[UP]
[1][TOP] >UniRef100_Q55RM6 Putative uncharacterized protein n=1 Tax=Filobasidiella neoformans RepID=Q55RM6_CRYNE Length = 458 Score = 73.2 bits (178), Expect = 9e-12 Identities = 37/75 (49%), Positives = 42/75 (56%), Gaps = 12/75 (16%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPP------------ 314 P R P P++ R PP P SR+ AR VA S +VPPPPPPPPPP Sbjct: 241 PSRPPAPPTSRRKPAPPPPASRS-ARPSSVAQPSAPSVPPPPPPPPPPGRPAAPPSAPSA 299 Query: 313 PPPPPPTPPPATTDG 269 PPPPPP PPP +DG Sbjct: 300 PPPPPPPPPPVRSDG 314 Score = 56.6 bits (135), Expect = 8e-07 Identities = 40/127 (31%), Positives = 50/127 (39%), Gaps = 14/127 (11%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPP----PPPPTP 290 PP RP P + PP P R D G+G PPPPPPPP PP PPPP P Sbjct: 286 PPGRPAAPPSAPSAPPPPPPPPPPVRSD----GTGVAPPPPPPPPPARPPGGAPPPPPPP 341 Query: 289 PPATTDGAP-----GGG*DSNARVRRKLARSWE-----AETTAATPPASVSNVSAGTMGR 140 P + P GG A ++ + S + + +A + GT Sbjct: 342 PTSAPSAPPLPTASGGRSALLASIQGRGVHSLKKVDPSEQKVSALAGGDTAGTGTGTGAA 401 Query: 139 GVAEGAG 119 V GAG Sbjct: 402 AVGAGAG 408 [2][TOP] >UniRef100_Q5KG31 Putative uncharacterized protein n=1 Tax=Filobasidiella neoformans RepID=Q5KG31_CRYNE Length = 464 Score = 71.6 bits (174), Expect = 2e-11 Identities = 37/79 (46%), Positives = 42/79 (53%), Gaps = 16/79 (20%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPP------------ 314 P R P P++ R PP P SR+ AR VA S +VPPPPPPPPPP Sbjct: 241 PSRPPAPPTSRRKPAPPPPASRS-ARPSSVAQPSAPSVPPPPPPPPPPGRPAAPPSAPPS 299 Query: 313 ----PPPPPPTPPPATTDG 269 PPPPPP PPP +DG Sbjct: 300 APSAPPPPPPPPPPVRSDG 318 Score = 61.2 bits (147), Expect = 3e-08 Identities = 42/141 (29%), Positives = 51/141 (36%), Gaps = 8/141 (5%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPP---PPPPTPP 287 PP RP P + P P ++G+G PPPPPPPP PP PPPP PP Sbjct: 286 PPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPPPP 345 Query: 286 PATTDGAP-----GGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEGA 122 P + AP GG R L S + + S + G G Sbjct: 346 PTSAPSAPPLPTASGG-------RSALLASIQGRGVHSLKKVDPSEQKVSALAGGDTAGT 398 Query: 121 GRGNRDGRRPHGMSMGRMGKG 59 G G G G G + G Sbjct: 399 GTGTGTGAAAVGAGAGAVAGG 419 [3][TOP] >UniRef100_A2A655 Bromodomain PHD finger transcription factor n=1 Tax=Mus musculus RepID=A2A655_MOUSE Length = 2973 Score = 68.2 bits (165), Expect = 3e-10 Identities = 48/145 (33%), Positives = 56/145 (38%), Gaps = 10/145 (6%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP++P P+A R PPPPPPPPPPPPPPPP PPPA+ Sbjct: 8 PPKQPAAPAAERCA----------------------PAPPPPPPPPPPPPPPPPPPPPAS 45 Query: 277 TDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGR----------GVAE 128 P GG +R R W A P +S+ G + A Sbjct: 46 ---GPIGG--LRSRHRGSSRGRWAAAQAEVAPKTRLSSPRGGGRRKQPPPPPPASGSSAS 100 Query: 127 GAGRGNRDGRRPHGMSMGRMGKGAG 53 G GRG R G GR G G G Sbjct: 101 GPGRGGRGG------GGGRTGGGGG 119 [4][TOP] >UniRef100_A2A654 Bromodomain PHD finger transcription factor n=1 Tax=Mus musculus RepID=A2A654_MOUSE Length = 3036 Score = 68.2 bits (165), Expect = 3e-10 Identities = 48/145 (33%), Positives = 56/145 (38%), Gaps = 10/145 (6%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP++P P+A R PPPPPPPPPPPPPPPP PPPA+ Sbjct: 8 PPKQPAAPAAERCA----------------------PAPPPPPPPPPPPPPPPPPPPPAS 45 Query: 277 TDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGR----------GVAE 128 P GG +R R W A P +S+ G + A Sbjct: 46 ---GPIGG--LRSRHRGSSRGRWAAAQAEVAPKTRLSSPRGGGRRKQPPPPPPASGSSAS 100 Query: 127 GAGRGNRDGRRPHGMSMGRMGKGAG 53 G GRG R G GR G G G Sbjct: 101 GPGRGGRGG------GGGRTGGGGG 119 [5][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 67.0 bits (162), Expect = 6e-10 Identities = 33/67 (49%), Positives = 34/67 (50%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 S P R P LLPP +EV NG PPPPPPPPPPPPPPPP PPP Sbjct: 958 SLPPEDRSPLPSPGLLPPA---------EEVPNGLSPPPPPPPPPPPPPPPPPPPPPPPP 1008 Query: 280 TTDGAPG 260 PG Sbjct: 1009 PPPPPPG 1015 [6][TOP] >UniRef100_UPI0000F2CF3F PREDICTED: similar to formin-like 2 n=1 Tax=Monodelphis domestica RepID=UPI0000F2CF3F Length = 1104 Score = 66.6 bits (161), Expect = 8e-10 Identities = 33/62 (53%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = -1 Query: 445 PRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT-TDG 269 P PS+V PP P + A + V NG + PPPPPPPPPPPPPPP P PAT T Sbjct: 536 PGTPSSVPSPPPPPPLPPSTAASETVQNGPVTSPVPPPPPPPPPPPPPPPLPGPATDTPP 595 Query: 268 AP 263 AP Sbjct: 596 AP 597 [7][TOP] >UniRef100_B8NKG8 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus flavus NRRL3357 RepID=B8NKG8_ASPFN Length = 692 Score = 66.6 bits (161), Expect = 8e-10 Identities = 48/140 (34%), Positives = 58/140 (41%), Gaps = 25/140 (17%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPP------PPPPPPPP-- 302 PP P S PP P S ++ R PPPPPP PPPPPPPP Sbjct: 527 PPPPPLPSSRGPPAPPPPPPSSSIPRPPPPPGRGPSAPPPPPPPAPAGGAPPPPPPPPGA 586 Query: 301 --PPTPPPATTDGAP-----GGG*DSNARVR----------RKLARSWEAETTAATPPAS 173 PP PPP P GG D A +R RK+ S + + +AA P S Sbjct: 587 GAPPPPPPPGGAAPPLPTPSGGRDDLLAAIRASGGKGGGGLRKVKESDKKDRSAAMVPGS 646 Query: 172 VSNVSAGTMGRGVAEGAGRG 113 + SA + G G A+G G Sbjct: 647 ANETSAASAGGGAAQGGMAG 666 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/68 (45%), Positives = 38/68 (55%), Gaps = 3/68 (4%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPP---PPPPPTPP 287 PP P P+A R PP P S A+ ++ +VPPPPPPPPPP PPPPP PP Sbjct: 477 PPPPPPVPAASRPT-PPPPASSAVPPPPPPSS----SVPPPPPPPPPPTSSVPPPPPPPP 531 Query: 286 PATTDGAP 263 ++ G P Sbjct: 532 LPSSRGPP 539 [8][TOP] >UniRef100_A6YED4 HOXA13 (Fragment) n=1 Tax=Tachyglossus aculeatus RepID=A6YED4_9MAMM Length = 226 Score = 66.2 bits (160), Expect = 1e-09 Identities = 38/76 (50%), Positives = 45/76 (59%), Gaps = 4/76 (5%) Frame = +3 Query: 177 AGG---VAAVVSASQERANFRRTRALLSHPPPGAPSVVAGGGVGGGGGGGGGGGG-GGGG 344 AGG VAA +A+ A + R L+ HP P AP GGG GGGGGGGGGGG G G Sbjct: 44 AGGNFSVAAAAAAAAAAAAANQCRNLMGHPAPLAPGGGGGGGGGGGGGGGGGGGAYNGPG 103 Query: 345 TVSPLPLATSSSRASA 392 PLP A +SS +S+ Sbjct: 104 EAPPLPAAAASSSSSS 119 [9][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVRRK 224 PPPPPPPPPPPPPPPP PPP T + GG + R RR+ Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPTQEDLAGGNAPQHLRTRRR 49 [10][TOP] >UniRef100_Q00ZZ2 Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins (ISS) n=1 Tax=Ostreococcus tauri RepID=Q00ZZ2_OSTTA Length = 685 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/62 (48%), Positives = 35/62 (56%) Frame = -1 Query: 454 PRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATT 275 P PR S+ + +PP + A A + PPPPPPPPPPPPPPPP PPP TT Sbjct: 496 PVPPRPGSSAPMAMPPVTLASARAAS------TTPPPPPPPPPPPPPPPPPPPPPPPTTT 549 Query: 274 DG 269 G Sbjct: 550 GG 551 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/53 (49%), Positives = 27/53 (50%) Frame = -1 Query: 442 RQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 RQ A +PP P S A V S PPPPPPPPPPPPP PPP Sbjct: 488 RQALAEGRPVPPRPGSSAPMAMPPVTLASARAASTTPPPPPPPPPPPPPPPPP 540 [11][TOP] >UniRef100_A9VAA9 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VAA9_MONBE Length = 1509 Score = 65.1 bits (157), Expect = 2e-09 Identities = 48/140 (34%), Positives = 65/140 (46%), Gaps = 18/140 (12%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP-----------PPPP 311 PP P P+A+ PP + +L + GSG +PPPPPPP PPPP Sbjct: 1070 PPPAPAPPAALTAGAPPAAPTTSLPPPPNLG-GSG--IPPPPPPPGLGAAPAAAAVPPPP 1126 Query: 310 PPPPPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATP-PASVSNVSAGTMGRGV 134 PP P PPPA + G GGG + A +L +S T + P PA + + G MG G+ Sbjct: 1127 PPSAPAPPPAPSLG--GGGGLAAALANAQLRKSTTPATNISPPAPAPAAASNGGGMG-GL 1183 Query: 133 AEGAGRG------NRDGRRP 92 + +G + DG P Sbjct: 1184 LDAINKGVQLRRVSTDGSNP 1203 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/70 (44%), Positives = 36/70 (51%), Gaps = 4/70 (5%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP----PPPPPPPPT 293 SPP P+ PS + PP P A +A + + PPPPPPPP P PPP P Sbjct: 1018 SPPVSPQTPSPSPAMAPPAPPMAPPA--PPMAPQAATSAPPPPPPPPMSLGAPCPPPAPA 1075 Query: 292 PPPATTDGAP 263 PP A T GAP Sbjct: 1076 PPAALTAGAP 1085 [12][TOP] >UniRef100_B6Q311 Actin associated protein Wsp1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q311_PENMQ Length = 627 Score = 64.7 bits (156), Expect = 3e-09 Identities = 35/72 (48%), Positives = 40/72 (55%), Gaps = 5/72 (6%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPP-----PPPP 299 ++PP+ P PS RL+ PP P A SG PPPPPPPPPPP PPPP Sbjct: 448 IAPPQLP--PSNTRLVPPPPP-----------APSSG--APPPPPPPPPPPPSSGIPPPP 492 Query: 298 PTPPPATTDGAP 263 P PPP + GAP Sbjct: 493 PPPPPPPSSGAP 504 Score = 54.7 bits (130), Expect = 3e-06 Identities = 41/130 (31%), Positives = 52/130 (40%), Gaps = 19/130 (14%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPP-----PPPPPPPT 293 PP P P + + PP P SG PPPPPPPPP PPPPPPP Sbjct: 476 PPPPPPPPPSSGIPPPPPP--------PPPPPSSGAPPPPPPPPPPPASSGAPPPPPPPP 527 Query: 292 P----PPATTDGAPGGG*DSNARVR----------RKLARSWEAETTAATPPASVSNVSA 155 P PP GG D A +R RK+ + + + ++A P + +A Sbjct: 528 PGGAAPPPLPSVGGGGRDDLLAAIRASGGRGGGGLRKVNDTEKRDRSSAMVPGGSNEAAA 587 Query: 154 GTMGRGVAEG 125 T A G Sbjct: 588 STPSAAPAGG 597 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/72 (41%), Positives = 37/72 (51%), Gaps = 7/72 (9%) Frame = -1 Query: 457 