjct: 232 RRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSP 281 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/50 (50%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -3 Query: 182 APSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPG---GGGGPPAPR 45 +P P+PPP P + S PSPPP PPP PPP P PP PP+PR Sbjct: 179 SPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPR 228 [160][TOP] >UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum bicolor RepID=C5XPK9_SORBI Length = 613 Score = 63.2 bits (152), Expect = 9e-09 Identities = 24/44 (54%), Positives = 28/44 (63%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ + S P P PPPP PPPP PPPP PP+P Sbjct: 432 PPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSP 475 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 449 PPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 492 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 PSP+PPPP+ PSP PPPP PPPP PPPP PP Sbjct: 466 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP 507 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP+PPPP+ PSP PPPP PPPP PPPP PP P Sbjct: 422 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPP----SPPPP 461 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP+PPPP+ PSPPPP PPPP P PPPP PP P Sbjct: 439 PSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPP----SPPPP 478 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 405 PSPPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 448 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 410 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 453 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ S P P PPPP PPPP PPPP P+P Sbjct: 427 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSP 470 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP P PPPP PPPP P+P Sbjct: 444 PPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSP 487 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 454 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 497 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P+ PSPPPP P PPPP PPPP P+P Sbjct: 461 PSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSP 504 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P+ PSPPPP P PPPP PPPP PP P Sbjct: 417 PSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP----SPPPP 456 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ + S P P PPPP P PP P PP PP+P Sbjct: 415 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 458 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ + S P P PPPP P PP P PP PP+P Sbjct: 459 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 502 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/47 (51%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAP 48 PSP PP P+ PSPPPP PP PPPP P PP PP+P Sbjct: 434 PSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 480 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/45 (51%), Positives = 25/45 (55%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +PSP PP P +PSPPPP PPPP P PP P PP P Sbjct: 467 SPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP----SPPPP 507 [161][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P+P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-----PPPP 100 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/47 (51%), Positives = 27/47 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 P P PPPP P PPPPPPPPPPP PPPP PP+ ++ Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENL 113 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/46 (52%), Positives = 26/46 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 42 P P PPPP P PPPPPPPPPPP PPPP PP ++ Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQE 111 [162][TOP] >UniRef100_Q4QE97 Formin A n=1 Tax=Leishmania major RepID=Q4QE97_LEIMA Length = 1300 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/69 (44%), Positives = 32/69 (46%), Gaps = 22/69 (31%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPS----------------------PPPPPPPPPPPRPPPP 75 S AP P PPPP SS P+ PPPPPPPPPPP PPPP Sbjct: 622 SSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPP 681 Query: 74 GGGGGPPAP 48 G GPP P Sbjct: 682 RMGNGPPPP 690 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -3 Query: 179 PSPAPP--PPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PP PP P PPPPPPPPPPP PPP G G PP P Sbjct: 646 PPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPPRMGNGPPPPP 691 [163][TOP] >UniRef100_Q1HMI8 Formin A n=2 Tax=Trypanosoma cruzi RepID=Q1HMI8_TRYCR Length = 1097 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/55 (54%), Positives = 30/55 (54%), Gaps = 11/55 (20%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP--------PPPPPRPPPPGGG---GGPPAP 48 P P PPPP A S P PPPPPP PPPPP PPPPG G G PP P Sbjct: 523 PPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPPPGAGTKSGLPPPP 577 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/58 (51%), Positives = 31/58 (53%), Gaps = 10/58 (17%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGG---GGPPAP 48 +S P P PPPP A K P PPPPPPP PPP PPPPG G G PP P Sbjct: 536 KSGLPPPPPPPPGAGAKSGLPPPPPPPPPPGAGTKSGLPPPPPPPPGAGTKSGLPPPP 593 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/71 (42%), Positives = 33/71 (46%), Gaps = 8/71 (11%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPP--------PPPPPPRPPPPGGGGGPPAPRDIG 36 +S P P PPPP A K P PPPPP PPPPPP PP G P P Sbjct: 570 KSGLPPPPPPPPGAGTKSGLPPPPPPPPGAGTKSGLPPPPPPPPPKAKSGPAQPGPTRSI 629 Query: 35 GVDEERNSSGV 3 +D +N S V Sbjct: 630 PIDVVKNISKV 640 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/54 (53%), Positives = 29/54 (53%), Gaps = 10/54 (18%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGG---GGPPAP 48 P P PPPP A S P PPPPPPP PPP PPPPG G G PP P Sbjct: 557 PPPPPPPPPGAGTKSGLP-PPPPPPPGAGTKSGLPPPPPPPPGAGTKSGLPPPP 609 [164][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/48 (54%), Positives = 27/48 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIG 36 P P PPPP P PPPPPPPPPPP PPPP PP P +G Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLG 53 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/49 (53%), Positives = 27/49 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 P P PPPP P PPPPPPPPPPP PPPP PP P + G Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLG 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [165][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP P+ Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPK 45 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP P PR Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPR 48 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP P PPAP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAFPPAP 57 [166][TOP] >UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA Length = 688 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP+P PPPP A + P PP P PPPPPP PPPP PP P Sbjct: 211 APTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPPTP 255 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 AP+P PPPP AP P PPPPPPP P+PPPP PPAP+ Sbjct: 209 APAPTPPPPPPP-----APKPKPPPPPPPKPKPPPPPPPPPPPAPK 249 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/45 (51%), Positives = 25/45 (55%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP + P PPPPPPPPP P+P PP P P Sbjct: 221 APKPKPPPPPPPKPK---PPPPPPPPPPPAPKPSPPTPPPTTPPP 262 [167][TOP] >UniRef100_A9V6R1 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V6R1_MONBE Length = 531 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/59 (50%), Positives = 33/59 (55%), Gaps = 11/59 (18%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPP------PPPP-----PPPRPPPPGGGGGPPAPRDIGG 33 +P PPPP + AP PPPP PPPP PPP PPP GGGG PP P +GG Sbjct: 357 APPPPPPTNRKPAMGAPPPPPPMNAGPPPPPPMGGGGPPPPPPPMGGGGPPPPPPPMGG 415 Score = 61.6 bits (148), Expect = 3e-08 Identities = 35/70 (50%), Positives = 38/70 (54%), Gaps = 17/70 (24%) Frame = -3 Query: 191 RSRAPSPAP---PPPAAAEKDSSAPSPPPP----------PPPPP----PPRPPPPGGGG 63 R+ P PAP PPPA + SAP PPPP PPPPP PP PPP GGGG Sbjct: 337 RAGPPPPAPMRGPPPAPS---GSAPPPPPPTNRKPAMGAPPPPPPMNAGPPPPPPMGGGG 393 Query: 62 GPPAPRDIGG 33 PP P +GG Sbjct: 394 PPPPPPPMGG 403 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 11/53 (20%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPP-------PPPPPPP----PPRPPPPGGGGGPPAP 48 P PPPP P PP PPPPPPP PP PPPP GGG PP P Sbjct: 394 PPPPPPPMGGGGPPPPPPPMGGGSGGPPPPPPPMNAGPPPPPPPMGGGAPPPP 446 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/58 (50%), Positives = 31/58 (53%), Gaps = 9/58 (15%) Frame = -3 Query: 194 RRSRAPSPAPPPPAAAEKDSSAP----SPPPPPPPP----PPPRPPPPGGG-GGPPAP 48 R+ +P PPPP A P PPPPPPP PPP PPP GGG GGPP P Sbjct: 366 RKPAMGAPPPPPPMNAGPPPPPPMGGGGPPPPPPPMGGGGPPPPPPPMGGGSGGPPPP 423 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIG 36 P PPPP P PPPP PPP PPP GGG PP P G Sbjct: 406 PPPPPPPMGGGSGGPPPPPPPMNAGPPPPPPPMGGGAPPPPPPGAG 451 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/69 (42%), Positives = 30/69 (43%), Gaps = 19/69 (27%) Frame = -3 Query: 182 APSPAPP----PPAAAEKDSSAPSPPPPP------PPPPPPR---------PPPPGGGGG 60 AP P PP PP P PPPPP PPPPPP PPPP G Sbjct: 372 APPPPPPMNAGPPPPPPMGGGGPPPPPPPMGGGGPPPPPPPMGGGSGGPPPPPPPMNAGP 431 Query: 59 PPAPRDIGG 33 PP P +GG Sbjct: 432 PPPPPPMGG 440 [168][TOP] >UniRef100_A9URA4 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9URA4_MONBE Length = 1593 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/52 (50%), Positives = 30/52 (57%) Frame = -3 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 + + RS + S PP + PSPPP PPPPPPP PPPPG G PP P Sbjct: 972 LSQHRSASSSINTHPPLTSTPSEVLPSPPPAPPPPPPPPPPPPGAPGAPPPP 1023 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/52 (50%), Positives = 29/52 (55%), Gaps = 7/52 (13%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGGGGPP 54 S P+P PPPP + +PPPPPPP PPPP PPPPG G PP Sbjct: 998 SPPPAPPPPPPPPPPPPGAPGAPPPPPPPLPGIPGAPPPPPPPPPGIPGAPP 1049 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/52 (51%), Positives = 27/52 (51%), Gaps = 9/52 (17%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPP---------PPPPRPPPPGGGGGPP 54 AP PPPP AP PPPPPPP PPPP PPPPG G PP Sbjct: 1016 APGAPPPPPPPLPGIPGAPPPPPPPPPGIPGAPPPLPPPPPPPPPGIPGAPP 1067 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/60 (48%), Positives = 30/60 (50%), Gaps = 9/60 (15%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPP---------RPPPPGGGGGPPAPRDIGGV 30 AP P PPPP AP P PPPPPPPPP PPPPG G PP P G+ Sbjct: 1033 APPPPPPPPPGIP---GAPPPLPPPPPPPPPGIPGAPPPLPPPPPGIPGAPPPPPPPPGI 1089 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/50 (52%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 48 AP P PPPP PP PPPPP PPP PPPPG G PP P Sbjct: 1047 APPPLPPPPPPPPPGIPGAPPPLPPPPPGIPGAPPPPPPPPGIPGAPPPP 1096 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/60 (48%), Positives = 30/60 (50%), Gaps = 11/60 (18%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP------PPPPPPP-----PRPPPPGGGGGPPAPRDIGG 33 P P PPPP P PPP PPPPPPP P PPPPG G PP P +GG Sbjct: 1053 PPPPPPPPGIPGAPPPLPPPPPGIPGAPPPPPPPPGIPGAPPPPPPGIPGAPPPP--LGG 1110 [169][TOP] >UniRef100_A0CS42 Chromosome undetermined scaffold_26, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CS42_PARTE Length = 417 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/58 (51%), Positives = 33/58 (56%), Gaps = 12/58 (20%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSS-------APS-----PPPPPPPPPPPRPPPPGGGGGPPAPR 45 AP P PPPP + ++ APS PPPPPPPPPPP PPPP G PP PR Sbjct: 251 APPPPPPPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPR 308 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/51 (47%), Positives = 27/51 (52%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 Q+++ P PAP A P PPPPPPPPPP PPP G PP P Sbjct: 265 QQQQVVPPPPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPRGPPPPPP 315 [170][TOP] >UniRef100_Q2U6Q3 Actin regulatory protein n=1 Tax=Aspergillus oryzae RepID=Q2U6Q3_ASPOR Length = 665 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/54 (53%), Positives = 30/54 (55%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGVDE 24 R PS PPPP A AP PPPPPP P PPPP GG PP P GG D+ Sbjct: 532 RGPSAPPPPPPPAPA-GGAPPPPPPPPGAGAPPPPPPPGGAAPPLPTPSGGRDD 584 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/69 (43%), Positives = 34/69 (49%), Gaps = 11/69 (15%) Frame = -3 Query: 179 PSPAPPPPAAA-----EKDSSAPSPPPPPPPP------PPPRPPPPGGGGGPPAPRDIGG 33 P+P PPPP+++ PS PPPPPPP PPP PPPPG G PP P G Sbjct: 512 PAPPPPPPSSSIPPPPPPPGRGPSAPPPPPPPAPAGGAPPPPPPPPGAGAPPPPPPPGGA 571 Query: 32 VDEERNSSG 6 SG Sbjct: 572 APPLPTPSG 580 Score = 60.1 bits (144), Expect = 8e-08 Identities = 31/77 (40%), Positives = 33/77 (42%), Gaps = 25/77 (32%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPP-----------------PPPPPPPR--------P 84 S P P PPPP + + AP PPPP PPPPPPP P Sbjct: 494 SSVPPPPPPPPLPSSRGPPAPPPPPPSSSIPPPPPPPGRGPSAPPPPPPPAPAGGAPPPP 553 Query: 83 PPPGGGGGPPAPRDIGG 33 PPP G G PP P GG Sbjct: 554 PPPPGAGAPPPPPPPGG 570 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/56 (51%), Positives = 31/56 (55%), Gaps = 11/56 (19%) Frame = -3 Query: 182 APSPAPPPPAAAE------KDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 48 A P PPPPA++ SS P PPPPPPP PPPP PPP GPPAP Sbjct: 459 ASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTSSVPPPPPPPPLPSSRGPPAP 514 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/61 (49%), Positives = 30/61 (49%), Gaps = 14/61 (22%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPP----------PPPPPPR----PPPPGGGGGPPA 51 S P P PPPP SS P PPPPP PPPPPP PPPP G GP A Sbjct: 480 SSVPPPPPPPPPPT---SSVPPPPPPPPLPSSRGPPAPPPPPPSSSIPPPPPPPGRGPSA 536 Query: 50 P 48 P Sbjct: 537 P 537 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/58 (50%), Positives = 30/58 (51%), Gaps = 10/58 (17%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKD------SSAPSPPPPP----PPPPPPRPPPPGGGGGPPAP 48 RS A P PPP AA + SSA PPPPP PPPPPP PPP PP P Sbjct: 445 RSPASQPPPPPVPAASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTSSVPPPPPP 502 [171][TOP] >UniRef100_Q1E016 Predicted protein n=1 Tax=Coccidioides immitis RepID=Q1E016_COCIM Length = 280 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP A +AP PPPPPPPPPPP PP P P P+ Sbjct: 124 PPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPPPQ 168 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/57 (47%), Positives = 29/57 (50%), Gaps = 12/57 (21%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPR------------PPPPGGGGGPPAPR 45 P P PPPP A + AP PPPPPPPPPP PPPP PPAP+ Sbjct: 103 PPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPK 159 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP A S A PPPPPPPPPPP P PP PAP Sbjct: 123 PPPPPPPPPPAPTTSKAAPPPPPPPPPPPP-PAPPAPKPSKPAP 165 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/54 (48%), Positives = 28/54 (51%), Gaps = 8/54 (14%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRP--------PPPGGGGGPPAP 48 +AP P PPA + P PPPPPPPPPPP P PPP PPAP Sbjct: 81 KAPPPPQSPPAPTTTAQAPPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAP 134 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPA-AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPPA K + P PPPPPPPPP P P P PP P Sbjct: 125 PPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPPPQP 169 [172][TOP] >UniRef100_Q0CGJ5 Putative uncharacterized protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CGJ5_ASPTN Length = 600 Score = 63.2 bits (152), Expect = 9e-09 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 11/66 (16%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPP----PPPP-------PRPPPPGGGGGPPAPRD 42 S P+ PPPP A AP PPPPPP PPPP P PPPP GG PP P+ Sbjct: 455 STGPTAPPPPPPAP--GGGAPPPPPPPPGAGAPPPPPPPGAGAPPPPPPPGGAAPPLPKP 512 Query: 41 IGGVDE 24 GG D+ Sbjct: 513 AGGRDD 518 Score = 60.5 bits (145), Expect = 6e-08 Identities = 45/130 (34%), Positives = 51/130 (39%), Gaps = 12/130 (9%) Frame = -3 Query: 401 RLYHAWPTGPWRTSTNAAKLNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATS 222 R H W T +T L+ RG R P + A +P P P ATS Sbjct: 367 RRRHLWMTA--HPATEFLHLS-RGSERCPLHRRHRVVARAAPPPPPPPP--------ATS 415 Query: 221 RALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPP-----PPPPPP-------PPRPPP 78 ++ P P PPPP A P PPP PPPPPP PP PPP Sbjct: 416 T---------KTGPPPPGPPPPPAPASSVPPPPPPPSSHIPPPPPPPSSTGPTAPPPPPP 466 Query: 77 PGGGGGPPAP 48 GGG PP P Sbjct: 467 APGGGAPPPP 476 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/56 (48%), Positives = 29/56 (51%), Gaps = 9/56 (16%) Frame = -3 Query: 188 SRAPSPAPPP-----PAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAP 48 S P P PPP P S+ P+ PPPPPP P PP PPPP G G PP P Sbjct: 433 SSVPPPPPPPSSHIPPPPPPPSSTGPTAPPPPPPAPGGGAPPPPPPPPGAGAPPPP 488 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/58 (46%), Positives = 31/58 (53%), Gaps = 11/58 (18%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPP----PPPPP-------PRPPPPGGGGGPPAPRDIGG 33 P PPPP ++ ++ P PPP P PPPPP P PPPP G G PP P GG Sbjct: 447 PPPPPPPSSTGPTAPPPPPPAPGGGAPPPPPPPPGAGAPPPPPPPGAGAPPPPPPPGG 504 [173][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 63.2 bits (152), Expect = 9e-09 Identities = 39/106 (36%), Positives = 49/106 (46%), Gaps = 14/106 (13%) Frame = -3 Query: 308 VPVSICASVSPRPTNTPAVMA--------LVLMGATSRALR*DVQERRSRAPSPAPPPPA 153 V +IC++V P+ P + L G TS ++ SP PPPP+ Sbjct: 88 VSTTICSTVETPPSANPTIPIDLPTAPTDLGANGITSTQTVIVTRQPPHTPSSPPPPPPS 147 Query: 152 AAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPA-PRDIGG 33 +A P PPPPPP PPPPP PPPP PP+ P D GG Sbjct: 148 SAPLPQPPPPPPPPPPASAPPPPPPPPPPPPISPSLPPSNPPDRGG 193 [174][TOP] >UniRef100_C5P8S7 Pherophorin-dz1 protein, putative n=2 Tax=Coccidioides posadasii RepID=C5P8S7_COCP7 Length = 281 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP A +AP PPPPPPPPPPP PP P P P+ Sbjct: 125 PPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPPPQ 169 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/57 (47%), Positives = 29/57 (50%), Gaps = 12/57 (21%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPR------------PPPPGGGGGPPAPR 45 P P PPPP A + AP PPPPPPPPPP PPPP PPAP+ Sbjct: 104 PPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPK 160 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP A S A PPPPPPPPPPP P PP PAP Sbjct: 124 PPPPPPPPPPAPTTSKAAPPPPPPPPPPPP-PAPPAPKPSKPAP 166 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPA-AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPPA K + P PPPPPPPPP P P P PP P Sbjct: 126 PPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPPPQP 170 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/52 (46%), Positives = 25/52 (48%), Gaps = 8/52 (15%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRP--------PPPGGGGGPPAP 48 P P PP + P PPPPPPPPPPP P PPP PPAP Sbjct: 84 PPPQSPPAPTTTAQAPPPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAP 135 [175][TOP] >UniRef100_B8PFG8 Predicted protein n=1 Tax=Postia placenta Mad-698-R RepID=B8PFG8_POSPM Length = 476 Score = 63.2 bits (152), Expect = 9e-09 Identities = 39/101 (38%), Positives = 41/101 (40%), Gaps = 7/101 (6%) Frame = -3 Query: 329 RSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAA 150 RS P+ P A PRPT P A+ R PS PPPP Sbjct: 282 RSAAPTPAPP---APPPPRPTAAPPAPP---PPPARPAVAPPPPPTRPAPPSGGPPPPPP 335 Query: 149 AEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAP 48 P PPPPPP PPPPP PPPP GG PP P Sbjct: 336 PAPSGGPPPPPPPPPPPPAGGAPPPPPPPPPPPSGGMPPPP 376 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/48 (58%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAP 48 P P PPPP A AP PPPPPPPPP PP PPPP GG P P Sbjct: 345 PPPPPPPPPA----GGAPPPPPPPPPPPSGGMPPPPPPPPPAGGSPGP 388 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/57 (50%), Positives = 30/57 (52%), Gaps = 10/57 (17%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGG-----GGPPAP 48 S P P PPPP + P PPPPPPPP PPP PPPP GG G PAP Sbjct: 339 SGGPPPPPPPPPPPPAGGAPPPPPPPPPPPSGGMPPPPPPPPPAGGSPGPSAGLPAP 395 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/70 (42%), Positives = 34/70 (48%), Gaps = 22/70 (31%) Frame = -3 Query: 191 RSRAPSP----APPPPAAAEKDSSAPSPPPP-----PP-------------PPPPPRPPP 78 RS AP+P AP PP +A + P+PPPP PP PPPP RP P Sbjct: 266 RSAAPTPPRSAAPTPPRSAAPTPAPPAPPPPRPTAAPPAPPPPPARPAVAPPPPPTRPAP 325 Query: 77 PGGGGGPPAP 48 P GG PP P Sbjct: 326 PSGGPPPPPP 335 [176][TOP] >UniRef100_B8NKG8 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus flavus NRRL3357 RepID=B8NKG8_ASPFN Length = 692 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/54 (53%), Positives = 30/54 (55%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGGVDE 24 R PS PPPP A AP PPPPPP P PPPP GG PP P GG D+ Sbjct: 559 RGPSAPPPPPPPAPA-GGAPPPPPPPPGAGAPPPPPPPGGAAPPLPTPSGGRDD 611 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/64 (50%), Positives = 33/64 (51%), Gaps = 12/64 (18%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPP------PPPPPPP------PPRPPPPGGGGGPPAPR 45 SR P PAPPPP + P PP PPPPPPP PP PPPP G G PP P Sbjct: 535 SRGP-PAPPPPPPSSSIPRPPPPPGRGPSAPPPPPPPAPAGGAPPPPPPPPGAGAPPPPP 593 Query: 44 DIGG 33 GG Sbjct: 594 PPGG 597 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/69 (43%), Positives = 34/69 (49%), Gaps = 11/69 (15%) Frame = -3 Query: 179 PSPAPPPPAAA-----EKDSSAPSPPPPPPPP------PPPRPPPPGGGGGPPAPRDIGG 33 P+P PPPP+++ PS PPPPPPP PPP PPPPG G PP P G Sbjct: 539 PAPPPPPPSSSIPRPPPPPGRGPSAPPPPPPPAPAGGAPPPPPPPPGAGAPPPPPPPGGA 598 Query: 32 VDEERNSSG 6 SG Sbjct: 599 APPLPTPSG 607 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/56 (51%), Positives = 31/56 (55%), Gaps = 11/56 (19%) Frame = -3 Query: 182 APSPAPPPPAAAE------KDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 48 A P PPPPA++ SS P PPPPPPP PPPP PPP GPPAP Sbjct: 486 ASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTSSVPPPPPPPPLPSSRGPPAP 541 Score = 56.2 bits (134), Expect = 1e-06 Identities = 42/114 (36%), Positives = 44/114 (38%), Gaps = 19/114 (16%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P P AS P P PA S A+ S P P PPPP + Sbjct: 465 PPPPPPRSPASQPPPPPPVPAASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTS--- 521 Query: 137 SSAPSPPPPP---------PPPPP-----PRPPPPGGGG-----GPPAPRDIGG 33 S P PPPPP PPPPP PRPPPP G G PP P GG Sbjct: 522 SVPPPPPPPPLPSSRGPPAPPPPPPSSSIPRPPPPPGRGPSAPPPPPPPAPAGG 575 [177][TOP] >UniRef100_B8M4W4 Actin associated protein Wsp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M4W4_TALSN Length = 648 Score = 63.2 bits (152), Expect = 9e-09 Identities = 35/85 (41%), Positives = 37/85 (43%), Gaps = 4/85 (4%) Frame = -3 Query: 278 PRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP- 102 P P+NT V +S A S P P PPPP P PPPPPPP Sbjct: 457 PSPSNTRPVPPPPPPAPSSGAPPPPPPPPPSGIPQPPPPPPPPPPSGIPQPPPPPPPPPS 516 Query: 101 ---PPPPRPPPPGGGGGPPAPRDIG 36 PPPP PPP G G PP P G Sbjct: 517 FGAPPPPPPPPATGSGAPPPPPPTG 541 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/61 (47%), Positives = 31/61 (50%), Gaps = 11/61 (18%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP----PPPPPPPPR-------PPPPGGGGGPPAPRDIGG 33 P P PPPP+ + P PPP PPPPPPPP PPPP G G PP P G Sbjct: 494 PPPPPPPPSGIPQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGAPPPPPPGGA 553 Query: 32 V 30 V Sbjct: 554 V 554 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/59 (47%), Positives = 29/59 (49%), Gaps = 12/59 (20%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP-------PPPPPR-----PPPPGGGGGPPAPRDIGG 33 P PPPP AP PPPPPP PPPPP PPPP GG PP +GG Sbjct: 505 PQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGAPPPPPPGGAVPPPLLSVGG 563 [178][TOP] >UniRef100_B8M4W3 Actin associated protein Wsp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M4W3_TALSN Length = 822 Score = 63.2 bits (152), Expect = 9e-09 Identities = 35/85 (41%), Positives = 37/85 (43%), Gaps = 4/85 (4%) Frame = -3 Query: 278 PRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP- 102 P P+NT V +S A S P P PPPP P PPPPPPP Sbjct: 457 PSPSNTRPVPPPPPPAPSSGAPPPPPPPPPSGIPQPPPPPPPPPPSGIPQPPPPPPPPPS 516 Query: 101 ---PPPPRPPPPGGGGGPPAPRDIG 36 PPPP PPP G G PP P G Sbjct: 517 FGAPPPPPPPPATGSGAPPPPPPTG 541 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/61 (47%), Positives = 31/61 (50%), Gaps = 11/61 (18%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP----PPPPPPPPR-------PPPPGGGGGPPAPRDIGG 33 P P PPPP+ + P PPP PPPPPPPP PPPP G G PP P G Sbjct: 494 PPPPPPPPSGIPQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGAPPPPPPGGA 553 Query: 32 V 30 V Sbjct: 554 V 554 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/59 (47%), Positives = 29/59 (49%), Gaps = 12/59 (20%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP-------PPPPPR-----PPPPGGGGGPPAPRDIGG 33 P PPPP AP PPPPPP PPPPP PPPP GG PP +GG Sbjct: 505 PQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGAPPPPPPGGAVPPPLLSVGG 563 [179][TOP] >UniRef100_B8LZG7 Formin 1,2/cappuccino, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8LZG7_TALSN Length = 675 Score = 63.2 bits (152), Expect = 9e-09 Identities = 28/50 (56%), Positives = 30/50 (60%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 APS PPPP ++AP PPPPPP PP PPPP GGPPA GG Sbjct: 589 APSAPPPPPPPPPPGTAAPPPPPPPPGGAPPPPPPPPPAGGPPASALGGG 638 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/62 (48%), Positives = 34/62 (54%), Gaps = 18/62 (29%) Frame = -3 Query: 179 PSPAPPP-------PAAAEKDS-------SAPSPPPPPPPP----PPPRPPPPGGGGGPP 54 P P+ PP P++ E D+ SAP PPPPPPPP PPP PPPPGG PP Sbjct: 562 PPPSAPPTLPVAEAPSSPESDTPAAVAAPSAPPPPPPPPPPGTAAPPPPPPPPGGAPPPP 621 Query: 53 AP 48 P Sbjct: 622 PP 623 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSP---PPPPPPPPPPRPPPP---GGGGGPP 54 P P PPPP A P P PPPPPPPPP PP GGGGG P Sbjct: 595 PPPPPPPPGTAAPPPPPPPPGGAPPPPPPPPPAGGPPASALGGGGGAP 642 [180][TOP] >UniRef100_A2R4H0 Function: sepA function in A. nidulans requires a preceding mitosis n=1 Tax=Aspergillus niger CBS 513.88 RepID=A2R4H0_ASPNC Length = 1811 Score = 63.2 bits (152), Expect = 9e-09 Identities = 28/53 (52%), Positives = 28/53 (52%), Gaps = 9/53 (16%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPP PPPPP PPPPGG G PP P Sbjct: 1043 PPPPPPPPPPPGGAVGIPPPPPPPPPPPGGKVGIPPPPPPPPPPGGAGFPPPP 1095 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/61 (50%), Positives = 31/61 (50%), Gaps = 12/61 (19%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPP--------PPPPPPRPPPPGGGGG----PPAPRDIG 36 P P PPPP A P PPPPP PPPPPP PPPPGG G PP P G Sbjct: 1028 PPPPPPPPPGAVGIPPPPPPPPPPPPGGAVGIPPPPPPPPPPPGGKVGIPPPPPPPPPPG 1087 Query: 35 G 33 G Sbjct: 1088 G 1088 