PPRR-----PRQPSAVR-LLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPP-PPPPPP 299 PPR P+ P AV +PP P +RA ++ + VPPPPP P PPPPP Sbjct: 418 PPREVPQLPPKIPHAVAPASIPPPPPARAPIAPPQLPPSNTRLVPPPPPAPSSGAPPPPP 477 Query: 298 PTPPPATTDGAP 263 P PPP + G P Sbjct: 478 PPPPPPPSSGIP 489 [13][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 64.3 bits (155), Expect = 4e-09 Identities = 40/104 (38%), Positives = 48/104 (46%), Gaps = 1/104 (0%) Frame = -1 Query: 445 PRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGA 266 P PS L +R R V + S PPPPPPPPPPPPPPPP PPP + Sbjct: 2315 PHLPSGSPSLSSLPTKTRPFFRSSSV-DASAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2373 Query: 265 PGGG*DSNARVRRKLARSWEAETTAATPPAS-VSNVSAGTMGRG 137 P +V +A + T ATPPA V+ A + RG Sbjct: 2374 PKPAVHPKKKV---IATAPVTLTPTATPPADVVTAAEAAAIPRG 2414 [14][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVRRKLARSWEAE 200 PPPPPPPPPPPPPPPP PPP AP G S R RR+L+ + E Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPSAVRPRRRLSTAIRGE 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPP 20 [15][TOP] >UniRef100_Q5RB50 Putative uncharacterized protein DKFZp459N037 n=1 Tax=Pongo abelii RepID=Q5RB50_PONAB Length = 494 Score = 63.9 bits (154), Expect = 5e-09 Identities = 31/68 (45%), Positives = 35/68 (51%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P +PS +PP P +R S + PPPPPPPPPPPPPPP PPP Sbjct: 323 PPPPPSRPSVA---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPPPPPPPPPPGPPPP-- 377 Query: 277 TDGAPGGG 254 G P G Sbjct: 378 -PGLPSDG 384 [16][TOP] >UniRef100_Q2U6Q3 Actin regulatory protein n=1 Tax=Aspergillus oryzae RepID=Q2U6Q3_ASPOR Length = 665 Score = 63.9 bits (154), Expect = 5e-09 Identities = 49/154 (31%), Positives = 61/154 (39%), Gaps = 39/154 (25%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP------PPPPPPP-- 302 PP P S+V PP P + ++PPPPPPP PPPPPPP Sbjct: 486 PPPPPPPTSSVPPPPPPPPLPSSRGPPAPPPPPPSSSIPPPPPPPGRGPSAPPPPPPPAP 545 Query: 301 ----PPTPPPATTDGAP-----------------GGG*DSNARVR----------RKLAR 215 PP PPP GAP GG D A +R RK+ Sbjct: 546 AGGAPPPPPPPPGAGAPPPPPPPGGAAPPLPTPSGGRDDLLAAIRASGGKGGGGLRKVKE 605 Query: 214 SWEAETTAATPPASVSNVSAGTMGRGVAEGAGRG 113 S + + +AA P S + SA + G G A+G G Sbjct: 606 SDKKDRSAAMVPGSANETSAASAGGGAAQGGMAG 639 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/77 (40%), Positives = 37/77 (48%), Gaps = 12/77 (15%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSG---------DTVPPPPPPPPPPP-- 311 PP PR P++ PP P A +R S +VPPPPPPPPPP Sbjct: 440 PPPPPRSPASQ----PPPPPVPAASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTSS 495 Query: 310 -PPPPPTPPPATTDGAP 263 PPPPP PP ++ G P Sbjct: 496 VPPPPPPPPLPSSRGPP 512 [17][TOP] >UniRef100_UPI0000603C6F PREDICTED: Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 n=1 Tax=Mus musculus RepID=UPI0000603C6F Length = 1266 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -1 Query: 418 LLPP-TPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 L+PP +P ++ + A+ +PPPPPPPPPPPPPPPP PPP + AP G Sbjct: 606 LMPPLSPQTKIIT--PYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSSG 659 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/68 (41%), Positives = 31/68 (45%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 SP P P + + PP P + A A PPPPPPPPPPPPP PPT P Sbjct: 918 SPDFPPPPPESSLVFPPPPPPAPAPA-------------PPPPPPPPPPPPPVPPTASPT 964 Query: 280 TTDGAPGG 257 G G Sbjct: 965 PDKGGSPG 972 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/74 (39%), Positives = 36/74 (48%), Gaps = 7/74 (9%) Frame = -1 Query: 460 SPPR---RPR-QPSAVRLL---LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPP 302 SPP +P+ QPS++ + PP P +L PPPPPPPPPPPP P Sbjct: 899 SPPAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPPAPAPAPPPPPPPPPPPPPVP 958 Query: 301 PPTPPPATTDGAPG 260 P P G+PG Sbjct: 959 PTASPTPDKGGSPG 972 [18][TOP] >UniRef100_UPI0001A2D80C UPI0001A2D80C related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D80C Length = 815 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/60 (50%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = -1 Query: 457 PPRRPRQPSAVRL--LLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P S+V L PP P NG +PPPPPPPPPPPPPPPP PPP Sbjct: 256 PPPPPMTDSSVSTVSLFPPVP------------NGPSAALPPPPPPPPPPPPPPPPPPPP 303 [19][TOP] >UniRef100_UPI00016E98C2 UPI00016E98C2 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E98C2 Length = 500 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/68 (45%), Positives = 33/68 (48%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 +PP P + PP P SR G PPPPPPPPPPP PPPP PPP Sbjct: 330 APPPPPPSRPGISAPPPPPPPSRPPPPPPPSIPSGGGAPPPPPPPPPPPPGPPPPAPPP- 388 Query: 280 TTDGAPGG 257 T A GG Sbjct: 389 -TSDANGG 395 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/67 (40%), Positives = 32/67 (47%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P +P PP P + +G G PPPPPPPPPP PPPP PP + Sbjct: 332 PPPPPSRPGISAPPPPPPPSRPPPPPPPSIPSGGGAPPPPPPPPPPPPGPPPPAPPPTSD 391 Query: 277 TDGAPGG 257 +G G Sbjct: 392 ANGGDAG 398 Score = 54.3 bits (129), Expect = 4e-06 Identities = 34/79 (43%), Positives = 37/79 (46%), Gaps = 14/79 (17%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRA--LARDDEVANGSGDTVPPPPPPP--PPPPP------ 308 PP P P+ R PP P SRA A + G + PPPPPPP PPPPP Sbjct: 306 PP--PPPPARGRTAPPPPPPSRAPISAPPPPPPSRPGISAPPPPPPPSRPPPPPPPSIPS 363 Query: 307 ----PPPPTPPPATTDGAP 263 PPPP PPP G P Sbjct: 364 GGGAPPPPPPPPPPPPGPP 382 [20][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 6/49 (12%) Frame = -1 Query: 412 PPTPHSRALARDDEVAN------GSGDTVPPPPPPPPPPPPPPPPTPPP 284 PPTP ++ E ++ G T PPPPPPPPPPPPPPPP PPP Sbjct: 470 PPTPPDEESKKNSECSSQDSTRGGPSSTPPPPPPPPPPPPPPPPPPPPP 518 [21][TOP] >UniRef100_UPI00017F09BE PREDICTED: similar to KIAA1902 protein, partial n=1 Tax=Sus scrofa RepID=UPI00017F09BE Length = 734 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 LPP P L+ D A +G PP PPPPPPPPPPPPP PPP Sbjct: 234 LPPPPPPLPLSSDAPEAVQNGPVTPPMPPPPPPPPPPPPPPPPP 277 [22][TOP] >UniRef100_B4W7V0 OmpA family protein n=1 Tax=Brevundimonas sp. BAL3 RepID=B4W7V0_9CAUL Length = 384 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 G+ D PPPPPPPPPPPPPPPP PPPA AP Sbjct: 241 GAEDAPPPPPPPPPPPPPPPPPPPPPAPVAQAP 273 [23][TOP] >UniRef100_B8AC65 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AC65_ORYSI Length = 790 Score = 62.8 bits (151), Expect = 1e-08 Identities = 52/149 (34%), Positives = 64/149 (42%), Gaps = 41/149 (27%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPT--PHSRAL--------ARDDEVANGSG---DTVPPPPPPPP 320 +PP P P+ LLPPT P R+L A E S D PPP PP P Sbjct: 26 TPPPTPPLPTP---LLPPTLAPLQRSLVFGRVEGEAMSSEARESSATAVDRTPPPTPPSP 82 Query: 319 PPPPPPPP-----TPPPATTDGAPGGG*DSNARVRRK-----------------LARSWE 206 PPPPPPPP TPPP++ AP GG +++ R L R Sbjct: 83 PPPPPPPPTNGTLTPPPSS---APSGGRATSSEARESPHATSVDDGGRAPPPPPLPRPTS 139 Query: 205 AETTAATPP------ASVSNVSAGTMGRG 137 A T AT P +S S+ S G++ RG Sbjct: 140 ARATPATTPSADGSSSSSSSTSGGSLPRG 168 [24][TOP] >UniRef100_UPI0001926BAB PREDICTED: similar to mini-collagen n=1 Tax=Hydra magnipapillata RepID=UPI0001926BAB Length = 149 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPPA G PG Sbjct: 55 PPPPPPPPPPPPPPPPPPPPAPLPGNPG 82 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP PG Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPAPLPG 79 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -1 Query: 340 PPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPP PPP AP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPAP 76 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP P G PG Sbjct: 58 PPPPPPPPPPPPPPPPPAPLPGNPGPPG 85 [25][TOP] >UniRef100_UPI0000ECB813 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=2 Tax=Gallus gallus RepID=UPI0000ECB813 Length = 1051 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -1 Query: 418 LLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPP 287 L PP P ALA E TVP PPPPPPPPPPPPPP PP Sbjct: 488 LPPPPPPLPALAAASEAVQNGPVTVPVPPPPPPPPPPPPPPAPP 531 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -1 Query: 433 SAVRLLLPPTPHSRALARDDEVANGSGDT-VPPPPPPPPPPPPPPPPTPPPATTDGAP 263 S+V L PP P A + V NG VPPPPPPPPPPPPPP P P D AP Sbjct: 484 SSVPLPPPPPPLPALAAASEAVQNGPVTVPVPPPPPPPPPPPPPPAPPLPGPALDTAP 541 [26][TOP] >UniRef100_UPI0000E2427E PREDICTED: guanine nucleotide binding protein, alpha activating polypeptide O n=1 Tax=Pan troglodytes RepID=UPI0000E2427E Length = 537 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/71 (42%), Positives = 35/71 (49%), Gaps = 4/71 (5%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPP----PPPPPPPPPPPPPP 296 + P P PSA P H R + D +++PP PPPPPPPPPPPPPP Sbjct: 78 LGPAPCPTLPSARGSAKAPRTHRRLKSGDAHALAAPPNSLPPHPAPPPPPPPPPPPPPPP 137 Query: 295 TPPPATTDGAP 263 PPPA P Sbjct: 138 PPPPAAAAAGP 148 [27][TOP] >UniRef100_Q4RY48 Chromosome 3 SCAF14978, whole genome shotgun sequence n=1 Tax=Tetraodon nigroviridis RepID=Q4RY48_TETNG Length = 1449 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/68 (42%), Positives = 36/68 (52%), Gaps = 7/68 (10%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPP-------PPPPPPPPPPPPP 299 P + P P L PP PH L + ++ + + +PP PPPPPPPPPPPPP Sbjct: 715 PEQYPLPPQPEPLHAPPAPH---LLQQQQLTSSGSNHIPPQQQQTSPPPPPPPPPPPPPP 