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPP-----PPPPPPPRPPPPGGGGGPPAP 48 AP+P PPPP P PPPP PPPPPPP PPPPGG G P P Sbjct: 1021 APAPPPPPPP--------PPPPPPGAVGIPPPPPPPPPPPPGGAVGIPPP 1062 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/49 (53%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 48 P P PPPP K P PPPPPPP PPPP PPP G PP P Sbjct: 1061 PPPPPPPPPPGGKVGIPPPPPPPPPPGGAGFPPPPPPPPGASFGAPPPP 1109 [181][TOP] >UniRef100_Q2H922 Actin cytoskeleton-regulatory complex protein PAN1 n=1 Tax=Chaetomium globosum RepID=PAN1_CHAGB Length = 1450 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/49 (53%), Positives = 29/49 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 P P PP P+A + P+PPPPPP PP PPPP GGPPA GG Sbjct: 1368 PPPPPPMPSAGGPPGAPPAPPPPPPGMAPPAPPPPPPAGGPPAAAPAGG 1416 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PP P + S P PPPPPPPPPP P G G PPAP Sbjct: 1343 APPPPPPMPGSFPSASPGPGAPPPPPPPPPPMPSAGGPPGAPPAP 1387 [182][TOP] >UniRef100_A3AB67 Formin-like protein 16 n=1 Tax=Oryza sativa Japonica Group RepID=FH16_ORYSJ Length = 906 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/103 (35%), Positives = 44/103 (42%), Gaps = 13/103 (12%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAP---------SPAP 165 P P S PR + +PA + S +L P SPAP Sbjct: 254 PPSTPAITAVSSVPRSSPSPAPAPAARPASPSPSLPLPPGRESPSRPQSIAAAAVASPAP 313 Query: 164 PPPAAAEKDSSAPSPPPPP----PPPPPPRPPPPGGGGGPPAP 48 PPP + ++AP PPPPP PPPPP PPPP GPP P Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPP 356 Score = 62.0 bits (149), Expect = 2e-08 Identities = 41/125 (32%), Positives = 50/125 (40%), Gaps = 20/125 (16%) Frame = -3 Query: 317 PSGVPVSICASVSPRPT-------NTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPP 159 PS P SP P+ +P+ + A + + A +P PPP Sbjct: 271 PSPAPAPAARPASPSPSLPLPPGRESPSRPQSIAAAAVASPAPPPPPPPKPAAAAPPPPP 330 Query: 158 PAAAEKDSSAPSPPPP------PPPPPPPR------PPPPGG-GGGPPAPRDIGGVDEER 18 P A P PPP PPPPPPP+ PPPPGG GGPP P GG Sbjct: 331 PPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPP 390 Query: 17 NSSGV 3 + GV Sbjct: 391 AAPGV 395 [183][TOP] >UniRef100_UPI000175FB6D PREDICTED: similar to LOC495114 protein n=1 Tax=Danio rerio RepID=UPI000175FB6D Length = 954 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 7/52 (13%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGGGGPPAP 48 AP P PPPP +P PPPPPPPP PPP PPPPGG PP P Sbjct: 320 APPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIPPPP 371 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/58 (48%), Positives = 30/58 (51%), Gaps = 10/58 (17%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGG---GPPAPRDIGGV 30 P PPPP + P PPPPPP PPPPP PPPPG G PP P GG+ Sbjct: 308 PPPPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGL 365 [184][TOP] >UniRef100_UPI0000E2427E PREDICTED: guanine nucleotide binding protein, alpha activating polypeptide O n=1 Tax=Pan troglodytes RepID=UPI0000E2427E Length = 537 Score = 62.8 bits (151), Expect = 1e-08 Identities = 38/117 (32%), Positives = 51/117 (43%), Gaps = 4/117 (3%) Frame = -3 Query: 374 PWRTSTNAAKLNKRGRSRLPSGVPVSICASVSPRPTNT-PAVMALVLMGATSRALR*DVQ 198 PWR+ + + +L +R + P + + P P T P+ T R L+ Sbjct: 48 PWRSPSLSGRLTERCELWETATPPPARELPLGPAPCPTLPSARGSAKAPRTHRRLKSGDA 107 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGG---PPAPRDIG 36 + P+ PP PA P PPPPPPPPPPP PPP G PP P +G Sbjct: 108 HALAAPPNSLPPHPAPP------PPPPPPPPPPPPPPPPPAAAAAGPTLPPTPPSVG 158 [185][TOP] >UniRef100_UPI0001A2DDE0 UPI0001A2DDE0 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2DDE0 Length = 1417 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 7/52 (13%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGGGGPPAP 48 AP P PPPP +P PPPPPPPP PPP PPPPGG PP P Sbjct: 817 APPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIPPPP 868 [186][TOP] >UniRef100_UPI0001A2BBDD hypothetical protein LOC100009637 n=1 Tax=Danio rerio RepID=UPI0001A2BBDD Length = 502 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 12/59 (20%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPP----PPP--------PPPPRPPPPGGGGGPPAP 48 SRAP+ APPPP + AP PPPP PPP PPPP PPP GG PP P Sbjct: 316 SRAPTSAPPPPPPSRPSMGAPPPPPPSRGHPPPPPPAPASMPPPPPPPPMSGGAAPPPP 374 Score = 57.0 bits (136), Expect = 6e-07 Identities = 35/101 (34%), Positives = 40/101 (39%) Frame = -3 Query: 335 RGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPP 156 RGR P P S P P + M SR + P P PPPP Sbjct: 305 RGRGAPPPPPPSRAPTSAPPPPPPSRPSMGAPPPPPPSRGHPPPPPPAPASMPPPPPPPP 364 Query: 155 AAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 + ++ P PPPPPPPP PP P GG G P GG Sbjct: 365 MSG--GAAPPPPPPPPPPPGPPPPSEMDGGHGESTPPPAGG 403 [187][TOP] >UniRef100_UPI0001951365 UPI0001951365 related cluster n=1 Tax=Bos taurus RepID=UPI0001951365 Length = 795 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/73 (45%), Positives = 37/73 (50%), Gaps = 11/73 (15%) Frame = -3 Query: 215 LR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPP-----PPPPPPR------PPPPGG 69 LR V + S + P PPPP +P PPPPP PPPPPP PPPP Sbjct: 386 LRTQVMRQASSSGIPGPPPPPPLPGGGPSPPPPPPPLPGVGPPPPPPLPGMPGIPPPPPL 445 Query: 68 GGGPPAPRDIGGV 30 GGPP P +GGV Sbjct: 446 FGGPPPPPPLGGV 458 [188][TOP] >UniRef100_A2RUY4 Zgc:158395 protein n=1 Tax=Danio rerio RepID=A2RUY4_DANRE Length = 502 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 12/59 (20%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPP----PPP--------PPPPRPPPPGGGGGPPAP 48 SRAP+ APPPP + AP PPPP PPP PPPP PPP GG PP P Sbjct: 316 SRAPTSAPPPPPPSRPSMGAPPPPPPSRGHPPPPPPAPASMPPPPPPPPMSGGAAPPPP 374 Score = 57.0 bits (136), Expect = 6e-07 Identities = 35/101 (34%), Positives = 40/101 (39%) Frame = -3 Query: 335 RGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPP 156 RGR P P S P P + M SR + P P PPPP Sbjct: 305 RGRGAPPPPPPSRAPTSAPPPPPPSRPSMGAPPPPPPSRGHPPPPPPAPASMPPPPPPPP 364 Query: 155 AAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 + ++ P PPPPPPPP PP P GG G P GG Sbjct: 365 MSG--GAAPPPPPPPPPPPGPPPPSEMDGGHGESTPPPAGG 403 [189][TOP] >UniRef100_Q7XMC9 OSJNBb0018A10.6 protein n=1 Tax=Oryza sativa RepID=Q7XMC9_ORYSA Length = 909 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 APSP PPP S P PPPPPP P PP PPPP PPAP Sbjct: 449 APSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAP 493 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/57 (49%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPPPRPPPPGGGGGPPAP 48 ++ SRAPSP PP A + P PPP PPPPPPPP P PP PPAP Sbjct: 432 RQAASRAPSPPAPPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAP 488 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP+ PPP S P+PPPPPP P PP PPPP PP P Sbjct: 462 PSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPP----PPPCP 501 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/46 (50%), Positives = 24/46 (52%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 +PS PPPP AP PPPP P PP P PPPP PP R Sbjct: 463 SPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPPPCPPAPPKTR 508 [190][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPPPPP PPPP PP P Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPPPPP PPPP PP P Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPPPPP PPPP PP P Sbjct: 464 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 508 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPPPP PPPPP PPPP PP P Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 456 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P S P PPP PPPPPPP PPPP PP P Sbjct: 421 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 464 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPPPPP PPP PPP PP P Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 261 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAP-SPPPP-PPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + S P SPPPP PPPPPPP PPPP PP P Sbjct: 305 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPPPPP PPP PPP PP+P Sbjct: 311 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 354 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPPPPP PPP PPP PP+P Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP P PPPP PP P Sbjct: 399 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 442 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPPPPP PPP PPP PP+P Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPPPPP PPPP PP P Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP----SPPPP 253 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 264 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 307 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 364 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 365 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 408 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 479 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 522 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPPPPP PPPP PP P Sbjct: 513 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP----SPPPP 553 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ P PP PPPPPPP PPPP PP+P Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 302 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ P PP PPPPPPP PPPP PP+P Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 359 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ P PP PPPPPPP PPPP PP+P Sbjct: 360 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 403 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ P PP PPPPPPP PPPP PP+P Sbjct: 474 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 517 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 PSP PPPP + S P PPPPPPP PP PPPP PP Sbjct: 253 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + S P PPPPPPP PP P PP PP+P Sbjct: 287 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 330 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAP-SPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + S P SPPPPPPP PPP PPP PP P Sbjct: 235 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 279 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP +P PP PPPPPPP PPPP PP P Sbjct: 251 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAP-SPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + S P SPPPP PPPP P PPPP PP P Sbjct: 344 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 388 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PP PPPP PPPP PP P Sbjct: 394 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 440 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ P PP PPPPPPP PPPP PP P Sbjct: 414 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAP-SPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + S P SPPPP PPPP P PPPP PP P Sbjct: 458 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 502 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAP 48 P P+PPPP+ +P PP PPPP PPPP PPPP PP P Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP P PP P PP P Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAP 48 P P+PPPP+ P PP PPPP PPPP PPPP PP P Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 285 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 P P PPP + S P PPP PPPPPPP PPPP PP Sbjct: 258 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 299 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 PSP PPPP + PPPPPP PPPP PPPP PP Sbjct: 271 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAP 48 P P+PPPP +P PP PPPP PPPP PPPP PP P Sbjct: 342 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 386 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRP-PPPGGGGGPPAP 48 P P+PPPP+ +P PPPPP PPPPP P PPP PP P Sbjct: 419 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 463 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 PSP PPPP S P PPP PPPPPPP PPPP PP Sbjct: 434 PSPPPPPPP-----SPPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAP 48 P P+PPPP +P PP PPPP PPPP PPPP PP P Sbjct: 456 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 500 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + PPPPPP PPPP PPPP PP P Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP----SPPPP 367 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + PPPPPP PPPP PPPP PP P Sbjct: 372 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP----SPPPP 411 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + PSPPPPPPP PPP PPP PP+P Sbjct: 426 PSPPPPPPPSPPPPPP-PSPPPPPPPSPPPPPPPSPPPPPPPSP 468 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP S P PPP PPPPPPP PPPP PP P Sbjct: 442 PSPPPPPPP-----SPPPPPPPSPPPPPPPSPPPP----SPPPP 476 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + PPPPPP PPPP PPPP PP P Sbjct: 486 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP----SPPPP 525 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 193 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 237 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/48 (50%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ +P PP PPP PPPPP PPPP PP P Sbjct: 246 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/42 (52%), Positives = 25/42 (59%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 437 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 478 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP-PPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPPPP PPPP PPPP PP P Sbjct: 518 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP----SPPPP 558 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ +P PP PPPP PPP PPP PP P Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 271 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/48 (50%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ PSPPPP P PPPP PPPP PP+P Sbjct: 203 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ P PP PPPP PPP PPP PP P Sbjct: 223 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 266 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP +P PP PPPPPPP PPP PP P Sbjct: 233 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PPPP PPPP PPPP PP+P Sbjct: 277 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 320 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP +P PP PPPPPPP PPP PP P Sbjct: 285 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP+ P PP PPPP PPP PPP PP P Sbjct: 293 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPP 336 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PPPPPPP PP P PP PP+P Sbjct: 326 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 369 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PPPPPPP PP P PP PP+P Sbjct: 370 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 413 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/46 (54%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDS----SAPSPPPPPPPPPPPRPPPPGGGGGPP 54 PSP PPPP + S S P P PPPP PPPP PPPP PP Sbjct: 388 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 433 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 P P+PPPP P PPPPPPP PP PPPP PP Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PPPPPPP PP P PP PP+P Sbjct: 440 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 483 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PPPPPPP PP P PP PP+P Sbjct: 484 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 527 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP +P PP PPPP PPP PPP PP P Sbjct: 500 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/46 (54%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDS----SAPSPPPPPPPPPPPRPPPPGGGGGPP 54 PSP PPPP + S S P P PPPP PPPP PPPP PP Sbjct: 502 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 547 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PPPPPPP PP PPPP PP P Sbjct: 432 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP----SPPPP 471 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/44 (50%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PPPPPPP PP P PP PP P Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAP 48 P P+PPPP +P PP PPPP PPPP PPPP PP P Sbjct: 386 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP 426 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/43 (53%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 232 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/50 (54%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP------PPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + PSPPPP PPPPPPP PPPP PP P Sbjct: 279 PSPPPPPPPSPPPPPP-PSPPPPSPPPPSPPPPPPPSPPPP----SPPPP 323 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P S P PPPP PPPP PPPP PP P Sbjct: 300 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 343 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP S P PPP PPPP PP P PP PP+P Sbjct: 336 PSPPPPPPP-----SPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 374 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP S P PPP PPPP PP P PP PP+P Sbjct: 380 PSPPPPPPP-----SPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 418 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP S P PPP PPPP PP P PP PP+P Sbjct: 450 PSPPPPPPP-----SPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 488 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP S P PPP PPPP PP P PP PP+P Sbjct: 494 PSPPPPPPP-----SPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 532 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P +P PPPPP PPPP PPP PP+P Sbjct: 220 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 263 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/44 (50%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPP + S P PPP PPPP PP P PP PP P Sbjct: 292 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPP 335 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAP 48 PSP PP P +P PP PPPP PPPP PPPP PP P Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP 230 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -3 Query: 179 PSPAPP-PPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPP 54 PSP PP PP + PSPPPP PPPP PP PPPP PP Sbjct: 243 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 286 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/42 (50%), Positives = 24/42 (57%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP+ +P PPPPP PPPP PPP PP+P Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 315 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/42 (50%), Positives = 23/42 (54%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP+ +P PPPPP PPPP PPP PP P Sbjct: 331 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 372 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/42 (50%), Positives = 23/42 (54%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP+ +P PP PPPP PPP PPP PP P Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 380 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/42 (50%), Positives = 23/42 (54%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP+ +P PPPPP PPPP PPP PP P Sbjct: 375 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 416 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/42 (50%), Positives = 23/42 (54%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP+ +P PPPPP PPPP PPP PP P Sbjct: 445 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 486 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/42 (50%), Positives = 23/42 (54%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP+ +P PP PPPP PPP PPP PP P Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 494 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/42 (50%), Positives = 23/42 (54%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP+ +P PPPPP PPPP PPP PP P Sbjct: 489 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 530 [191][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVP 117 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 +P PPPP P PPPPPPPPPPP PPPP PP P + G Sbjct: 71 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPG 118 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGG 66 P P PPPP P PPPPPPPPPPP PPPP G Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPG 118 [192][TOP] >UniRef100_A4S3R1 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S3R1_OSTLU Length = 700 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDS-SAPSPPPPPPPPPPPRPPPPGGGGGPP 54 R + +P PPA+ + + SAPS PPPPPPPPPP PPPP GG PP Sbjct: 509 RPGSSAPVAMPPASMQASAPSAPSAPPPPPPPPPPPPPPPPGGHAPP 555 [193][TOP] >UniRef100_Q7JP76 Cytokinesis defect protein 1, isoform a n=2 Tax=Caenorhabditis elegans RepID=Q7JP76_CAEEL Length = 1435 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAP 48 P PPPP S P PPPPPP PPPPP PPP G GGPP P Sbjct: 743 PPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPP 787 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 6/53 (11%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP--PP----PPPRPPPPGGGGGPPAPRDIGG 33 P PPPP + P PPPPP PP PPP PPPPGG PP P GG Sbjct: 727 PPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGG 779 [194][TOP] >UniRef100_Q7JP75 Cytokinesis defect protein 1, isoform b n=1 Tax=Caenorhabditis elegans RepID=Q7JP75_CAEEL Length = 1437 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAP 48 P PPPP S P PPPPPP PPPPP PPP G GGPP P Sbjct: 743 PPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPP 787 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 6/53 (11%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP--PP----PPPRPPPPGGGGGPPAPRDIGG 33 P PPPP + P PPPPP PP PPP PPPPGG PP P GG Sbjct: 727 PPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGG 779 [195][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP P+ Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 83 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 [196][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP P+ Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 56 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 [197][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 P P PPPP P PPPPPPPPPPP PPPP PP P+ Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 107 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/46 (54%), Positives = 26/46 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 42 P P PPPP P PPPPPPPPPPP PPPP PP R+ Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQRE 109 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP P P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVP 114 [198][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 P P PPPP P PPPPPPPPPPP PPPP PP P I Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHI 59 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [199][TOP] >UniRef100_B5DI49 GA25909 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DI49_DROPS Length = 1129 Score = 62.8 bits (151), Expect = 1e-08 Identities = 32/64 (50%), Positives = 33/64 (51%), Gaps = 15/64 (23%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP--------PPPPPRP-------PPPGGGGGPPAPR 45 P P PPP A A +AP PPPPPP PPPPP P PPP G GGPP P Sbjct: 541 PPPPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPPPPPMPGSGAPPPPPPPGFGGPPPPP 600 Query: 44 DIGG 33 GG Sbjct: 601 GSGG 604 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/57 (56%), Positives = 32/57 (56%), Gaps = 12/57 (21%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPP-------PPPPPPR----PPPPG-GGGGPPAP 48 AP P PPPP S AP PPPPP PPPPPP PPPPG GGG PP P Sbjct: 557 APPPPPPPPMPG---SGAPPPPPPPMPGSGAPPPPPPPGFGGPPPPPGSGGGPPPPP 610 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/66 (42%), Positives = 32/66 (48%), Gaps = 10/66 (15%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPP----------PPPPPRPPPPGGGGGPPA 51 ++ A +PAPPP A P PPPPPP PPPPP PP PG G PP Sbjct: 516 EQSAESAGTPAPPPAPALVIPPPPPPPPPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPP 575 Query: 50 PRDIGG 33 P + G Sbjct: 576 PPPMPG 581 [200][TOP] >UniRef100_B4G8I0 GL19302 n=1 Tax=Drosophila persimilis RepID=B4G8I0_DROPE Length = 1104 Score = 62.8 bits (151), Expect = 1e-08 Identities = 32/64 (50%), Positives = 33/64 (51%), Gaps = 15/64 (23%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP--------PPPPPRP-------PPPGGGGGPPAPR 45 P P PPP A A +AP PPPPPP PPPPP P PPP G GGPP P Sbjct: 516 PPPPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPPPPPMPGSGAPPPPPPPGFGGPPPPP 575 Query: 44 DIGG 33 GG Sbjct: 576 GSGG 579 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/57 (56%), Positives = 32/57 (56%), Gaps = 12/57 (21%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPP-------PPPPPPR----PPPPG-GGGGPPAP 48 AP P PPPP S AP PPPPP PPPPPP PPPPG GGG PP P Sbjct: 532 APPPPPPPPMPG---SGAPPPPPPPMPGSGAPPPPPPPGFGGPPPPPGSGGGPPPPP 585 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/66 (42%), Positives = 32/66 (48%), Gaps = 10/66 (15%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPP----------PPPPPRPPPPGGGGGPPA 51 ++ A +PAPPP A P PPPPPP PPPPP PP PG G PP Sbjct: 491 EQSAESAGTPAPPPAPALVIPPPPPPPPPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPP 550 Query: 50 PRDIGG 33 P + G Sbjct: 551 PPPMPG 556 [201][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAP 48 PSP PPPP+ S+P PPPPPP PPPPP PPPP PP P Sbjct: 54 PSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPP 100 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPP--PPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + PSPPPPP PPPPPP PPPP PP P Sbjct: 102 PSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPP 147 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/44 (61%), Positives = 28/44 (63%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP SS P PPPP PPPPPP PPPP PP+P Sbjct: 5 PSPPPPPPPP----SSPPPPPPPSPPPPPPSPPPP----PPPSP 40 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP PSPPPPPPP PPP PP P PP+P Sbjct: 131 PPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSP 174 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 PSP PPPP + S PSPP PPPPPPPP PPPP PP Sbjct: 204 PSP-PPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPP 244 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP ++ SPPPPPPPP PP PPPP PP P Sbjct: 52 PPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPP----SPPPP 91 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/44 (56%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 48 SP PPPP+ +P PPPP PPPPPPP PPPP PP P Sbjct: 127 SPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLP 170 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKD---SSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + S P PPP PPPPPP +PPPP PP P Sbjct: 30 PSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPP 76 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP + PSPP P PPPPPPP