771 Query: 298 PTPPPATT 275 P PP A T Sbjct: 772 PPPPSAQT 779 Score = 56.6 bits (135), Expect = 8e-07 Identities = 36/104 (34%), Positives = 45/104 (43%) Frame = -1 Query: 454 PRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATT 275 P P SA + PP P A +G T PPPPPPPPPPPPP P T P Sbjct: 1066 PPPPADTSAAFIAAPPPPPPPAPV--------TGPTPPPPPPPPPPPPPPAPVTGPTPPA 1117 Query: 274 DGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMG 143 P G S + + + + TP + S+V AG+ G Sbjct: 1118 PPLPPGSLGSPTKKPPSSSLNAGGKRPPPTPQRN-SSVKAGSSG 1160 Score = 53.1 bits (126), Expect = 9e-06 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRAL----------------ARDDEVANGSGDTVPPP--- 335 PP P P A P P S+A+ RD NG + PPP Sbjct: 895 PPPPPPPPPA------PVPMSQAVHCSGLKQALKERFPSPPRDLLCLNGGLEESPPPAPT 948 Query: 334 --PPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPP PPP Sbjct: 949 PSPPPPPPPPPPPPPPPPP 967 [28][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/65 (44%), Positives = 30/65 (46%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P P PPTP + PPPPPPPPPPPPPPPPTPPP Sbjct: 67 PPTPPPTP-------PPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTP 119 Query: 277 TDGAP 263 P Sbjct: 120 PPTPP 124 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/66 (43%), Positives = 29/66 (43%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 SPP P QP PP P PPPPPPPPPPPP PPPTPPP Sbjct: 88 SPPTAPPQPP------PPPP-------------------PPPPPPPPPPPPTPPPTPPPT 122 Query: 280 TTDGAP 263 P Sbjct: 123 PPPTPP 128 [29][TOP] >UniRef100_Q00484 Mini-collagen n=1 Tax=Hydra sp. RepID=Q00484_9CNID Length = 149 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPPA G PG Sbjct: 55 PPPPPPPPPPPPPPPPPPPPAPLPGNPG 82 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP PG Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPAPLPG 79 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP P G PG Sbjct: 58 PPPPPPPPPPPPPPPPPAPLPGNPGPPG 85 [30][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 PPPPPPPPPPPPPPPP PPP PGGG Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPGGG 82 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*D 248 PPPPPPPPPPPPPPPP PPP GGG D Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVD 85 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 PPPPPPPPPPPPPPPP PPP P GG Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPGG 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPP 20 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPP 21 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPP 22 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPP 23 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPP 24 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPP 25 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPP 26 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPP 27 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPP 28 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPP 29 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPP 30 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPP 64 [31][TOP] >UniRef100_B2KTD4 Minicollagen 1 n=1 Tax=Clytia hemisphaerica RepID=B2KTD4_9CNID Length = 149 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPPA G PG Sbjct: 56 PPPPPPPPPPPPPPPPPPPPAPIPGNPG 83 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP PG Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPAPIPG 80 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -1 Query: 340 PPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPP PPP AP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPAP 77 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP P G PG Sbjct: 59 PPPPPPPPPPPPPPPPPAPIPGNPGPPG 86 [32][TOP] >UniRef100_A9V6E2 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V6E2_MONBE Length = 2389 Score = 62.4 bits (150), Expect = 2e-08 Identities = 40/112 (35%), Positives = 50/112 (44%), Gaps = 5/112 (4%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPP-----PPPPP 299 V PP P P PP P G + PPPPPPPPPP PPPPP Sbjct: 1215 VPPPPPPPPPGGASGPPPPPPPPPP----------GGASGPPPPPPPPPPGGASGPPPPP 1264 Query: 298 PTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMG 143 P PPP + GA G D+ +R+++ RS +T S+S + G G Sbjct: 1265 PPPPPGASSGANSAGMDA---LRKQIERS------RSTRSGSLSQLKQGAGG 1307 [33][TOP] >UniRef100_UPI0000E1F8E7 PREDICTED: Ras association and pleckstrin homology domains 1 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E1F8E7 Length = 1252 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -1 Query: 346 VPPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 +PPPPPPPPPPPPPPPP PPP + AP G Sbjct: 630 LPPPPPPPPPPPPPPPPPPPPLPSQSAPSAG 660 [34][TOP] >UniRef100_UPI0000E1F8E6 PREDICTED: Ras association and pleckstrin homology domains 1 isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E1F8E6 Length = 1304 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -1 Query: 346 VPPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 +PPPPPPPPPPPPPPPP PPP + AP G Sbjct: 682 LPPPPPPPPPPPPPPPPPPPPLPSQSAPSAG 712 [35][TOP] >UniRef100_UPI00016E586F UPI00016E586F related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E586F Length = 387 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/69 (46%), Positives = 34/69 (49%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 SPP P P L LP P +VA +G PPPPP PPPP PPP PPP Sbjct: 162 SPPPLPPLPPRPLLTLPSPP---------QVAPMAGPPAPPPPPGPPPPMAVPPPMPPPL 212 Query: 280 TTDGAPGGG 254 T G P GG Sbjct: 213 PTGGGPPGG 221 [36][TOP] >UniRef100_Q7ZYY2 Wiskott-Aldrich syndrome, like n=1 Tax=Danio rerio RepID=Q7ZYY2_DANRE Length = 518 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 3/70 (4%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA- 281 PP P + PP PHS +++ + G PPPPPPPPPPP PPPP PPPA Sbjct: 351 PPPPPSRGPTQAPPPPPPPHSASISPPAPPSIGGA---PPPPPPPPPPPGPPPPGPPPAQ 407 Query: 280 --TTDGAPGG 257 + +PGG Sbjct: 408 DVDSGDSPGG 417 [37][TOP] >UniRef100_Q6NYX7 Wiskott-Aldrich syndrome, like n=1 Tax=Danio rerio RepID=Q6NYX7_DANRE Length = 518 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 3/70 (4%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA- 281 PP P + PP PHS +++ + G PPPPPPPPPPP PPPP PPPA Sbjct: 351 PPPPPSRGPTQAPPPPPPPHSASISPPAPPSIGGA---PPPPPPPPPPPGPPPPGPPPAQ 407 Query: 280 --TTDGAPGG 257 + +PGG Sbjct: 408 DVDSGDSPGG 417 [38][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/88 (40%), Positives = 41/88 (46%), Gaps = 3/88 (3%) Frame = -1 Query: 388 LARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNA--RVRRKLAR 215 L DD G PPPPPPPPPPPPPPPP PPP P D A R +A Sbjct: 639 LVVDDVAVRSVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPDVLAADAFDRTVAA 698 Query: 214 SW-EAETTAATPPASVSNVSAGTMGRGV 134 W A T A A ++ A + G G+ Sbjct: 699 GWGSAPTGGAWTHAGSASRYAASAGAGI 726 [39][TOP] >UniRef100_Q2R2Z8 Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2R2Z8_ORYSJ Length = 489 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/65 (44%), Positives = 33/65 (50%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 P R P P R + PP P + A A D G+ PPP PPPPPPPPPPP P P+ Sbjct: 49 PSRPPLHPVGDRAIHPPMPPASAAAGD-----GAAPDQEPPPSPPPPPPPPPPPRPAPSL 103 Query: 277 TDGAP 263 P Sbjct: 104 ASALP 108 [40][TOP] >UniRef100_C9K0J5 Putative uncharacterized protein RAPH1 n=1 Tax=Homo sapiens RepID=C9K0J5_HUMAN Length = 1302 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -1 Query: 346 VPPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 +PPPPPPPPPPPPPPPP PPP + AP G Sbjct: 680 LPPPPPPPPPPPPPPPPPPPPLPSQSAPSAG 710 [41][TOP] >UniRef100_A8TMB7 Antisense fragile X mental retardation protein variant A n=1 Tax=Homo sapiens RepID=A8TMB7_HUMAN Length = 100 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVRRKLARSWEA 203 PPPPPPPPPPPPPPPP PP T G + AR RR+ A EA Sbjct: 49 PPPPPPPPPPPPPPPPPPPRCRTPPGSGASVTAAARARRRPAARSEA 95 [42][TOP] >UniRef100_Q70E73 Ras-associated and pleckstrin homology domains-containing protein 1 n=1 Tax=Homo sapiens RepID=RAPH1_HUMAN Length = 1250 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -1 Query: 346 VPPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 +PPPPPPPPPPPPPPPP PPP + AP G Sbjct: 628 LPPPPPPPPPPPPPPPPPPPPLPSQSAPSAG 658 [43][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/88 (36%), Positives = 41/88 (46%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P PS PP P + + PPPPPPPPPPPPPPPP PPP Sbjct: 143 PPSPPPPPS------PPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Query: 277 TDGAPGGG*DSNARVRRKLARSWEAETT 194 P ++ ++ K R ++A+ T Sbjct: 197 PPPPPPVDRNARLKIALKAIRIFQAKIT 224 [44][TOP] >UniRef100_UPI000194E282 PREDICTED: similar to Wiskott-Aldrich syndrome-like (human) n=1 Tax=Taeniopygia guttata RepID=UPI000194E282 Length = 504 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/72 (43%), Positives = 36/72 (50%), Gaps = 7/72 (9%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP-------PPPPPPP 299 PP P +P A +PP P +R V + S + PPPPPPPP PPPPPPP Sbjct: 323 PPPPPSRPGAA---VPPPPPNRMYPPPPPVHSSSAPSGPPPPPPPPATASSVPPPPPPPP 379 Query: 298 PTPPPATTDGAP 263 P P P G P Sbjct: 380 PPPGPPPPPGLP 391 [45][TOP] >UniRef100_UPI0000E7FF28 PREDICTED: similar to zinc-finger homeodomain protein 4 isoform 2 n=1 Tax=Gallus gallus RepID=UPI0000E7FF28 Length = 3618 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/66 (42%), Positives = 34/66 (51%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 +PP P P PPTP + A ++ N + + PPP PPPPPPPPPP PPP Sbjct: 1987 TPPPPPPPPPPPPPPPPPTPSQPSSAGAGKIQNTTPTPLQAPPPTPPPPPPPPPPPPPPP 2046 Query: 280 TTDGAP 263 AP Sbjct: 2047 PPPSAP 2052 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -1 Query: 370 VANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGA 266 ++ S +T PPPPPPPPPPPPPPPPTP ++ GA Sbjct: 1980 ISPSSPETPPPPPPPPPPPPPPPPPTPSQPSSAGA 2014 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPPATT 275 T PPPPPPPPPPPPPPPP PPP ++ Sbjct: 3151 TPPPPPPPPPPPPPPPPPPPPPPSS 3175 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP + G Sbjct: 3152 PPPPPPPPPPPPPPPPPPPPPPSSSLSG 3179 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -1 Query: 340 PPPPPPPPPPPPPPPTPPPATTDGAPGG 257 PPPPPPPPPPPPPPP PPP + G Sbjct: 3152 PPPPPPPPPPPPPPPPPPPPPPSSSLSG 3179 [46][TOP] >UniRef100_UPI0000E7F7FF PREDICTED: similar to N-WASP n=1 Tax=Gallus gallus RepID=UPI0000E7F7FF Length = 505 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/72 (43%), Positives = 36/72 (50%), Gaps = 7/72 (9%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP-------PPPPPPPP 299 PP P +P A +PP P +R V + S + PPPPPPP PPPPPPPP Sbjct: 324 PPPPPSRPGAA---VPPPPPNRMYPPPPPVHSSSAPSGPPPPPPPPASGSSAPPPPPPPP 380 Query: 298 PTPPPATTDGAP 263 P P P G P Sbjct: 381 PPPGPPPPPGLP 392 [47][TOP] >UniRef100_B9Q7D9 Zinc finger (C3HC4 RING finger) protein n=1 Tax=Toxoplasma gondii VEG RepID=B9Q7D9_TOXGO Length = 1058 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 10/61 (16%) Frame = -1 Query: 409 PTPHSRALARDDE----VANGSGDTVPPPPPPPPPPPPPPPPTPPPATT------DGAPG 260 PTP S A G+G T PPPPPPPPPPPPPPPP P PA T GA G Sbjct: 264 PTPTSSAQPAGPSGSTGAVGGTGATPPPPPPPPPPPPPPPPPPPLPAGTVSTSRAGGAVG 323 Query: 259 G 257 G Sbjct: 324 G 324 [48][TOP] >UniRef100_B9PM01 Zinc finger (C3HC4 RING finger) protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9PM01_TOXGO Length = 2406 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 10/61 (16%) Frame = -1 Query: 409 PTPHSRALARDDE----VANGSGDTVPPPPPPPPPPPPPPPPTPPPATT------DGAPG 260 PTP S A G+G T PPPPPPPPPPPPPPPP P PA T GA G Sbjct: 1612 PTPTSSAQPAGPSGSTGAVGGTGATPPPPPPPPPPPPPPPPPPPLPAGTVSTSRAGGAVG 1671 Query: 259 G 257 G Sbjct: 1672 G 1672 [49][TOP] >UniRef100_B6KE02 Zinc finger (C3HC4 RING finger) protein, putative n=1 Tax=Toxoplasma gondii ME49 RepID=B6KE02_TOXGO Length = 2401 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 10/61 (16%) Frame = -1 Query: 409 PTPHSRALARDDE----VANGSGDTVPPPPPPPPPPPPPPPPTPPPATT------DGAPG 260 PTP S A G+G T PPPPPPPPPPPPPPPP P PA T GA G Sbjct: 1607 PTPTSSAQPAGPSGSTGAVGGTGATPPPPPPPPPPPPPPPPPPPLPAGTVSTSRAGGAVG 1666 Query: 259 G 257 G Sbjct: 1667 G 1667 [50][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/72 (44%), Positives = 34/72 (47%), Gaps = 7/72 (9%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPP-------PPPPP 299 PP P P A+ + PP P G G VPPPPPPPPPP PPPPP Sbjct: 1033 PPPPPPPPGAIGVPPPPPPPP-----PPPPPGGKGMGVPPPPPPPPPPPGFGGGMPPPPP 1087 Query: 298 PTPPPATTDGAP 263 P PPP G P Sbjct: 1088 PPPPPGFGGGMP 1099 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 + P PPPPPPPPPPPPPP PPP G P Sbjct: 1018 SAPAPPPPPPPPPPPPPPPPPPPGAIGVP 1046 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/79 (39%), Positives = 34/79 (43%), Gaps = 12/79 (15%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPP------PPPPPP 296 PP P P + +PP P G G +PPPPPPPPPP PPPPPP Sbjct: 1051 PPPPPPPPGGKGMGVPPPPPP------PPPPPGFGGGMPPPPPPPPPPGFGGGMPPPPPP 1104 Query: 295 ------TPPPATTDGAPGG 257 PPP G GG Sbjct: 1105 PPGRFGAPPPPPPPGGAGG 1123 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/74 (41%), Positives = 31/74 (41%), Gaps = 7/74 (9%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPP-------PPPP 305 VS P P P PP P A G PPPPPPPPP PPPP Sbjct: 1017 VSAPAPPPPP-------PPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPP 1069 Query: 304 PPPTPPPATTDGAP 263 PPP PPP G P Sbjct: 1070 PPPPPPPGFGGGMP 1083 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/35 (62%), Positives = 22/35 (62%), Gaps = 5/35 (14%) Frame = -1 Query: 343 PPPPPPPPPPP-----PPPPPTPPPATTDGAPGGG 254 PPPPPPPPPPP PPPPP PPP G G G Sbjct: 1030 PPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMG 1064 [51][TOP] >UniRef100_O73590 Zinc finger homeobox protein 4 n=1 Tax=Gallus gallus RepID=ZFHX4_CHICK Length = 3573 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/66 (42%), Positives = 34/66 (51%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 +PP P P PPTP + A ++ N + + PPP PPPPPPPPPP PPP Sbjct: 1942 TPPPPPPPPPPPPPPPPPTPSQPSSAGAGKIQNTTPTPLQAPPPTPPPPPPPPPPPPPPP 2001 Query: 280 TTDGAP 263 AP Sbjct: 2002 PPPSAP 2007 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -1 Query: 370 VANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGA 266 ++ S +T PPPPPPPPPPPPPPPPTP ++ GA Sbjct: 1935 ISPSSPETPPPPPPPPPPPPPPPPPTPSQPSSAGA 1969 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPPATT 275 T PPPPPPPPPPPPPPPP PPP ++ Sbjct: 3106 TPPPPPPPPPPPPPPPPPPPPPPSS 3130 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP + G Sbjct: 3107 PPPPPPPPPPPPPPPPPPPPPPSSSLSG 3134 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -1 Query: 340 PPPPPPPPPPPPPPPTPPPATTDGAPGG 257 PPPPPPPPPPPPPPP PPP + G Sbjct: 3107 PPPPPPPPPPPPPPPPPPPPPPSSSLSG 3134 [52][TOP] >UniRef100_A1AP13 TonB family protein n=1 Tax=Pelobacter propionicus DSM 2379 RepID=A1AP13_PELPD Length = 265 Score = 61.6 bits (148), Expect = 3e-08 Identities = 45/118 (38%), Positives = 55/118 (46%), Gaps = 18/118 (15%) Frame = +3 Query: 54 PAPLPIRPIDMPWGLRPSLLPRPAPSAT--PLPIVPALTLLTLA--GGVAAVVSASQERA 221 P PLP P R + PRP A P P+ P T G AA+V+ + A Sbjct: 52 PGPLPAGPAAPRPAARSNPAPRPRAVAPLPPAPVAPRSAPRTALEQNGPAAIVAPQKREA 111 Query: 222 -----NFRRTRALLSHPPPGAP----SVVAGGGVGGGGGGGGG-----GGGGGGGTVS 353 +TRA++ PPG+P SV GGG GGGG GGGG GGG GGG + Sbjct: 112 VATAQGEGQTRAIVPDGPPGSPGGVGSVPPGGGSGGGGNGGGGSGSETGGGSGGGATA 169 [53][TOP] >UniRef100_A8HTP3 ERD4-related membrane protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HTP3_CHLRE Length = 2041 Score = 61.6 bits (148), Expect = 3e-08 Identities = 37/70 (52%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Frame = +3 Query: 255 PPPG--APSVVAGGGVGGGGGGGGGGGGGGGGTVSPLPLATSSSRASARLCGVGGSSNRT 428 PPP S GGGVGGGGGGGGGGGGGGGG +S P AT S+R G S Sbjct: 1223 PPPRWRGSSTGDGGGVGGGGGGGGGGGGGGGGVLS--PAATGGGEGSSRRGASGEDSGAV 1280 Query: 429 ADGWRGRRGG 458 A RG GG Sbjct: 1281 A--CRGGAGG 1288 [54][TOP] >UniRef100_UPI0001926BC8 PREDICTED: similar to mini-collagen isoform 1 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC8 Length = 146 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP G PG Sbjct: 53 PPPPPPPPPPPPPPPPPPPPVAIPGNPG 80 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP PG Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPVAIPG 77 [55][TOP] >UniRef100_UPI00017974C7 PREDICTED: similar to KIAA1902 protein n=1 Tax=Equus caballus RepID=UPI00017974C7 Length = 1089 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 LPP P + + D A +G PP PPPPPPPPPPPPP PPP Sbjct: 522 LPPPPPALPPSSDTPEAVQNGPATPPMPPPPPPPPPPPPPPPPP 565 [56][TOP] >UniRef100_UPI0000E1F761 PREDICTED: formin-like 2 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E1F761 Length = 1087 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 LPP P + D +G PP PPPPPPPPPPPPP PPP PG Sbjct: 526 LPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPG 577 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPA 281 PPPPPPPPPPPPPPPP P PA Sbjct: 559 PPPPPPPPPPPPPPPPLPGPA 579 [57][TOP] >UniRef100_UPI0000E1F760 PREDICTED: formin-like 2 isoform 8 n=1 Tax=Pan troglodytes RepID=UPI0000E1F760 Length = 1093 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 LPP P + D +G PP PPPPPPPPPPPPP PPP PG Sbjct: 526 LPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPG 577 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPA 281 PPPPPPPPPPPPPPPP P PA Sbjct: 559 PPPPPPPPPPPPPPPPLPGPA 579 [58][TOP] >UniRef100_Q4RE14 Chromosome undetermined SCAF15155, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4RE14_TETNG Length = 334 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/63 (47%), Positives = 36/63 (57%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP PR SA RL PP P +R+ + +PPPPPPPPPPPPPPP PP + Sbjct: 241 PPSVPR--SAGRLAPPPAPPARSPTTE------LSSRIPPPPPPPPPPPPPPPHLPPASL 292 Query: 277 TDG 269 +G Sbjct: 293 RNG 295 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/69 (43%), Positives = 33/69 (47%), Gaps = 12/69 (17%) Frame = -1 Query: 454 PRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPP------------PPPPP 311 PR P P A+R L P P + R V +G PPP PP PPPPP Sbjct: 218 PRCP--PQALRALPPSYPCNAPTRRPPSVPRSAGRLAPPPAPPARSPTTELSSRIPPPPP 275 Query: 310 PPPPPTPPP 284 PPPPP PPP Sbjct: 276 PPPPPPPPP 284 [59][TOP] >UniRef100_Q7TPN5 Wiskott-Aldrich syndrome-like (Human) n=2 Tax=Mus musculus RepID=Q7TPN5_MOUSE Length = 501 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/75 (41%), Positives = 35/75 (46%), Gaps = 7/75 (9%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP-------PPPPPPPP 299 PP P +P V +PP P +R S + PPPPPPP PPPPPPPP Sbjct: 320 PPPPPSRPGVV---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPPSMAGSTAPPPPPPPP 376 Query: 298 PTPPPATTDGAPGGG 254 P P P G P G Sbjct: 377 PPPGPPPPPGLPSDG 391 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/70 (42%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P PS+ PP P +G T PPPPPPPPPPP PPPP P+ Sbjct: 341 PPPPPALPSSAPSGPPPPPPPSM----------AGSTAPPPPPPPPPPPGPPPPPGLPSD 390 Query: 277 TD---GAPGG 257 D AP G Sbjct: 391 GDHQVPAPSG 400 [60][TOP] >UniRef100_Q1GRM3 OmpA/MotB n=1 Tax=Sphingopyxis alaskensis RepID=Q1GRM3_SPHAL Length = 373 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP + APG Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPVVECAPG 260 [61][TOP] >UniRef100_Q00485 Mini-collagen (Fragment) n=1 Tax=Hydra sp. RepID=Q00485_9CNID Length = 142 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP G PG Sbjct: 49 PPPPPPPPPPPPPPPPPPPPVAIPGNPG 76 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP PG Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPVAIPG 73 [62][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/51 (52%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = -1 Query: 397 SRALARDDEVANGSGDTV----PPPPPPPPPPPPPPPPTPPPATTDGAPGG 257 +RA + + N +GD V PPPPPPPPPPPPPPPP PPP P G Sbjct: 78 TRARRKRNRTRNRNGDGVSSLQPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 128 [63][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 376 DEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 DEV+ + VPPPPPPPPPPPPPPPP PPP Sbjct: 1022 DEVSKPAVTAVPPPPPPPPPPPPPPPPPPPP 1052 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP + G P Sbjct: 1040 PPPPPPPPPPPPPPPPPPPPMSAGGIP 1066 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDG 269 PPPPPPPPPPPPPPPP PPP + G Sbjct: 1039 PPPPPPPPPPPPPPPPPPPPPMSAG 1063 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP A G Sbjct: 1037 PPPPPPPPPPPPPPPPPPPPPPPMSAGG 1064 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/71 (42%), Positives = 31/71 (43%), Gaps = 5/71 (7%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPP-----PPPP 299 V PP P P PP P + G PPPPPPPPPPP PPPP Sbjct: 1032 VPPPPPPPPPPPP----PPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPPMSPGMPPPP 1087 Query: 298 PTPPPATTDGA 266 P PP A GA Sbjct: 1088 PPPPGAPVPGA 1098 [64][TOP] >UniRef100_Q91YD9 Neural Wiskott-Aldrich syndrome protein n=3 Tax=Mus musculus RepID=WASL_MOUSE Length = 501 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/75 (41%), Positives = 35/75 (46%), Gaps = 7/75 (9%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP-------PPPPPPPP 299 PP P +P V +PP P +R S + PPPPPPP PPPPPPPP Sbjct: 320 PPPPPSRPGVV---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPPSMAGSTAPPPPPPPP 376 Query: 298 PTPPPATTDGAPGGG 254 P P P G P G Sbjct: 377 PPPGPPPPPGLPSDG 391 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/70 (42%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P PS+ PP P +G T PPPPPPPPPPP PPPP P+ Sbjct: 341 PPPPPALPSSAPSGPPPPPPPSM----------AGSTAPPPPPPPPPPPGPPPPPGLPSD 390 Query: 277 TD---GAPGG 257 D AP G Sbjct: 391 GDHQVPAPSG 400 [65][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/65 (44%), Positives = 31/65 (47%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 P RP QP A + PP P PPPPPPPPPPPPPPPP PPP Sbjct: 339 PHPRPPQPPAAQAPPPPPP-------------------PPPPPPPPPPPPPPPPPPPPPA 379 Query: 277 TDGAP 263 + P Sbjct: 380 STKPP 384 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -1 Query: 409 PTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 P PH R + PPPPPPPPPPPPPPPP PPP Sbjct: 333 PHPHPHPHPRPPQPPAAQAPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/49 (48%), Positives = 24/49 (48%) Frame = -1 Query: 409 PTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 P PH A PPPPPPPPPPPPPPPP PPP P Sbjct: 335 PHPHPHPRPPQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPASTKP 383 [66][TOP] >UniRef100_UPI0000F2CB43 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2CB43 Length = 252 Score = 61.2 bits (147), Expect = 3e-08 Identities = 54/164 (32%), Positives = 60/164 (36%), Gaps = 51/164 (31%) Frame = +3 Query: 6 SPPPNH-------HLPFSLVSSHPAPLPIRPIDMPWGLRPSLLPRPAPSA-----TPLP- 146 SPPP H FS SS P P P L PS PRP P+A T +P Sbjct: 40 SPPPPHPAAEGMSRTVFSRASSRDPPRPFPTPMTPHFLPPSPSPRPRPAAQYRLSTDIPS 99 Query: 147 ----------IVPALTLLTLAGGVAAVV--SASQERANFRRTRALLSHPPPGAPSV---- 278 + A + A AA V +AS A A + PP AP Sbjct: 100 PERARQAAAAVASAAAAASAASAAAAAVASAASSAAAAAAAAAAAGAAEPPAAPPAPFFP 159 Query: 279 ----------------------VAGGGVGGGGGGGGGGGGGGGG 344 A GG GGGGGGGGGGGGGGGG Sbjct: 160 PLLLNAGGRLERRQRRRRRRRGAAAGGAGGGGGGGGGGGGGGGG 203 Score = 58.2 bits (139), Expect = 3e-07 Identities = 44/109 (40%), Positives = 52/109 (47%) Frame = +3 Query: 126 PSATPLPIVPALTLLTLAGGVAAVVSASQERANFRRTRALLSHPPPGAPSVVAGGGVGGG 305 P+A P P P L L AGG + Q R RR A G GGG GGG Sbjct: 150 PAAPPAPFFPPLLLN--AGGR---LERRQRRRRRRRGAAAGGAGGGGGGGGGGGGGGGGG 204 Query: 306 GGGGGGGGGGGGGTVSPLPLATSSSRASARLCGVGGSSNRTADGWRGRR 452 GGGGGGGGGGGGG ++SSS + G G +R+ + GRR Sbjct: 205 GGGGGGGGGGGGGGGGGSGGSSSSSGS-----GGSGGEDRSPEPSPGRR 248 [67][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 60.8 bits (146), Expect = 4e-08 Identities = 23/44 (52%), Positives = 28/44 (63%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 + P+ + +A + S T PPPPPPPPPPPPPPPP PPP Sbjct: 123 IDPSQYIEMMANQMQQQTQSSQTPPPPPPPPPPPPPPPPPPPPP 166 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -1 Query: 346 VPPPPPPPPPPPPPPPPTPPP 284 +PPPPPPPPPPPPPPPP PPP Sbjct: 424 LPPPPPPPPPPPPPPPPPPPP 444 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPP 445 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPP 446 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPP 447 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPP 448 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPP 449 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPP 450 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPP 451 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPAT 278 PPPPPPPPPPPPPPPP PP T Sbjct: 152 PPPPPPPPPPPPPPPPPKPPKT 173 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATT 275 PPPPPPPPPPPPPPPP P P T Sbjct: 151 PPPPPPPPPPPPPPPPPPKPPKT 173 [68][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/78 (39%), Positives = 41/78 (52%), Gaps = 10/78 (12%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTP-HSRALARDDEVANGSGDTVP---------PPPPPPPPPPP 308 P +R ++P+ L+L P +A + V + + +T P PPPPPPPPPPP Sbjct: 1434 PSKRGQKPTLNPLVLEPVASQDTIMATIEAVIHMARETPPLPPPPPPPPPPPPPPPPPPP 1493 Query: 307 PPPPTPPPATTDGAPGGG 254 PPPP PPP P GG Sbjct: 1494 PPPPPPPPPPLPRTPRGG 1511 [69][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -1 Query: 364 NGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 N + PPPPPPPPPPPPPPPP PPP T P Sbjct: 37 NNKAEAAPPPPPPPPPPPPPPPPPPPPPPTPPPP 70 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPPTPPP P Sbjct: 50 PPPPPPPPPPPPPPPPTPPPPPLPKTP 76 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP T P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPP 71 [70][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -1 Query: 364 NGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 N + PPPPPPPPPPPPPPPP PPP T P Sbjct: 37 NNKAEAAPPPPPPPPPPPPPPPPPPPPPPTPPPP 70 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPPTPPP P Sbjct: 50 PPPPPPPPPPPPPPPPTPPPPPLPKTP 76 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP T P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPP 71 [71][TOP] >UniRef100_Q75D15 ABR207Wp n=1 Tax=Eremothecium gossypii RepID=Q75D15_ASHGO Length = 2402 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/64 (43%), Positives = 33/64 (51%), Gaps = 12/64 (18%) Frame = -1 Query: 418 LLPPTPHSRALARDDEVANGSGDTVPPPPPPPP------------PPPPPPPPTPPPATT 275 L PP P R+++ SGD PPPPPPPP PPPPPPPP PP + Sbjct: 4 LPPPPPPPPGFRRNNKSGASSGDAPPPPPPPPPGMHRTYSGYPSVPPPPPPPPPPPMSLE 63 Query: 274 DGAP 263 +G P Sbjct: 64 EGPP 67 [72][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/59 (49%), Positives = 32/59 (54%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 SPP PR PS PP+P + PPPPPPPPPPPPPPPP+PPP Sbjct: 243 SPPPSPRPPSPP----PPSP-----------------SPPPPPPPPPPPPPPPPPSPPP 280 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/69 (42%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPP----PPPPPPPPPPPPTP 290 P P P+ LPP+P A +R PPPP PPPPPPPPPPPP P Sbjct: 215 PNVNPIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPP 274 Query: 289 PPATTDGAP 263 PP+ P Sbjct: 275 PPSPPPPPP 283 [73][TOP] >UniRef100_UPI0001926BC7 PREDICTED: similar to mini-collagen isoform 3 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC7 Length = 148 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP G PG Sbjct: 54 PPPPPPPPPPPPPPPPPPPPLPLPGNPG 81 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -1 Query: 346 VPPPPPPPPPPPPPPPPTPPP 284 VPPPPPPPPPPPPPPPP PPP Sbjct: 49 VPPPPPPPPPPPPPPPPPPPP 69 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP PG Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPLPLPG 78 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGG 257 