PPPP PP P Sbjct: 21 PPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPP 68 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -3 Query: 179 PSPAPPPPAAAEKD--SSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + S P PPPP PPPPPP PPP PPAP Sbjct: 172 PSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAP 217 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/47 (51%), Positives = 25/47 (53%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P P PPA + P PPPPPP PPPP PP P PP P Sbjct: 205 SPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPPPP 251 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/42 (57%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPP--PPPPPPPPRPPPPGGGGGPP 54 P PPPP+ S P PPP PPPPPPPP PPPP PP Sbjct: 49 PPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPP 90 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPP---PRPPPPGGGGGPPAP 48 PS PPPP++ PSPPPPPPP PP P PPPP PP P Sbjct: 61 PSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPP 107 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP P PP PPPPPP P PPPP PP+P Sbjct: 3 PPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPP---PSPPSP 43 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP PSPPPPPP P PP PPP PP P Sbjct: 76 PPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPP 119 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/49 (55%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPP-----PPPPPPRPPPPGGGGGPPAP 48 PSP PPPP PSPPPPP PPPPPP PPPP PP P Sbjct: 93 PSPPPPPPL--------PSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPP 133 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPP---PPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPP + S P PP PPPPPP PP PPPP PP+P Sbjct: 119 PSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSP 165 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP PSPPPPPP PPPP PPP PP+P Sbjct: 148 PSPPPPPP---------PSPPPPPPSPPPPLPPPSPLPPPPPSP 182 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P+PPPP + +P PP PPPPPPP PPP PP P Sbjct: 202 PPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPP 245 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAP 48 P PPPP ++ PSPPPPPP PPPPP PP P PP P Sbjct: 8 PPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/50 (50%), Positives = 26/50 (52%), Gaps = 7/50 (14%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPP-------PPPPPPRPPPPGGGGGPPAP 48 SP PPPP+ S P PPP P PPPPPP PPPP PP P Sbjct: 113 SPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPP 162 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/48 (50%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAP 48 P +PPPP PSPPPPPPP P PP PPPP PP P Sbjct: 13 PPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/49 (53%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPP---PPPPPP---PRPPPPGGGGGPPAP 48 SP PPPP + PSPPPP PPPPPP P PPPP PP P Sbjct: 70 SPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPP 118 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/65 (40%), Positives = 27/65 (41%), Gaps = 21/65 (32%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP---------------------PPPPPPPRPPPPGGGG 63 P P+PPPP PSPPPP PPPPPPP PPPP Sbjct: 146 PPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPS 205 Query: 62 GPPAP 48 PP P Sbjct: 206 PPPPP 210 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP PSPPPPPPP PPP P P PP+P Sbjct: 188 PSPPPPPP---------PSPPPPPPPSPPPPPLPSPPAPSPPSP 222 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + +P PPPP PPPPP P PPP PP P Sbjct: 78 PSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPP 125 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/50 (50%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPP------PPPPPPPPPRPPPPGGGGGPPAP 48 PSP PP P + PSPP PPPPPPP P PPPP PP P Sbjct: 163 PSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLP 212 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/47 (46%), Positives = 23/47 (48%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P P PP+ P PP PPPPPP PPPP PP P Sbjct: 31 SPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPP 77 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PS PPPP + +P PPPP PPPPP PPP PP P Sbjct: 111 PSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPP 154 [202][TOP] >UniRef100_A9RY14 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RY14_PHYPA Length = 311 Score = 62.4 bits (150), Expect = 2e-08 Identities = 41/109 (37%), Positives = 54/109 (49%), Gaps = 2/109 (1%) Frame = +1 Query: 76 GGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAIT 255 GGGG GG GG GG G D S GG A + + +W Y+ P+ TKAIT Sbjct: 80 GGGGGDNGGNGGDYGGGGRDGSSGGDDAGGRAPESSSGILAW--YMDRTQKNPVTTKAIT 137 Query: 256 AGVLVGLGDTLAQMLTGTPLGNLDLPR--LFSFAAFVLVLQGPVGHAWY 396 A +L LGD Q++ +D+ R + +F F+LV GP H WY Sbjct: 138 AAILNLLGDIFCQLVIDKS-DKVDVKRTAVITFLGFILV--GPTLHTWY 183 [203][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 242 APPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPP-----PPPP 281 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 245 PCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCP 288 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP P PP PP P Sbjct: 286 PCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCP 329 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPP PPPP PPPP PP P Sbjct: 269 PPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPP 312 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P P PPPPPPPPP PPPP PP P Sbjct: 274 PPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPP 317 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P P PPPPPPPPP PPP PP P Sbjct: 284 PPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPP 327 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P P PP P PPPPPPPPPPP PPP PP P Sbjct: 252 PCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCP 295 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PP PPPPPPPP PPP PP P Sbjct: 273 PPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPP 316 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPP PPP PPPP PP P Sbjct: 258 PPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPP 301 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P P PPPPPP PP PPPP PP P Sbjct: 267 PPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPP 310 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPP P PPPP PP P Sbjct: 296 PPPPPPPPCPP------PPPPPPPPPPPCPPPPPPPPPCPPPCP 333 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPP PPP PPP PPPP PP P Sbjct: 310 PPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCPPPPCP 353 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PP P P PPPPPP PPPP PPPP PP P Sbjct: 322 PPPPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPPCPPPPPPCP 365 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPP PPPPPP PPPP PP P Sbjct: 265 PPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPP 308 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPP PPP PPPP PP P Sbjct: 268 PPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPP 311 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPP PPPPPP PP P PP P Sbjct: 271 PPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPP 314 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/42 (54%), Positives = 23/42 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 P P PPPP P PPPPPP PPPP PPPP PP Sbjct: 293 PCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPP 334 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPP PPPPPPP P PP PP P Sbjct: 272 PPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPP 315 [204][TOP] >UniRef100_UPI000151B778 hypothetical protein PGUG_03728 n=1 Tax=Pichia guilliermondii ATCC 6260 RepID=UPI000151B778 Length = 270 Score = 62.4 bits (150), Expect = 2e-08 Identities = 39/98 (39%), Positives = 43/98 (43%), Gaps = 5/98 (5%) Frame = -3 Query: 326 SRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPS-----PAPP 162 +R PS VP S V P P VL G + + S APS APP Sbjct: 97 NRAPSPVPTSPAPPVPSAPPPLPGAPPPVLGGGS----------KSSAAPSVPSFPSAPP 146 Query: 161 PPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P A AP+P PP PPPPP PP PG PPAP Sbjct: 147 PAPKATPALKAPAPAAPPAPPPPPAPPAPGMSLAPPAP 184 [205][TOP] >UniRef100_UPI0000D9B853 PREDICTED: similar to Formin-1 isoform IV (Limb deformity protein) n=1 Tax=Macaca mulatta RepID=UPI0000D9B853 Length = 1164 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/49 (57%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPP-----RPPPPGGGGGPPAP 48 P P PPPP SS+ PPPPPPPPPPP P PP GG PPAP Sbjct: 685 PPPPPPPPPPPLPLSSSAGPPPPPPPPPPPPPLPNSPAPPNPGGPPPAP 733 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/57 (45%), Positives = 27/57 (47%), Gaps = 15/57 (26%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPP---------------RPPPPGGGGGPP 54 P P PPPP S+ P PPPPPPPPPPP PPPPG PP Sbjct: 687 PPPPPPPPPLPLSSSAGPPPPPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPP 743 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/58 (50%), Positives = 31/58 (53%), Gaps = 10/58 (17%) Frame = -3 Query: 176 SPAPP-PPAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAPRDIGG 33 SPAPP PP +A P PPPPPP PPPPP PPPP PAP + GG Sbjct: 671 SPAPPVPPVSAGPPPPPPPPPPPPPLPLSSSAGPPPPPPPPPPPPPLPNSPAPPNPGG 728 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 9/54 (16%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPS---------PPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP DS +P+ PPPPPPPPPPP P P GPP P Sbjct: 655 APIP-PPPPLPLGLDSLSPAPPVPPVSAGPPPPPPPPPPPPPLPLSSSAGPPPP 707 [206][TOP] >UniRef100_Q4RY48 Chromosome 3 SCAF14978, whole genome shotgun sequence n=1 Tax=Tetraodon nigroviridis RepID=Q4RY48_TETNG Length = 1449 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 A P PPPPA + P+PPPPPPPPPPP PP P G PPAP Sbjct: 1078 AAPPPPPPPAPV----TGPTPPPPPPPPPPPPPPAPVTGPTPPAP 1118 [207][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP S P PPPPPPPPPPP PPPP G P P Sbjct: 503 PSPPPPPPP-----SPPPPPPPPPPPPPPPPPPPPPPGPSPITP 541 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/41 (58%), Positives = 26/41 (63%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGP 57 P P PPPP+ +P PPPPPPPPPPP PPPP GP Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P P PPPP PSPPPPPPP PPP PPPP PP P Sbjct: 485 SPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP S P PPPP PPPPPP PPPP PP P Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP S P PPP PPPPPPP PPPP PP P Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 P P PPPP P PPPPPPPPPP PPPP PP P I Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPI 539 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S P P PPPP +P PPPPP PPPPP PPPP PP P Sbjct: 485 SPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PP PPPPPPPP PPPP PP P Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 RS SP PPPP P P PPPPPPP P PPPP PP P Sbjct: 480 RSGGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 [208][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 10/56 (17%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSP----------PPPPPPPPPPRPPPPGGGGGPPAP 48 R P +PPPP +A S+PSP PPPPPPPPPP PPPP PP P Sbjct: 216 RPPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPP 271 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/49 (55%), Positives = 30/49 (61%) Frame = -3 Query: 194 RRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 RR SP PPP A++ S +PSP PPPPP PPP PPPP PP P Sbjct: 215 RRPPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPP 263 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +PSP+P PP P PPPPPPPPPPP PPPP PP P Sbjct: 234 SPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/47 (57%), Positives = 28/47 (59%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 S +PSP PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 234 SPSPSPRPPPPPM-------PPPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P P PPPPPPPPP PPPP PP P Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFP 288 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/42 (54%), Positives = 23/42 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 P P PPPP S P PPPPPPPPPP PP P PP Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPP 292 [209][TOP] >UniRef100_C1MZS3 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MZS3_9CHLO Length = 3282 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/50 (58%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPR-----PPPPGGGGGPPAP 48 APSPAPPPP APSP PPPP PPPP+ PPPPG P AP Sbjct: 963 APSPAPPPPERPPTPVVAPSPAPPPPSPPPPQPAEPSPPPPGSPPRPDAP 1012 Score = 60.5 bits (145), Expect = 6e-08 Identities = 39/95 (41%), Positives = 43/95 (45%), Gaps = 5/95 (5%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSR---APSPAPPPPAAA 147 P P + AS P P P + A S A ER APSPAPPPP+ Sbjct: 934 PRAPPEPVAASPPPSPAPPPPERPPTPVVAPSPAP--PPPERPPTPVVAPSPAPPPPSPP 991 Query: 146 EKDSSAPSPPPP--PPPPPPPRPPPPGGGGGPPAP 48 + PSPPPP PP P P PPPPG P AP Sbjct: 992 PPQPAEPSPPPPGSPPRPDAPSPPPPGRPPAPDAP 1026 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/51 (52%), Positives = 30/51 (58%), Gaps = 3/51 (5%) Frame = -3 Query: 191 RSRAP-SPAPPPPAAAEKDSSAPSPPPP--PPPPPPPRPPPPGGGGGPPAP 48 R AP +P+PPPP+ APSPPPP PP P P PPPPG P AP Sbjct: 1061 RPPAPDAPSPPPPSPPPPRPDAPSPPPPGLPPRPAAPSPPPPGQPPAPAAP 