PPPPPPPPPPPPPPPP P P + P G Sbjct: 56 PPPPPPPPPPPPPPPPPPLPLPGNPGPPG 84 [74][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP GAP Sbjct: 939 PPPPPPPPPPPPPPPPPPPPPPPPGAP 965 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP PG Sbjct: 936 PPPPPPPPPPPPPPPPPPPPPPPPPPPG 963 Score = 57.4 bits (137), Expect = 5e-07 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPP 284 T PPPPPPPPPPPPPPPP PPP Sbjct: 852 TTPPPPPPPPPPPPPPPPPPPP 873 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGG 257 PPPPPPPPPPPPPPPP PPP P G Sbjct: 935 PPPPPPPPPPPPPPPPPPPPPPPPPPPPG 963 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%), Gaps = 3/30 (10%) Frame = -1 Query: 343 PPPPPPPPPPPPPP---PPTPPPATTDGAP 263 PPPPPPPPPPPPPP PP PPPA GAP Sbjct: 948 PPPPPPPPPPPPPPPGAPPPPPPALPPGAP 977 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPP 284 T PPPPPPPPPPPPPPPP PPP Sbjct: 853 TPPPPPPPPPPPPPPPPPPPPP 874 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 PPPPPPPPPPPPPPPP PPP P G Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 963 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 856 PPPPPPPPPPPPPPPPPPPP 875 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPP 876 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPP 877 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPP 878 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPP 879 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPP 880 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPP 881 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPP 882 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPP 883 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPP 884 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPP 885 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPP 886 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPP 887 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPP 888 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPP 889 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPP 890 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPP 891 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPP 892 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPP 893 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPP 894 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPP 895 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPP 896 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPP 897 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPP 898 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPP 899 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPP 900 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPP 901 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPP 902 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPP 903 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPP 904 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPP 905 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPP 906 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPP 907 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPP 908 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPP 909 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPP 910 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPP 911 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPP 912 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPP 913 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPP 914 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPP 915 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPP 916 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPP 917 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPP 918 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPP 919 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPP 920 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPP 921 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPP 922 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPP 923 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPP 924 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPP 925 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPP 926 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPP 927 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPP 928 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPP 929 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPP 930 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPP 931 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPP 932 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPP 933 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPP 934 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPP 935 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPP 936 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPP 937 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPP 938 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPP 939 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPP 940 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPP 941 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPP 942 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPP 943 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPP 944 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPP 945 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPP 946 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPP 947 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPP 948 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPP 949 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPP 950 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 932 PPPPPPPPPPPPPPPPPPPP 951 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 933 PPPPPPPPPPPPPPPPPPPP 952 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -1 Query: 352 DTVP--PPPPPPPPPPPPPPPTPPPATTD 272 +T P PPPPPPPPPPPPPPP PPP D Sbjct: 117 ETTPTTPPPPPPPPPPPPPPPQPPPPEPD 145 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -1 Query: 346 VPPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 V PPPPPPPPPPPPPP T PP T G GG Sbjct: 743 VCPPPPPPPPPPPPPPTTWPPEPTSGCVYGG 773 [75][TOP] >UniRef100_UPI0000F2AE0C PREDICTED: similar to hCG1781691 n=1 Tax=Monodelphis domestica RepID=UPI0000F2AE0C Length = 358 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/82 (36%), Positives = 38/82 (46%) Frame = -1 Query: 367 ANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAA 188 +N S PPPPPPPPPPPPPPP PPP D N R + + T Sbjct: 10 SNPSTQPPQPPPPPPPPPPPPPPPPPPPPPKDSPFSIKNLLNGDHHRAPPKQQQPPRTLF 69 Query: 187 TPPASVSNVSAGTMGRGVAEGA 122 P ++ + +A +G EGA Sbjct: 70 APASAAAAAAAAAAAKGALEGA 91 [76][TOP] >UniRef100_UPI000024DCC5 zinc finger homeodomain 4 n=1 Tax=Mus musculus RepID=UPI000024DCC5 Length = 3581 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/65 (43%), Positives = 31/65 (47%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P P A PP P + + + PP PPPPPPPPPPPPP PPP Sbjct: 1976 PPPPPPLPPA-----PPQPSTLGPVKIPNTVSAPLQAPPPTPPPPPPPPPPPPPPPPPPP 2030 Query: 277 TDGAP 263 AP Sbjct: 2031 PPSAP 2035 [77][TOP] >UniRef100_UPI00016E4781 UPI00016E4781 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E4781 Length = 906 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/63 (44%), Positives = 30/63 (47%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP PR + PPTP PPPPPPPPPPPPPPPP PPP Sbjct: 588 PPPSPRLNPTIPNQSPPTPR------------------PPPPPPPPPPPPPPPPPPPPQH 629 Query: 277 TDG 269 +G Sbjct: 630 PEG 632 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P R + P PPPPPPPPPPPPPP PPP Sbjct: 583 PPLPLPPPSPRLNPTIPNQSPPTPRPPPPPPPPPPPPPPPPPP 625 [78][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = -1 Query: 370 VANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 ++ S +T PPPPPPPPPPPPPPPPTP P T P Sbjct: 1924 ISPSSPETPPPPPPPPPPPPPPPPPTPAPPPTPPPP 1959 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPPATT 275 T PPPPPPPPPPPPPPPP PPP ++ Sbjct: 3065 TPPPPPPPPPPPPPPPPPPPPPPSS 3089 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP + G Sbjct: 3066 PPPPPPPPPPPPPPPPPPPPPPSSSLSG 3093 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P P PPTP PPPPPPPPPPPPPPPP+ PP Sbjct: 1938 PPPPPPPPPPPTPAPPPTPP------------------PPPPPPPPPPPPPPPPSAPP 1977 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/60 (43%), Positives = 28/60 (46%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 +PP P P PPTP P PPPPPPPPPPPPPP PPP+ Sbjct: 1931 TPPPPPPPPPPPPPPPPPTPAPP----------------PTPPPPPPPPPPPPPPPPPPS 1974 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPP P PPP P Sbjct: 1935 PPPPPPPPPPPPPPTPAPPPTPPPPPP 1961 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -1 Query: 340 PPPPPPPPPPPPPPPTPPPATTDGAPGG 257 PPPPPPPPPPPPPPP PPP + G Sbjct: 3066 PPPPPPPPPPPPPPPPPPPPPPSSSLSG 3093 [79][TOP] >UniRef100_Q5RGR6 Wiskott-Aldrich syndrome, like n=1 Tax=Danio rerio RepID=Q5RGR6_DANRE Length = 518 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/67 (40%), Positives = 34/67 (50%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P + PP PHS +++ + G PPPPPPPP PPPP PP P Sbjct: 351 PPPPPSRGPTQAPPPPPPPHSASISPPAPPSIGGAPPPPPPPPPPPGPPPPGPPPPQDVD 410 Query: 277 TDGAPGG 257 + +PGG Sbjct: 411 SGDSPGG 417 [80][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/91 (36%), Positives = 43/91 (47%), Gaps = 2/91 (2%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSN 164 PPPPPPPPPPPPPPPP PPPA D V + W++ T A A ++ Sbjct: 226 PPPPPPPPPPPPPPPPPPPPACDD------------VSFPVYFEWDSSTLTAQARAVIAQ 273 Query: 163 VS--AGTMGRGVAEGAGRGNRDGRRPHGMSM 77 S G+ G AG +R G + + + Sbjct: 274 ASNQRGSCGVTRVTVAGFTDRSGAASYNVGL 304 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 224 PPPPPPPPPPPPPPPPPPPP 243 [81][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPPA AP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPAAKPSAP 95 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -1 Query: 409 PTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 P P AL A PPPPPPPPPPPPPPPP PPP Sbjct: 42 PPPLVTALDNPQSAAPAQARPTPPPPPPPPPPPPPPPPPPPP 83 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPAAKP 92 [82][TOP] >UniRef100_B4YB55 BimA n=1 Tax=Burkholderia pseudomallei RepID=B4YB55_BURPS Length = 369 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 T PPPPPPPPPPPPPPP PPP+TT P Sbjct: 93 TTTPPPPPPPPPPPPPPPPPPPSTTPSPP 121 [83][TOP] >UniRef100_A3WBR8 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBR8_9SPHN Length = 378 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 G D PPPPPPPPPPPPPPPP PPP AP Sbjct: 226 GGQDAPPPPPPPPPPPPPPPPPPPPPPPPPPAP 258 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP + AP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPAPEPAP 262 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 364 NGSGDTVPPPPPPPPPPPPPPPPTPPP 284 N G PPPPPPPPPPPPPPPP PPP Sbjct: 224 NFGGQDAPPPPPPPPPPPPPPPPPPPP 250 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP P PA + P Sbjct: 241 PPPPPPPPPPPPPPPPAPEPAPCNTGP 267 [84][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/60 (51%), Positives = 34/60 (56%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 V+ P P P+ V PP P RD VA+ S PPPPPPPPPPPPP PP PPP Sbjct: 196 VTGPGGPTFPTPVSA--PPPPF-----RDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPP 248 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/69 (42%), Positives = 33/69 (47%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 SPP P P PP+P PPPPPPPPPPPPPPPP+PPP Sbjct: 224 SPPPPPPPPPPPPPPPPPSPP------------------PPPPPPPPPPPPPPPPSPPPP 265 Query: 280 TTDGAPGGG 254 + + P G Sbjct: 266 SPNPPPPKG 274 [85][TOP] >UniRef100_A8NN84 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NN84_COPC7 Length = 550 Score = 60.5 bits (145), Expect = 6e-08 Identities = 43/130 (33%), Positives = 55/130 (42%), Gaps = 21/130 (16%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPH--SRALARDDEVANGSGDTVPPPPPPPPPPPPP------ 305 +PP PR+P+ PP P +RA+A +D + + PPPPPPPPPP PP Sbjct: 345 TPPPPPRRPALSNPAPPPRPPVPTRAVAEEDTTSVSTPP--PPPPPPPPPPGPPAATGGA 402 Query: 304 PPPTPPPATTDGA-----------PGGG*DSNARVRRKLARSWEAETTAATPPASV--SN 164 PPP PPP GA PGG S A+ PP N Sbjct: 403 PPPPPPPPPPGGAAPPPPPPPPPPPGGAVPPPPPPPPPAGGSGAPSALASMPPPQPGRGN 462 Query: 163 VSAGTMGRGV 134 + A G+G+ Sbjct: 463 LLADIQGKGI 472 Score = 57.4 bits (137), Expect = 5e-07 Identities = 37/95 (38%), Positives = 39/95 (41%), Gaps = 30/95 (31%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPP------------------ 332 PP PR+P AV PP P SR NG+ T PPPP Sbjct: 316 PPAPPRRP-AVSSPNPPPPPSRPQP------NGAAATPPPPPRRPALSNPAPPPRPPVPT 368 Query: 331 ------------PPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPP PPA T GAP Sbjct: 369 RAVAEEDTTSVSTPPPPPPPPPPPPGPPAATGGAP 403 [86][TOP] >UniRef100_UPI00017C2CD7 PREDICTED: similar to formin-like 2 n=1 Tax=Bos taurus RepID=UPI00017C2CD7 Length = 664 Score = 60.1 bits (144), Expect = 7e-08 Identities = 28/47 (59%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = -1 Query: 415 LPPTPHSRALARD--DEVANGSGDT-VPPPPPPPPPPPPPPPPTPPP 284 LPP P L+ D + V NG VPPPPPPPPPPPP PPP PPP Sbjct: 292 LPPPPPPLPLSSDAPEAVQNGPATPPVPPPPPPPPPPPPXPPPPPPP 338 [87][TOP] >UniRef100_UPI0000F2C630 PREDICTED: similar to zinc finger homeodomain 4, n=1 Tax=Monodelphis domestica RepID=UPI0000F2C630 Length = 3606 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/71 (43%), Positives = 36/71 (50%), Gaps = 5/71 (7%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPP-----PPPPPPPPPPPPPP 296 +PP P P LPPTP ++ V +G + PP PPP PPPPPPPPPP Sbjct: 1965 TPPPPPPPPP-----LPPTP-----SQSSSVGSGKIQSTPPTPLQAPPPTPPPPPPPPPP 2014 Query: 295 TPPPATTDGAP 263 PPP AP Sbjct: 2015 PPPPPPPPSAP 2025 [88][TOP] >UniRef100_UPI0000D9F166 PREDICTED: similar to guanine nucleotide binding protein, alpha activating polypeptide O n=1 Tax=Macaca mulatta RepID=UPI0000D9F166 Length = 571 Score = 60.1 bits (144), Expect = 7e-08 Identities = 29/69 (42%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPP----PPPPPPPPPPPPPPTP 290 P P P A P H R + D +++PP PPPPPPPPPPPPPP P Sbjct: 114 PAPCPALPCARGSAKAPRTHRRLKSGDAHALAAPPNSLPPHPAPPPPPPPPPPPPPPPPP 173 Query: 289 PPATTDGAP 263 PPA P Sbjct: 174 PPAAAAAGP 182 [89][TOP] >UniRef100_Q9Y6X0 SET-binding protein n=2 Tax=Homo sapiens RepID=SETBP_HUMAN Length = 1542 Score = 60.1 bits (144), Expect = 7e-08 Identities = 35/95 (36%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTP-HSRALARDDEVANGSGDTVPPPPPPPPP-PPPPPPPTPPP 284 P +R ++PS L+L P +A + V + + + P PPPPPPP PPPPPPP PPP Sbjct: 1428 PSKRGQKPSLSPLVLEPAASQDTIMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPLPPP 1487 Query: 283 ATTDGAPGGG*DSNARVRRKLARSWEAETTAATPP 179 P GG +RK A+ +PP Sbjct: 1488 PPLPKTPRGG-------KRKHKPQAPAQPPQQSPP 1515 [90][TOP] >UniRef100_UPI00016E98C3 UPI00016E98C3 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E98C3 Length = 523 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/74 (41%), Positives = 37/74 (50%), Gaps = 6/74 (8%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALA------RDDEVANGSGDTVPPPPPPPPPPPPPP 302 +S P P PS L PP P ++ + +G G PPPPPPPPPPPP P Sbjct: 347 ISAPPPPPPPSRGSLPPPPLPGHASIPFTPPPPPPPSIPSGGG--APPPPPPPPPPPPGP 404 Query: 301 PPTPPPATTDGAPG 260 PP PP T+D G Sbjct: 405 PPPAPPPTSDANGG 418 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/81 (37%), Positives = 35/81 (43%), Gaps = 8/81 (9%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP--------PPPPP 305 +PP P + PP P SR + + PPPPPPP PPPPP Sbjct: 336 APPPPPPSRPGISAPPPPPPPSRGSLPPPPLPGHASIPFTPPPPPPPSIPSGGGAPPPPP 395 Query: 304 PPPTPPPATTDGAPGGG*DSN 242 PPP PPP AP D+N Sbjct: 396 PPPPPPPGPPPPAPPPTSDAN 416 Score = 53.9 bits (128), Expect = 5e-06 Identities = 32/81 (39%), Positives = 35/81 (43%), Gaps = 14/81 (17%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP------------PPP 314 PP P +P PP P +L + S PPPPPPP PPP Sbjct: 338 PPPPPSRPGISAPPPPPPPSRGSLPPPPLPGHASIPFTPPPPPPPSIPSGGGAPPPPPPP 397 Query: 313 PPPPPPTPPPA--TTDGAPGG 257 PPPPP PPPA T A GG Sbjct: 398 PPPPPGPPPPAPPPTSDANGG 418 [91][TOP] >UniRef100_UPI000179F39E UPI000179F39E related cluster n=1 Tax=Bos taurus RepID=UPI000179F39E Length = 810 Score = 60.1 bits (144), Expect = 7e-08 Identities = 28/47 (59%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = -1 Query: 415 LPPTPHSRALARD--DEVANGSGDT-VPPPPPPPPPPPPPPPPTPPP 284 LPP P L+ D + V NG VPPPPPPPPPPPP PPP PPP Sbjct: 485 LPPPPPPLPLSSDAPEAVQNGPATPPVPPPPPPPPPPPPXPPPPPPP 531 [92][TOP] >UniRef100_Q2W222 RTX toxins and related Ca2+-binding protein n=1 Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W222_MAGSA Length = 1274 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -1 Query: 352 DTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 D PPPPPPPPPPPPPPPP PPP+ AP Sbjct: 269 DVAPPPPPPPPPPPPPPPPPPPPSPPAPAP 298 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPA P Sbjct: 275 PPPPPPPPPPPPPPPPPSPPAPAPPPP 301 [93][TOP] >UniRef100_Q5NBA4 Putative UDP-glucose pyrophosphorylase n=1 Tax=Oryza sativa Japonica Group RepID=Q5NBA4_ORYSJ Length = 884 Score = 60.1 bits (144), Expect = 7e-08 Identities = 48/143 (33%), Positives = 61/143 (42%), Gaps = 35/143 (24%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPT--PHSRAL--------ARDDEVANGSG---DTVPPPPPPPP 320 +PP P P+ LLPPT P R+L A E S D PPP PP P Sbjct: 26 TPPPTPPLPTP---LLPPTLAPLQRSLVFGRVEGEAMSSEARESSATAVDRTPPPTPPSP 82 Query: 319 PPPPPPPP-----TPPPATTDGAPGGG*DSNARVRRK-----------------LARSWE 206 PPPPPPPP TPPP++ AP GG +++ R L R Sbjct: 83 PPPPPPPPTNGTLTPPPSS---APSGGRATSSEARESPHATSVDDGGRAPPPPPLPRPTS 139 Query: 205 AETTAATPPASVSNVSAGTMGRG 137 A T AT P++ + S+ + G Sbjct: 140 ARATPATTPSADGSSSSSSSTSG 162 [94][TOP] >UniRef100_B6KQ22 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KQ22_TOXGO Length = 362 Score = 60.1 bits (144), Expect = 7e-08 Identities = 28/65 (43%), Positives = 32/65 (49%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP+ P P+ PP L +DE S PPPPP PPPPPPP PP PPP Sbjct: 123 PPQEPEPPAP-----PPVEDPEVLPEEDEA---SSSLPPPPPPSPPPPPPPSPPPPPPVE 174 Query: 277 TDGAP 263 +P Sbjct: 175 VPLSP 179 [95][TOP] >UniRef100_B0CNI2 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CNI2_LACBS Length = 1061 Score = 60.1 bits (144), Expect = 7e-08 Identities = 38/87 (43%), Positives = 43/87 (49%), Gaps = 4/87 (4%) Frame = -1 Query: 460 SPPRRP--RQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPP--PPPPPPPPPPPT 