1111 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/52 (51%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPPPP--PPPPPPPRPPPPGGGGGPPAP 48 E RS P APP P AA PSPPPP PP P PPPPG P AP Sbjct: 1227 EVRSPPPPVAPPQPVAASPQPEVPSPPPPVAPPQPVAASPPPPGAPPRPAAP 1278 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/53 (52%), Positives = 30/53 (56%), Gaps = 10/53 (18%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPP-----PPPPPP-----PRPPPPGGGGGPPAP 48 +PAPPPP A E AP+PPPP PPPPPP P PPPP P AP Sbjct: 1288 APAPPPPEAPEAPE-APAPPPPEAPEAPPPPPPEAPEAPPPPPPEAPEAPEAP 1339 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP---PPRPPPPGGGGGPPAP 48 R AP PPP APSPPPP PPPP P PPPPG P AP Sbjct: 1047 RPPAPDAPSPPPPGRPPAPDAPSPPPPSPPPPRPDAPSPPPPGLPPRPAAP 1097 [210][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PAPPPP+ P PPPPPPPPPPP PPPP PP+P Sbjct: 1204 PRPAPPPPS--------PPPPPPPPPPPPPLPPPPSPPPPPPSP 1239 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Frame = -3 Query: 182 APSPAPP--PPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 48 APSP PP PP A S P PPPPPPP PPPP PPPP PP+P Sbjct: 1194 APSPPPPGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPPPPSP 1244 Score = 59.3 bits (142), Expect = 1e-07 Identities = 35/98 (35%), Positives = 44/98 (44%), Gaps = 10/98 (10%) Frame = -3 Query: 311 GVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPS---------PAPPP 159 G+P A +P TP +V + + + RAPS P+PPP Sbjct: 1140 GLPPRPGAPAAPATPGTPPSPVVVEEKSPPPRAPSEPERSPPRAPSEPGRPPPTAPSPPP 1199 Query: 158 PAAAEKDSSAP-SPPPPPPPPPPPRPPPPGGGGGPPAP 48 P + + P SPPPPPPPPPPP P PP PP P Sbjct: 1200 PGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPPPPP 1237 Score = 58.5 bits (140), Expect = 2e-07 Identities = 42/104 (40%), Positives = 48/104 (46%), Gaps = 14/104 (13%) Frame = -3 Query: 317 PSGVPVS-ICAS---VSPRPTNTPA----------VMALVLMGATSRALR*DVQERRSRA 180 P G P S + AS V PRP TP V A+ A RA +V E ++ Sbjct: 394 PPGAPASPVWASTPDVPPRPVATPPPLNTPPAVPPVPAVPSSPAQPRAPIVEVPEAVLKS 453 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P+P PPPPA PPP PP P RPPPPG G PP P Sbjct: 454 PTPPPPPPA-----------PPPAPPRSPWRPPPPGTPGVPPPP 486 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPP 75 +P P PPPP PSPPPPPP PPPP PPPP Sbjct: 1212 SPPPPPPPPPPPPPLPPPPSPPPPPPSPPPPSPPPP 1247 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 AP P PPP P PPPP PPPPPP PPPP PP Sbjct: 1207 APPPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPPPPSPPPPPP 1249 [211][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 23 PPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 P P P PP P PPPPPPPPPPP PPPP PP P +I Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 72 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPP P PPPPPPPPPPP PPPP PP P Sbjct: 24 PPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PP P P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -3 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PPPP P PPPPPPPPPP PPPP PP P Sbjct: 16 PPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 55 [212][TOP] >UniRef100_Q5RB50 Putative uncharacterized protein DKFZp459N037 n=1 Tax=Pongo abelii RepID=Q5RB50_PONAB Length = 494 Score = 62.4 bits (150), Expect = 2e-08 Identities = 40/102 (39%), Positives = 44/102 (43%), Gaps = 4/102 (3%) Frame = -3 Query: 335 RGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPA---- 168 RGR P P + A+ P P + P+V P P Sbjct: 305 RGRGAPPPPPPRAPTAAPPPPPPSRPSVAV---------------------PPPPPNRMY 343 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 42 PPPP A SSAPS PPPPPPPPPP PPPPG P P D Sbjct: 344 PPPPPALP--SSAPSGPPPPPPPPPPPPPPPGPPPPPGLPSD 383 [213][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [214][TOP] >UniRef100_A9UWW7 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9UWW7_MONBE Length = 558 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPP 75 P P PPPP+A S+AP+ PPPPPPPPPP PPPP Sbjct: 471 PPPPPPPPSANAGASAAPAAPPPPPPPPPPPPPPP 505 [215][TOP] >UniRef100_Q55RM6 Putative uncharacterized protein n=1 Tax=Filobasidiella neoformans RepID=Q55RM6_CRYNE Length = 458 Score = 62.4 bits (150), Expect = 2e-08 Identities = 41/126 (32%), Positives = 44/126 (34%), Gaps = 9/126 (7%) Frame = -3 Query: 383 PTGPWRTSTNAAKLNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*D 204 P P + A RS PS V SV P P P R Sbjct: 244 PPAPPTSRRKPAPPPPASRSARPSSVAQPSAPSVPPPPPPPPPPG------------RPA 291 Query: 203 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP---------PPPPRPPPPGGGGGPPA 51 AP P PPPP D + +PPPPPPP PPPP PPP PP Sbjct: 292 APPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPPPPPTSAPSAPPL 351 Query: 50 PRDIGG 33 P GG Sbjct: 352 PTASGG 357 [216][TOP] >UniRef100_Q4P876 Putative uncharacterized protein n=1 Tax=Ustilago maydis RepID=Q4P876_USTMA Length = 460 Score = 62.4 bits (150), Expect = 2e-08 Identities = 42/115 (36%), Positives = 51/115 (44%), Gaps = 7/115 (6%) Frame = -3 Query: 365 TSTNAAKLNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRS 186 T++ A+ + P P S A+ +P P P + A A S A R Sbjct: 260 TASTASASSSAPAPAPPPPPPRSGTAAATPPPPPPPPLRA----PAVSSAPPPPPPPMRP 315 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGP-PAPRD 42 A S APPPP S+ PPPPPPPP PPP PPPP G P P P+D Sbjct: 316 AAGSSAPPPPPMRPAAGSSAPPPPPPPPPMSGSSAPPPPPPPPTSGSAPLPPPQD 370 [217][TOP] >UniRef100_Q0CKV1 Cytokinesis protein sepA n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CKV1_ASPTN Length = 1795 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/49 (55%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 48 P P PPPP K P PPPPPPP PPP PPPPG GPP P Sbjct: 1046 PPPPPPPPPPGMKAGMPPPPPPPPPPGAAGGMPPPPPPPPGASFGPPPP 1094 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/54 (48%), Positives = 29/54 (53%), Gaps = 10/54 (18%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP----------PPPPPRPPPPGGGGGPPAP 48 P P PPPP ++ +PPPPPP PPPPP PPPPG GG P P Sbjct: 1027 PPPPPPPPPPPPGGAAGLTPPPPPPPPPPGMKAGMPPPPPPPPPPGAAGGMPPP 1080 [218][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P PPPP ++ + P PPPPPPPPPPP PPPP PP P Sbjct: 253 PPPPPPGDPFQEITGPGPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PP E P PPPPPPPPPPP PPPP PP P Sbjct: 253 PPPPPPGDPFQEITGPGPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPP 78 P PPPP P PPPPPPPPPPP PPP Sbjct: 268 PGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 [219][TOP] >UniRef100_A8NWX4 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NWX4_COPC7 Length = 1693 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP +AP PPPPPPPPPPP P G G PP P Sbjct: 1202 PPPPPPPPILFSSGKTAPPPPPPPPPPPPPSTLPDGKGPPPPPP 1245 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/91 (36%), Positives = 41/91 (45%), Gaps = 8/91 (8%) Frame = -3 Query: 299 SICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSP 120 SIC+ SP P P ++ ++ + P P PPPP + D P P Sbjct: 1190 SICSMPSPPPPPPPPPPPPPILFSSGKTAP-------PPPPPPPPPPPPSTLPDGKGPPP 1242 Query: 119 PPPPPPPPP--------PRPPPPGGGGGPPA 51 PPPPPPPPP P PPPP GG P+ Sbjct: 1243 PPPPPPPPPALGGSGPPPPPPPPAPGGWRPS 1273 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/63 (41%), Positives = 31/63 (49%), Gaps = 13/63 (20%) Frame = -3 Query: 197 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRP-------------PPPGGGGGP 57 E+ + SP PPPP + + +P PPPPPPPPPPP P PPP P Sbjct: 1146 EQEFKVKSPPPPPPVKPRQSAQSPPPPPPPPPPPPPAPHMSMAPSICSMPSPPPPPPPPP 1205 Query: 56 PAP 48 P P Sbjct: 1206 PPP 1208 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/51 (54%), Positives = 28/51 (54%), Gaps = 7/51 (13%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPS----PPPPPPPPPPPRPPP---PGGGGGPPAP 48 P P PPPP A S APS P PPPPPPPPP PPP G PP P Sbjct: 1172 PPPPPPPPPPAPHMSMAPSICSMPSPPPPPPPPPPPPPILFSSGKTAPPPP 1222 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/71 (42%), Positives = 33/71 (46%), Gaps = 19/71 (26%) Frame = -3 Query: 203 VQERRSRAPSPAPPPP----------AAAEKDSSAPSPPPPPPPPPPPRP---------P 81 V+ R+S P PPPP + A S PSPPPPPPPPPPP P P Sbjct: 1160 VKPRQSAQSPPPPPPPPPPPPPAPHMSMAPSICSMPSPPPPPPPPPPPPPILFSSGKTAP 1219 Query: 80 PPGGGGGPPAP 48 PP PP P Sbjct: 1220 PPPPPPPPPPP 1230 [220][TOP] >UniRef100_A6R0R5 Predicted protein n=1 Tax=Ajellomyces capsulatus NAm1 RepID=A6R0R5_AJECN Length = 765 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/62 (48%), Positives = 32/62 (51%), Gaps = 15/62 (24%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-------PPRP--------PPPGGGGGPP 54 S P P PPPP A S+ P+PPPPPPPPP PPRP PPP G PP Sbjct: 485 SPTPPPPPPPPPAPAPASTGPAPPPPPPPPPTAGLPRPPPRPAPSNSVPPPPPPSAGAPP 544 Query: 53 AP 48 P Sbjct: 545 PP 546 Score = 61.6 bits (148), Expect = 3e-08 Identities = 41/111 (36%), Positives = 49/111 (44%), Gaps = 19/111 (17%) Frame = -3 Query: 320 LPSGVPVSICASVSPRP----TNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPA 153 LP +P + PRP T+TP L+ L + AP+P PPPP Sbjct: 415 LPPKIPHATPPPPPPRPQASPTSTPQSQHLLPPQTAPGPLPVRPAPPPTSAPAPPPPPPP 474 Query: 152 AAEKD---SSAPSPPPPPPP------------PPPPRPPPPGGGGGPPAPR 45 A SS+P+PPPPPPP PPPP PPPP G P PR Sbjct: 475 APAPGPVPSSSPTPPPPPPPPPAPAPASTGPAPPPPPPPPPTAGLPRPPPR 525 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 9/54 (16%) Frame = -3 Query: 182 APS---PAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPG---GGGGPPAP 48 APS P PPPP+A AP PPPPP PPPPP PPPPG GPP P Sbjct: 527 APSNSVPPPPPPSAG-----APPPPPPPSAGAPPPPPPPPPPGSAANSAGPPPP 575 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/59 (45%), Positives = 29/59 (49%), Gaps = 12/59 (20%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPP--------PPPPPP----PPRPPPPGGGGGPPAP 48 S P+P PPPP + P PPP PPPPPP PP PPPP G PP P Sbjct: 502 STGPAPPPPPP--PPPTAGLPRPPPRPAPSNSVPPPPPPSAGAPPPPPPPSAGAPPPPP 558 [221][TOP] >UniRef100_Q5TJ56 Formin-F n=1 Tax=Dictyostelium discoideum RepID=FORF_DICDI Length = 1220 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/54 (51%), Positives = 30/54 (55%), Gaps = 6/54 (11%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGPPAPRDIGG 33 +P P PPA PPPPPPPP PPP PPPP GGGPP P +GG Sbjct: 576 TPPPAPPAPPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGG 629 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/60 (50%), Positives = 30/60 (50%), Gaps = 13/60 (21%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPP------PPPPPPPPR-------PPPPGGGGGPPAPRDIGG 33 PAPPPP P PPP PPPPPPPP PPP GG GGPP P GG Sbjct: 582 PAPPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPPPPGGGG 641 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/49 (53%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 48 P PAPP P P PPPPPP PPPP PPP GGG PP P Sbjct: 577 PPPAPPAPPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPP 625 [222][TOP] >UniRef100_B4FIN2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FIN2_MAIZE Length = 351 Score = 62.0 bits (149), Expect = 2e-08 Identities = 38/130 (29%), Positives = 56/130 (43%), Gaps = 22/130 (16%) Frame = +1 Query: 79 GGGRGGGGGGGGGGGEGADESFSAAA--GGGGAGLGALLL-------------------- 192 GGG G G GGGGG + D + A G L LL Sbjct: 98 GGGAGSGASGGGGGNKMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPE 157 Query: 193 RSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQ 372 +W++Y +AL P+ K + +GV+ LGD +AQ G P+ + D R+F L Sbjct: 158 HNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKPIFDFDRARMFRSGLVGFTLH 217 Query: 373 GPVGHAWYNL 402 G + H +Y++ Sbjct: 218 GSLSHYYYHI 227 [223][TOP] >UniRef100_UPI0001868097 hypothetical protein BRAFLDRAFT_128521 n=1 Tax=Branchiostoma floridae RepID=UPI0001868097 Length = 1189 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 ++ P P+ PAA SSA PPPPPPPPPP PPPP G PP P + G Sbjct: 660 NKVPRPSSLAPAAGAPSSSAGDLPPPPPPPPPPAPPPPPPPGMPPPPPPLPG 711 [224][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/44 (61%), Positives = 28/44 (63%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PSP PPPP + AP PPPPPPPPPPP PPPP PAP Sbjct: 62 PSPPPPPPPVTY-NYPAPPPPPPPPPPPPPPPPPPPPRVSTPAP 104 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/62 (46%), Positives = 34/62 (54%), Gaps = 12/62 (19%) Frame = -3 Query: 188 SRAPSPAP----PPPAAA--------EKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 45 S PSP+P PPP+ + S+PSPPPPPPPPPPPRPPPP P P Sbjct: 453 SSTPSPSPSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPT 512 Query: 44 DI 39 + Sbjct: 513 SL 514 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/58 (44%), Positives = 29/58 (50%), Gaps = 13/58 (22%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPPPP-------------PPPRPPPPGGGGGPPAPRDI 39 P+PPPP + + PSPPPPPPPP P PRPPPP P PR I Sbjct: 541 PSPPPPPSLPVTYNYPSPPPPPPPPSYNYPAPTYYYPSPSPRPPPPPPRPRPSRPRPI 598 [225][TOP] >UniRef100_UPI0000E12BCF Os07g0596300 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E12BCF Length = 754 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P PPPP + + PSPPPPP PPPP PPPPG GPP P Sbjct: 155 APPPPPPPPITRSGAPPSPPPPPSPPPP--PPPPGARPGPPPP 195 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/63 (49%), Positives = 33/63 (52%), Gaps = 14/63 (22%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP------PPPPPP-------PPRPPPPGGGG-GPPAPRD 42 P P PPPP + S+ P PPP PPPPPP PP PPPPG GG PP P Sbjct: 203 PGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPA 262 Query: 41 IGG 33 GG Sbjct: 263 PGG 265 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGG-GGGPPAP 48 PSP PPPP + P PPPPPPPP PPP PPPPGG PP P Sbjct: 177 PSPPPPPPPPGAR----PGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLP 222 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 12/62 (19%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPP------PRPPPPGGGGGPPAPRD 42 RA +P PPPP + + P PPP PPPPP P P PPPP GG PP PR Sbjct: 227 RASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRG 286 Query: 41 IG 36 G Sbjct: 287 PG 288 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 6/54 (11%) Frame = -3 Query: 191 RSRAPS---PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG---GGGPPAP 48 RS P+ P PPPP + S AP PPPPPPPPPPP P P PP P Sbjct: 52 RSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPP 105 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 13/60 (21%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPS-------PPPPPPP------PPPPRPPPPGGGGGPPAP 48 S AP P PPPP SAPS PPPPPPP PPPP PPP PP P Sbjct: 73 SGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPP 132 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSP------PPPPPPPPPPRPPPPGGGGGPPAP 48 R AP P PPP A P+P PPPPPPP PPPP G G PP P Sbjct: 240 RLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAPPPP 293 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 7/55 (12%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPS--PPPPPPPPPP-----PRPPPPGGGGGPPAP 48 RS AP P+PPPP + P P PPPPPPPP P PPPP GG P AP Sbjct: 166 RSGAP-PSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAP 219 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAP 48 S APPPP +AP PPPPPP PPPP PPP G PP+P Sbjct: 126 SNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSP 173 [226][TOP] >UniRef100_UPI0000D9E432 PREDICTED: similar to formin-like 1 isoform 7 n=1 Tax=Macaca mulatta RepID=UPI0000D9E432 Length = 1023 Score = 62.0 bits (149), Expect = 2e-08 Identities = 48/144 (33%), Positives = 58/144 (40%), Gaps = 29/144 (20%) Frame = -3 Query: 389 AWPTGPWRTSTNAAKLNKRGRSRLPSG---------VPVSI-CASVSPRPTNTPAVMALV 240 A PT P +L ++G R+ G +PV++ SPRP + +A Sbjct: 399 AAPTRPSALELKVEELEEKGLIRILRGPGDAVSIEILPVAVELTRTSPRPALAGSDLAPA 458 Query: 239 LMGATSRALR*--------DVQERRSRAPSPAPP------PPAAAEKDSSAPSPPPPPPP 102 A A QE AP APP PP A P PPPPPPP Sbjct: 459 AEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPFPGSPEPPPAPPLPGDLPPPPPPPPP 518 Query: 101 PPPPR-----PPPPGGGGGPPAPR 45 PPPP PPPP GGPP P+ Sbjct: 519 PPPPGTDGPVPPPPPPPGGPPLPK 542 [227][TOP] >UniRef100_UPI0000D9E42C PREDICTED: similar to formin-like 1 isoform 6 n=1 Tax=Macaca mulatta RepID=UPI0000D9E42C Length = 1037 Score = 62.0 bits (149), Expect = 2e-08 Identities = 48/144 (33%), Positives = 58/144 (40%), Gaps = 29/144 (20%) Frame = -3 Query: 389 AWPTGPWRTSTNAAKLNKRGRSRLPSG---------VPVSI-CASVSPRPTNTPAVMALV 240 A PT P +L ++G R+ G +PV++ SPRP + +A Sbjct: 413 AAPTRPSALELKVEELEEKGLIRILRGPGDAVSIEILPVAVELTRTSPRPALAGSDLAPA 472 Query: 239 LMGATSRALR*--------DVQERRSRAPSPAPP------PPAAAEKDSSAPSPPPPPPP 102 A A QE AP APP PP A P PPPPPPP Sbjct: 473 AEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPFPGSPEPPPAPPLPGDLPPPPPPPPP 532 Query: 101 PPPPR-----PPPPGGGGGPPAPR 45 PPPP PPPP GGPP P+ Sbjct: 533 PPPPGTDGPVPPPPPPPGGPPLPK 556 [228][TOP] >UniRef100_UPI0000222115 hypothetical protein CBG16504 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000222115 Length = 1448 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGG--GGGPPAP 48 P PPPP P PPPPPP PPPPP PPPPGG GG PP P Sbjct: 751 PPPPPPGGLPPVRGGPPPPPPPPGSGPPPPPPPPPPGGFKGGLPPPP 797 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPP---PP---PPPPRPPPPGGGGGPPAP 48 P PPPP + P PPPPP PP PPP PPPPG G PP P Sbjct: 735 PPPPPPGGLPPITGGPPPPPPPGGLPPVRGGPPPPPPPPGSGPPPPPP 782 [229][TOP] >UniRef100_UPI0000E7F7FF PREDICTED: similar to N-WASP n=1 Tax=Gallus gallus RepID=UPI0000E7F7FF Length = 505 Score = 62.0 bits (149), Expect = 2e-08 Identities = 38/88 (43%), Positives = 42/88 (47%) Frame = -3 Query: 335 RGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPP 156 RGR P + A+ P P + P A V +R S APS PPPP Sbjct: 306 RGRGAPPPPPSRAPTAAPPPPPPSRPG--AAVPPPPPNRMYPPPPPVHSSSAPSGPPPPP 363 Query: 155 AAAEKDSSAPSPPPPPPPPPPPRPPPPG 72 SSAP PPPPPPPPP P PPPPG Sbjct: 364 PPPASGSSAPPPPPPPPPPPGP-PPPPG 390 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/60 (46%), Positives = 32/60 (53%), Gaps = 13/60 (21%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPP----PPPPP---------PPPRPPPPGGGGGPPAP 48 SRAP+ APPPP + ++ P PPP PPPPP PPP PPPP G P P Sbjct: 316 SRAPTAAPPPPPPSRPGAAVPPPPPNRMYPPPPPVHSSSAPSGPPPPPPPPASGSSAPPP 375 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/44 (54%), Positives = 25/44 (56%), Gaps = 6/44 (13%) Frame = -3 Query: 167 PPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPP 54 PPPP + S P PPPPPP PPPPP PPPP G PP Sbjct: 346 PPPPVHSSSAPSGPPPPPPPPASGSSAPPPPPPPPPPPGPPPPP 389 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/51 (47%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGGPPAPRDI 39 P PPP ++ S P PPPPP PPPPPP PPPPG P P ++ Sbjct: 345 PPPPPVHSSSAPSGPPPPPPPPASGSSAPPPPPPPPPPPGPPPPPGLPSEV 395 [230][TOP] >UniRef100_Q4RLQ7 Chromosome 10 SCAF15019, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4RLQ7_TETNG Length = 579 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/50 (56%), Positives = 30/50 (60%), Gaps = 8/50 (16%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPP-------PPPPPPRPPPPG-GGGGPPAP 48 P PPPP ++ AP PPPPP PPPPPP PPPPG G GPP P Sbjct: 374 PPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPPP 423 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/86 (39%), Positives = 39/86 (45%), Gaps = 6/86 (6%) Frame = -3 Query: 287 SVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPP 108 S++P PT A + L D +A +P PPPP P PPPPP Sbjct: 332 SLAPSPTQ-----------ALPKKLNLDAIGLNLKAGAPPPPPPPPPPPGFLGPPPPPPP 380 Query: 107 P------PPPPPRPPPPGGGGGPPAP 48 P PPPP PPPP GGGPP P Sbjct: 381 PLPGNTGAPPPPPPPPPLPGGGPPPP 406 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/70 (41%), Positives = 33/70 (47%), Gaps = 17/70 (24%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPP-----PPPPPPRPPPPG------------GGGGPPA 51 P P PPPP + P PPPPP PPPPPP PPPPG G GPP Sbjct: 374 PPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPPPPPPPGCGPPP 433 Query: 50 PRDIGGVDEE 21 P +G ++ Sbjct: 434 PPPMGSFGQK 443 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/49 (53%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 AP P PPPP P PPPPPP PPP PPPPG G PP P Sbjct: 388 APPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPPPPPPPGCGPPPPPP 436 [231][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 AP P PPPP P PPPPPPPPPPP PPP PP P I Sbjct: 1408 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPI 1455 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIG 36 P P PPPP P PPPPPPPPPP PP P PP P G Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSG 1458 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/39 (53%), Positives = 22/39 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGG 63 P P PPPP P+PPP PPPPPPP PP G G Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTG 1460 [232][TOP] >UniRef100_A9WHI6 Putative uncharacterized protein n=1 Tax=Chloroflexus aurantiacus J-10-fl RepID=A9WHI6_CHLAA Length = 344 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/98 (34%), Positives = 40/98 (40%), Gaps = 12/98 (12%) Frame = -3 Query: 326 SRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRA----------- 180 +R P P +V+P PT +P A+ A A Sbjct: 231 TRQPVSTPSPTVVTVTPSPTTSPTASPTASPTASPTASPTASPTASPTASATASPTEPPP 290 Query: 179 -PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG 69 P P PPPP A +PPPPPPPPPPP PPPP G Sbjct: 291 PPPPPPPPPTVAPPPPPTVAPPPPPPPPPPPPPPPPPG 328 [233][TOP] >UniRef100_Q2QUG5 Retrotransposon protein, putative, unclassified, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q2QUG5_ORYSJ Length = 895 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/77 (46%), Positives = 40/77 (51%), Gaps = 14/77 (18%) Frame = -3 Query: 224 SRALR*DVQERRSRAPSPAPPPPA---AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGP- 57 +RAL+ D + APS PPP A SS+ SPPPPPPPPPPP PPPP P Sbjct: 71 ARALKADAAAPVASAPSTPPPPQPPHLATPGASSSSSPPPPPPPPPPPPPPPPPCLVPPV 130 Query: 56 ----------PAPRDIG 36 PAPRD G Sbjct: 131 REQVPYPPILPAPRDFG 147 [234][TOP] >UniRef100_B9FY87 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FY87_ORYSJ Length = 1589 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P PPPP + + PSPPPPP PPPP PPPPG GPP P Sbjct: 990 APPPPPPPPITRSGAPPSPPPPPSPPPP--PPPPGARPGPPPP 1030 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/63 (49%), Positives = 33/63 (52%), Gaps = 14/63 (22%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP------PPPPPP-------PPRPPPPGGGG-GPPAPRD 42 P P PPPP + S+ P PPP PPPPPP PP PPPPG GG PP P Sbjct: 1038 PGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPA 1097 Query: 41 IGG 33 GG Sbjct: 1098 PGG 1100 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGG-GGGPPAP 48 PSP PPPP + P PPPPPPPP PPP PPPPGG PP P Sbjct: 1012 PSPPPPPPPPGAR----PGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLP 1057 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 12/62 (19%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPP------PRPPPPGGGGGPPAPRD 42 RA +P PPPP + + P PPP PPPPP P P PPPP GG PP PR Sbjct: 1062 RASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRG 1121 Query: 41 IG 36 G Sbjct: 1122 PG 1123 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/95 (36%), Positives = 41/95 (43%), Gaps = 5/95 (5%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P P S S P P P +M+ GA +R P P PPP + Sbjct: 924 PPPPPASSGLSSIPPPPPPPPLMSF---GAQTRTFV-------PPPPPPPPPPRSGVAAR 973 Query: 137 SSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAP 48 +AP PPPPPP PPPP PPP G PP+P Sbjct: 974 FNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSP 1008 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSP------PPPPPPPPPPRPPPPGGGGGPPAP 48 R AP P PPP A P+P PPPPPPP PPPP G G PP P Sbjct: 1075 RLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAPPPP 1128 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 7/55 (12%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPS--PPPPPPPPPP-----PRPPPPGGGGGPPAP 48 RS AP P+PPPP + P P PPPPPPPP P PPPP GG P AP Sbjct: 1001 RSGAP-PSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAP 1054 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 13/58 (22%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSS---------APSPPPPPPPPPPPRPPPPGGGGG----PPAP 48 AP P PPPP SS PPPPPPPPP P PPPP G PP P Sbjct: 883 APPPPPPPPPPYASSSSLSMHMGSATKQQPPPPPPPPPLPPPPPPPASSGLSSIPPPP 940 [235][TOP] >UniRef100_C3ZR57 Putative uncharacterized protein (Fragment) n=1 Tax=Branchiostoma floridae RepID=C3ZR57_BRAFL Length = 1018 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDIGG 33 ++ P P+ PAA SSA PPPPPPPPPP PPPP G PP P + G Sbjct: 551 NKVPRPSSLAPAAGAPSSSAGDLPPPPPPPPPPAPPPPPPPGMPPPPPPLPG 602 [236][TOP] >UniRef100_B4LU87 GJ17267 n=1 Tax=Drosophila virilis RepID=B4LU87_DROVI Length = 1229 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/52 (55%), Positives = 29/52 (55%), Gaps = 7/52 (13%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPP-------PPRPPPPGGGGGPPAP 48 AP P PPPP P PPPPPPPPP PP PPPP GGGPP P Sbjct: 669 APPPPPPPP---------PPPPPPPPPPPGMTAAAAPPPPPPPPPGGGPPPP 711 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 P P PPPP ++AP PPPPPP PPPPP P P G GPP P Sbjct: 679 PPPPPPPPPPGMTAAAAPPPPPPPPPGGGPPPPPPPGPANVGNGPPPP 726 [237][TOP] >UniRef100_A8XPD1 C. briggsae CBR-CYK-1 protein n=1 Tax=Caenorhabditis briggsae RepID=A8XPD1_CAEBR Length = 1477 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGG--GGGPPAP 48 P PPPP P PPPPPP PPPPP PPPPGG GG PP P Sbjct: 780 PPPPPPGGLPPVRGGPPPPPPPPGSGPPPPPPPPPPGGFKGGLPPPP 826 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Frame = -3 Query: 173 PAPPPPAAAEKDSSAPSPPPPP---PP---PPPPRPPPPGGGGGPPAP 48 P PPPP + P PPPPP PP PPP PPPPG G PP P Sbjct: 764 PPPPPPGGLPPITGGPPPPPPPGGLPPVRGGPPPPPPPPGSGPPPPPP 811 [238][TOP] >UniRef100_A4RC14 Predicted protein n=1 Tax=Magnaporthe grisea RepID=A4RC14_MAGGR Length = 429 Score = 62.0 bits (149), Expect = 2e-08 Identities = 41/124 (33%), Positives = 50/124 (40%), Gaps = 12/124 (9%) Frame = -3 Query: 383 PTGPWRTSTNAAKLNKRGRSRLPSGVPVSICASVSPR-PTNTPAVMALVLMGATSRALR* 207 P W TST L S C + +P P PA +V++ T Sbjct: 272 PPQSWTTSTLT----------LTSTTTFLECPTATPDCPIKKPATTTVVVVTTT------ 315 Query: 206 DVQERRSRAPSPAPPPP-----------AAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGG 60 V S PSP PPPP ++E + +PPPPPPPPPPP PP G Sbjct: 316 -VCPVTSATPSPPPPPPKTTAAPPPLPAVSSEPPKTTGAPPPPPPPPPPPPPPASSGSPA 374 Query: 59 PPAP 48 PP P Sbjct: 375 PPPP 378 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/66 (39%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPR------PPPPGGGGGPPAPRDIGGVDEE 21 AP P PPPP +S+ SP PPPPPPPPP+ P PP AP + Sbjct: 353 APPPPPPPPPPPPPPASSGSPAPPPPPPPPPKTTMVPQPQPPTTSTTTSAPPIVTAAANA 412 Query: 20 RNSSGV 3 + + GV Sbjct: 413 QRAGGV 418 [239][TOP] >UniRef100_B2AWS3 Actin cytoskeleton-regulatory complex protein PAN1 n=1 Tax=Podospora anserina RepID=PAN1_PODAN Length = 1441 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/98 (36%), Positives = 39/98 (39%), Gaps = 3/98 (3%) Frame = -3 Query: 317 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 138 P +P A P P P + MGA P P PPPP Sbjct: 1328 PPAIPSPTAAGAPPAPPPPPPMPG---MGAP---------------PPPPPPPPMPGSGA 1369 Query: 137 SSAPSPPPPPPP---PPPPRPPPPGGGGGPPAPRDIGG 33 +AP PPPPP P PPPP PPPP GG P GG Sbjct: 1370 PAAPPPPPPPAPGGAPPPPPPPPPPPGGAPAPAAPAGG 1407 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/51 (52%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPPAP 48 +P PA P P AA + P+PPPPPP PPPPP PPP G G P AP Sbjct: 1326 SPPPAIPSPTAA---GAPPAPPPPPPMPGMGAPPPPPPPPPMPGSGAPAAP 1373 Score = 54.3 bits (129), Expect = 4e-06 Identities = 33/88 (37%), Positives = 39/88 (44%), Gaps = 13/88 (14%) Frame = -3 Query: 275 RPTNTPAVMALVLMGATSRALR*DVQERRSRAPSP------APPPPAAAEKDSSAPSPPP 114 RP A +A +L G + +S A SP A PPPA ++ P P Sbjct: 1284 RPGQGAAHLASILFGTMAPPRPLSATGDKSAAASPPVTSPVASPPPAIPSPTAAGAPPAP 1343 Query: 113 PPPP-------PPPPRPPPPGGGGGPPA 51 PPPP PPPP PPPP G G PA Sbjct: 1344 PPPPPMPGMGAPPPPPPPPPMPGSGAPA 1371 [240][TOP] >UniRef100_Q84ZL0-2 Isoform 2 of Formin-like protein 5 n=1 Tax=Oryza sativa Japonica Group RepID=Q84ZL0-2 Length = 1627 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P PPPP + + PSPPPPP PPPP PPPPG GPP P Sbjct: 1028 APPPPPPPPITRSGAPPSPPPPPSPPPP--PPPPGARPGPPPP 1068 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/63 (49%), Positives = 33/63 (52%), Gaps = 14/63 (22%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP------PPPPPP-------PPRPPPPGGGG-GPPAPRD 42 P P PPPP + S+ P PPP PPPPPP PP PPPPG GG PP P Sbjct: 1076 PGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPA 1135 Query: 41 IGG 33 GG Sbjct: 1136 PGG 1138 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGG-GGGPPAP 48 PSP PPPP + P PPPPPPPP PPP PPPPGG PP P Sbjct: 1050 PSPPPPPPPPGAR----PGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLP 1095 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 12/62 (19%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPP------PRPPPPGGGGGPPAPRD 42 RA +P PPPP + + P PPP PPPPP P P PPPP GG PP PR Sbjct: 1100 RASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRG 1159 Query: 41 IG 36 G Sbjct: 1160 PG 1161 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 6/54 (11%) Frame = -3 Query: 191 RSRAPS---PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG---GGGPPAP 48 RS P+ P PPPP + S AP PPPPPPPPPPP P P PP P Sbjct: 925 RSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPP 978 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 13/60 (21%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPS-------PPPPPPP------PPPPRPPPPGGGGGPPAP 48 S AP P PPPP SAPS PPPPPPP PPPP PPP PP P Sbjct: 946 SGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPP 1005 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSP------PPPPPPPPPPRPPPPGGGGGPPAP 48 R AP P PPP A P+P PPPPPPP PPPP G G PP P Sbjct: 1113 RLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAPPPP 1166 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 7/55 (12%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPS--PPPPPPPPPP-----PRPPPPGGGGGPPAP 48 RS AP P+PPPP + P P PPPPPPPP P PPPP GG P AP Sbjct: 1039 RSGAP-PSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAP 1092 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/61 (44%), Positives = 28/61 (45%), Gaps = 17/61 (27%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP------------PPPRPPPPG-----GGGGPPA 51 P P PPPP + PPPPPPPP PPP PPPP GG PPA Sbjct: 859 PPPLPPPPPPPASSGLSSIPPPPPPPPLMSFGAQTRTFVPPPPPPPPPPRSGVGGNTPPA 918 Query: 50 P 48 P Sbjct: 919 P 919 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAP 48 S APPPP +AP PPPPPP PPPP PPP G PP+P Sbjct: 999 SNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSP 1046 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 13/58 (22%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSS---------APSPPPPPPPPPPPRPPPPGGGGG----PPAP 48 AP P PPPP SS PPPPPPPPP P PPPP G PP P Sbjct: 824 APPPPPPPPPPYASSSSLSMHMGSATKQQPPPPPPPPPLPPPPPPPASSGLSSIPPPP 881 [241][TOP] >UniRef100_Q84ZL0 Formin-like protein 5 n=1 Tax=Oryza sativa Japonica Group RepID=FH5_ORYSJ Length = 1627 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 +P PPPP + + PSPPPPP PPPP PPPPG GPP P Sbjct: 1028 APPPPPPPPITRSGAPPSPPPPPSPPPP--PPPPGARPGPPPP 1068 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/63 (49%), Positives = 33/63 (52%), Gaps = 14/63 (22%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPP------PPPPPP-------PPRPPPPGGGG-GPPAPRD 42 P P PPPP + S+ P PPP PPPPPP PP PPPPG GG PP P Sbjct: 1076 PGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPA 1135 Query: 41 IGG 33 GG Sbjct: 1136 PGG 1138 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGG-GGGPPAP 48 PSP PPPP + P PPPPPPPP PPP PPPPGG PP P Sbjct: 1050 PSPPPPPPPPGAR----PGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLP 1095 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 12/62 (19%) Frame = -3 Query: 185 RAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPP------PRPPPPGGGGGPPAPRD 42 RA +P PPPP + + P PPP PPPPP P P PPPP GG PP PR Sbjct: 1100 RASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRG 1159 Query: 41 IG 36 G Sbjct: 1160 PG 1161 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 6/54 (11%) Frame = -3 Query: 191 RSRAPS---PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG---GGGPPAP 48 RS P+ P PPPP + S AP PPPPPPPPPPP P P PP P Sbjct: 925 RSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPP 978 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 13/60 (21%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPS-------PPPPPPP------PPPPRPPPPGGGGGPPAP 48 S AP P PPPP SAPS PPPPPPP PPPP PPP PP P Sbjct: 946 SGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPP 1005 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSP------PPPPPPPPPPRPPPPGGGGGPPAP 48 R AP P PPP A P+P PPPPPPP PPPP G G PP P Sbjct: 1113 RLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAPPPP 1166 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 7/55 (12%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPS--PPPPPPPPPP-----PRPPPPGGGGGPPAP 48 RS AP P+PPPP + P P PPPPPPPP P PPPP GG P AP Sbjct: 1039 RSGAP-PSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAP 1092 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/61 (44%), Positives = 28/61 (45%), Gaps = 17/61 (27%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPP------------PPPRPPPPG-----GGGGPPA 51 P P PPPP + PPPPPPPP PPP PPPP GG PPA Sbjct: 859 PPPLPPPPPPPASSGLSSIPPPPPPPPLMSFGAQTRTFVPPPPPPPPPPRSGVGGNTPPA 918 Query: 50 P 48 P Sbjct: 919 P 919 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAP 48 S APPPP +AP PPPPPP PPPP PPP G PP+P Sbjct: 999 SNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSP 1046 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 13/58 (22%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSS---------APSPPPPPPPPPPPRPPPPGGGGG----PPAP 48 AP P PPPP SS PPPPPPPPP P PPPP G PP P Sbjct: 824 APPPPPPPPPPYASSSSLSMHMGSATKQQPPPPPPPPPLPPPPPPPASSGLSSIPPPP 881 [242][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PP P AA+ P PPPPPPPPPPP PPPP PP P Sbjct: 339 PHPRPPQPPAAQAPPPPPPPPPPPPPPPPPPPPPP-----PPPP 377 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/49 (53%), Positives = 28/49 (57%) Frame = -3 Query: 200 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 54 Q ++AP P PPPP P PPPPPPPPPPP PPPP PP Sbjct: 345 QPPAAQAPPPPPPPP---------PPPPPPPPPPPPPPPPPPPASTKPP 384 [243][TOP] >UniRef100_C5YP25 Putative uncharacterized protein Sb08g016300 n=1 Tax=Sorghum bicolor RepID=C5YP25_SORBI Length = 231 Score = 61.6 bits (148), Expect = 3e-08 Identities = 42/127 (33%), Positives = 56/127 (44%) Frame = +1 Query: 19 LSSSTPPMSRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRS 198 L SS PP S P PPP R G G A G GAG G + Sbjct: 36 LISSKPPPS----APLPPPVPPARPSPVGSAFGS---LSRKTGALGAGAGAGAGVV---G 85 Query: 199 WTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFSFAAFVLVLQGP 378 W YL LD P+ TK++TA + + D +QML+ P + D R A++ ++ GP Sbjct: 86 W--YLGVLDARPVLTKSVTAAAIFTVADLSSQMLSLGPEDSFDYLRTMRMASYGFLISGP 143 Query: 379 VGHAWYN 399 H W+N Sbjct: 144 TLHLWFN 150 [244][TOP] >UniRef100_UPI00017603E5 PREDICTED: diaphanous 2 n=1 Tax=Danio rerio RepID=UPI00017603E5 Length = 885 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP A S P PPPPPP PP PPPP GGG PP P Sbjct: 559 APPPPPPPPFPA---SLGPPPPPPPPGCGPPPPPPPPGGGPPPPP 600 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 4/52 (7%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAPRDIGG 33 +P PPPP AP PPPPPP P PPP PPPPG G PP P GG Sbjct: 544 APPPPPPPPPPPIGGAPPPPPPPPFPASLGPPPPPPPPGCGPPPPPPPPGGG 595 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/67 (44%), Positives = 30/67 (44%), Gaps = 18/67 (26%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP------------------PPRPPPPGGGGGPP 54 P P PPPP AP PPPPPPPPP PP PPPP G G PP Sbjct: 533 PPPPPPPPGGI-----APPPPPPPPPPPIGGAPPPPPPPPFPASLGPPPPPPPPGCGPPP 587 Query: 53 APRDIGG 33 P GG Sbjct: 588 PPPPPGG 594 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/52 (46%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Frame = -3 Query: 191 RSRAPSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 48 ++ P PPPP P PPPPPP PPPPP PP P G PP P Sbjct: 527 KAAGAGPPPPPPPPGGIAPPPPPPPPPPPIGGAPPPPPPPPFPASLGPPPPP 578 [245][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP PPP PP P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPPP P PP PP P Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPPP PPPP PP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P P PPPP P PPPPPPPPP P PPPP PP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPA 51 P P PPPP P PPPPPPP PPP PPPP PP+ Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPS 288 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -3 Query: 167 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 PPP P PPPPPPPPPPP PPPP PP P Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 P+ PP + P PPPPPPPPPPP PPPP PP P Sbjct: 220 PTAVVVPPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 263 [246][TOP] >UniRef100_UPI0001A2D186 UPI0001A2D186 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D186 Length = 166 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = -3 Query: 182 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 48 AP P PPPP A S P PPPPPP PP PPPP GGG PP P Sbjct: 30 APPPPPPPPFPA---SLGPPPPPPPPGCGPPPPPPPPGGGPPPPP 71 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 4/52 (7%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAPRDIGG 33 +P PPPP AP PPPPPP P PPP PPPPG G PP P GG Sbjct: 15 APPPPPPPPPPPIGGAPPPPPPPPFPASLGPPPPPPPPGCGPPPPPPPPGGG 66 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/67 (44%), Positives = 30/67 (44%), Gaps = 18/67 (26%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPP------------------PPRPPPPGGGGGPP 54 P P PPPP AP PPPPPPPPP PP PPPP G G PP Sbjct: 4 PPPPPPPPGGI-----APPPPPPPPPPPIGGAPPPPPPPPFPASLGPPPPPPPPGCGPPP 58 Query: 53 APRDIGG 33 P GG Sbjct: 59 PPPPPGG 65 [247][TOP] >UniRef100_UPI00016E98C3 UPI00016E98C3 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E98C3 Length = 523 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 18/65 (27%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPPP-----PPPP----------PPRPPP---PGGGG 63 SRAP APPPP + SAP PPPPP PPPP PP PPP P GGG Sbjct: 330 SRAPISAPPPPPPSRPGISAPPPPPPPSRGSLPPPPLPGHASIPFTPPPPPPPSIPSGGG 389 Query: 62 GPPAP 48 PP P Sbjct: 390 APPPP 394 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/50 (54%), Positives = 29/50 (58%), Gaps = 9/50 (18%) Frame = -3 Query: 176 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPP---------GGGGGPP 54 +P PPPP + AP PPPPPPPPPPP PPPP GG GPP Sbjct: 375 TPPPPPPPSIPSGGGAP-PPPPPPPPPPPGPPPPAPPPTSDANGGDAGPP 423 [248][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -3 Query: 179 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDI 39 P P PPPP AP+P PPPPPPPPP PPPP P AP + Sbjct: 786 PPPPPPPPLPPAPPQPAPAPTPPPPPPPPPPPPPPPPPPPPSAPPQV 832 [249][TOP] >UniRef100_Q7ZYY2 Wiskott-Aldrich syndrome, like n=1 Tax=Danio rerio RepID=Q7ZYY2_DANRE Length = 518 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/56 (51%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAPRDIGG 33 SRAP+ APPPP + AP PPPP P PPP PPP PPAP IGG Sbjct: 329 SRAPTSAPPPPPPSRPGMGAPPPPPPPSRGPTQAPPPPPPPHSASISPPAPPSIGG 384 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/58 (46%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAPRDIGGVD 27 SR P+ APPPP S +P PP PPPPPPP PPP GPP +D+ D Sbjct: 356 SRGPTQAPPPPPPPHSASISPPAPPSIGGAPPPPPPPPPPPGPPPPGPPPAQDVDSGD 413 [250][TOP] >UniRef100_Q6NYX7 Wiskott-Aldrich syndrome, like n=1 Tax=Danio rerio RepID=Q6NYX7_DANRE Length = 518 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/56 (51%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAPRDIGG 33 SRAP+ APPPP + AP PPPP P PPP PPP PPAP IGG Sbjct: 329 SRAPTSAPPPPPPSRPGMGAPPPPPPPSRGPTQAPPPPPPPHSASISPPAPPSIGG 384 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/58 (46%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -3 Query: 188 SRAPSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAPRDIGGVD 27 SR P+ APPPP S +P PP PPPPPPP PPP GPP +D+ D Sbjct: 356 SRGPTQAPPPPPPPHSASISPPAPPSIGGAPPPPPPPPPPPGPPPPGPPPAQDVDSGD 413