293 SP R P R+ ++ R P P RAL R PPPPP PPPPPPPPPP + Sbjct: 799 SPRRSPSLRRSTSQRRYSPSPP--RALPR-----------APPPPPRAPPPPPPPPPPRS 845 Query: 292 PPPATTDGAPGGG*DSNARVRRKLARS 212 PPP P D A +RRKL S Sbjct: 846 PPPPLPSSDPNTALDREAALRRKLEAS 872 [96][TOP] >UniRef100_A8NHE8 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHE8_COPC7 Length = 171 Score = 60.1 bits (144), Expect = 7e-08 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -1 Query: 403 PHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PHSR + D G PPPPPPPPPPPPPPPP P T Sbjct: 129 PHSRGIIYGDWSFGGGAPPPPPPPPPPPPPPPPPPPVSKPKT 170 [97][TOP] >UniRef100_B7Z5P8 cDNA FLJ50179, highly similar to Homeobox protein Hox-B3 n=1 Tax=Homo sapiens RepID=B7Z5P8_HUMAN Length = 358 Score = 51.6 bits (122), Expect(2) = 9e-08 Identities = 29/56 (51%), Positives = 33/56 (58%), Gaps = 4/56 (7%) Frame = +3 Query: 231 RTRALLSHPPPGAPSVVAGGGVGGGGGG----GGGGGGGGGGTVSPLPLATSSSRA 386 R + L + PG GGG GGGGGG GGGGGGGGGG SP P + +S RA Sbjct: 64 RQTSKLKNNSPGTAEGCGGGGGGGGGGGSGGSGGGGGGGGGGDKSP-PGSAASKRA 118 Score = 28.1 bits (61), Expect(2) = 9e-08 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 Query: 178 PAVWPQSSPPPKSAPTSAA 234 P P SPPP +APTSAA Sbjct: 9 PLSAPPGSPPPSAAPTSAA 27 [98][TOP] >UniRef100_UPI000178C29A hypothetical protein Y40B1A.3 n=1 Tax=Caenorhabditis elegans RepID=UPI000178C29A Length = 356 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/118 (32%), Positives = 51/118 (43%), Gaps = 5/118 (4%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 + PP P Q + P R A + S T PPPPPPPPPPPPPPPP P Sbjct: 44 IPPPPPPMQRTPRTPGNPMFNSPRDGAYTSMPSGSSSSTAPPPPPPPPPPPPPPPPPPME 103 Query: 283 ATT-----DGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEG 125 T+ GAPG S+ + A+P +S + +S+ R ++ G Sbjct: 104 GTSVIGGPIGAPGAH-----------RNSYSGGSIHASPSSSSAGMSSSGPTRSISTG 150 [99][TOP] >UniRef100_UPI000155EC14 PREDICTED: similar to SET binding protein 1 n=1 Tax=Equus caballus RepID=UPI000155EC14 Length = 1597 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/71 (40%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVA---NGSGDTVPPPPPPPPPPPPPPPPTPP 287 P +R ++PS L+L P + E +PPPPPPP PPPPPPPP PP Sbjct: 1482 PSKRGQKPSLSPLVLEPAASQDTIMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPPPPP 1541 Query: 286 PATTDGAPGGG 254 P GGG Sbjct: 1542 PPLPKTPRGGG 1552 [100][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/85 (40%), Positives = 39/85 (45%) Frame = -1 Query: 436 PSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGG 257 PS L P P R+ + D S PPPPPPPPPPPPPPPP PPP +P Sbjct: 2319 PSVSSLPAKPRPFFRSSSLDI-----SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSP-- 2371 Query: 256 G*DSNARVRRKLARSWEAETTAATP 182 + K + A T ATP Sbjct: 2372 ----KPTILPKKKLTVAAPVTTATP 2392 [101][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/85 (40%), Positives = 39/85 (45%) Frame = -1 Query: 436 PSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGG 257 PS L P P R+ + D S PPPPPPPPPPPPPPPP PPP +P Sbjct: 1257 PSVSSLPAKPRPFFRSSSLDI-----SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSP-- 1309 Query: 256 G*DSNARVRRKLARSWEAETTAATP 182 + K + A T ATP Sbjct: 1310 ----KPTILPKKKLTVAAPVTTATP 1330 [102][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/85 (40%), Positives = 39/85 (45%) Frame = -1 Query: 436 PSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGG 257 PS L P P R+ + D S PPPPPPPPPPPPPPPP PPP +P Sbjct: 2319 PSVSSLPAKPRPFFRSSSLDI-----SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSP-- 2371 Query: 256 G*DSNARVRRKLARSWEAETTAATP 182 + K + A T ATP Sbjct: 2372 ----KPTILPKKKLTVAAPVTTATP 2392 [103][TOP] >UniRef100_UPI0000E24D2B PREDICTED: SET binding protein 1 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E24D2B Length = 1596 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/70 (42%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTP-HSRALARDDEVANGSGDTVPPPPPPPPP-PPPPPPPTPPP 284 P +R ++PS L+L P +A + V + + + P PPPPPPP PPPPPPP PPP Sbjct: 1482 PSKRGQKPSLSPLVLEPAASQDTIMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPLPPP 1541 Query: 283 ATTDGAPGGG 254 P GG Sbjct: 1542 PPLPKTPRGG 1551 [104][TOP] >UniRef100_UPI0000E1F764 PREDICTED: formin-like 2 isoform 6 n=1 Tax=Pan troglodytes RepID=UPI0000E1F764 Length = 1032 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/65 (41%), Positives = 33/65 (50%) Frame = -1 Query: 418 LLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNA 239 +LP + VA +G PP PPPPPPPPPPPPP PPP PG ++ Sbjct: 493 ILPVVASGTLSMGSEVVAVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETGP 552 Query: 238 RVRRK 224 V+ K Sbjct: 553 SVKIK 557 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/50 (44%), Positives = 28/50 (56%) Frame = -1 Query: 370 VANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVRRKL 221 V NG PPPPPPPPPPPPPPP PPP P + ++++ + Sbjct: 511 VQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETGPSVKIKKPI 560 [105][TOP] >UniRef100_UPI0000D9B690 PREDICTED: similar to diaphanous 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9B690 Length = 1269 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/40 (60%), Positives = 27/40 (67%), Gaps = 7/40 (17%) Frame = -1 Query: 355 GDTVPPPPPPPPPPPPPPPPTPPP-------ATTDGAPGG 257 GD+ PPPPPPPPPPPPPPP PPP ++T PGG Sbjct: 629 GDSTTPPPPPPPPPPPPPPPPPPPLIGSVCISSTPSLPGG 668 [106][TOP] >UniRef100_UPI0000EE3DB8 zinc finger homeodomain 4 n=1 Tax=Homo sapiens RepID=UPI0000EE3DB8 Length = 3571 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/65 (43%), Positives = 30/65 (46%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P P A PP P S + + PP PPPPPPPPPPPPP PPP Sbjct: 1961 PPPPPPLPPA-----PPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPP 2015 Query: 277 TDGAP 263 P Sbjct: 2016 PSAPP 2020 [107][TOP] >UniRef100_UPI00004576BB Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Homo sapiens RepID=UPI00004576BB Length = 3567 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/65 (43%), Positives = 30/65 (46%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P P A PP P S + + PP PPPPPPPPPPPPP PPP Sbjct: 1961 PPPPPPLPPA-----PPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPP 2015 Query: 277 TDGAP 263 P Sbjct: 2016 PSAPP 2020 [108][TOP] >UniRef100_UPI00016E586E UPI00016E586E related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E586E Length = 505 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/78 (43%), Positives = 36/78 (46%), Gaps = 9/78 (11%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLP---------PTPHSRALARDDEVANGSGDTVPPPPPPPPPPPP 308 SPP P P L LP P P S +VA +G PPPPP PPPP Sbjct: 251 SPPPLPPLPPRPLLTLPCLMGAHPRRPPPQSPT---PPQVAPMAGPPAPPPPPGPPPPMA 307 Query: 307 PPPPTPPPATTDGAPGGG 254 PPP PPP T G P GG Sbjct: 308 VPPPMPPPLPTGGGPPGG 325 [109][TOP] >UniRef100_UPI00016E3909 UPI00016E3909 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E3909 Length = 510 Score = 59.7 bits (143), Expect = 1e-07 Identities = 46/134 (34%), Positives = 56/134 (41%), Gaps = 3/134 (2%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 +PP P P PP P + A+G +PPPP PPP PPP PP P Sbjct: 267 APPAPPLAPGG-----PPPPPAPPPPPGPPPASG----IPPPPGPPPSGPPPAPPLPSGG 317 Query: 280 TTDGAPGGG*DSNARVRRKLARSWEAETTAATPP---ASVSNVSAGTMGRGVAEGAGRGN 110 G GGG + A KL + + E A T P A S S ++G G G G G Sbjct: 318 GGGGGGGGGGLAAALAGAKLRKVSKQEDGATTGPIGRADSSRSSNSSIGGGSGGGGGGGG 377 Query: 109 RDGRRPHGMSMGRM 68 G G+ MG M Sbjct: 378 GGGGGGGGL-MGEM 390 Score = 57.4 bits (137), Expect = 5e-07 Identities = 48/133 (36%), Positives = 61/133 (45%), Gaps = 5/133 (3%) Frame = +3 Query: 9 PPPNHHLPFSLVSSHPAPLPIRPIDMPWGLRPSLLPRPAPSATPLPIVPALTLLTLAGGV 188 PPP P P P P I P G PS P PAP PLP GG+ Sbjct: 280 PPPAPPPP-------PGPPPASGIPPPPGPPPSG-PPPAP---PLPSGGGGGGGGGGGGL 328 Query: 189 AAVVSASQERANFRRTRALLSHPPPGAPSVVA-----GGGVGGGGGGGGGGGGGGGGTVS 353 AA ++ ++ R ++ + P A S + GGG GGGGGGGGGGGGGGGG + Sbjct: 329 AAALAGAKLRKVSKQEDGATTGPIGRADSSRSSNSSIGGGSGGGGGGGGGGGGGGGGLMG 388 Query: 354 PLPLATSSSRASA 392 + + R +A Sbjct: 389 EMSAILARRRKAA 401 [110][TOP] >UniRef100_UPI0001951250 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Canis lupus familiaris RepID=UPI0001951250 Length = 1052 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDG 269 PP P + + V NG PPPPPPPPPPPPPPP PPP G Sbjct: 488 PPPPLPPSSETPEAVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPG 535 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 LPP P + + A +G PP PPPPPPPPPPPPP PPP Sbjct: 485 LPPPPPPLPPSSETPEAVQNGPVTPPMPPPPPPPPPPPPPPPPP 528 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/51 (43%), Positives = 27/51 (52%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 LPP+ + ++ V PPPPPPPPPPPPPPPP P + P Sbjct: 492 LPPSSETPEAVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVP 542 [111][TOP] >UniRef100_UPI000184A1A2 Zinc finger protein ZIC 5 (Zinc finger protein of the cerebellum 5). n=2 Tax=Canis lupus familiaris RepID=UPI000184A1A2 Length = 668 Score = 59.7 bits (143), Expect = 1e-07 Identities = 45/131 (34%), Positives = 52/131 (39%), Gaps = 2/131 (1%) Frame = -1 Query: 439 QPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 QPSA PP P S + PPPPP PPPPPPPPPP TT + G Sbjct: 146 QPSAPPPPAPPLPPSPS---------------PPPPPSPPPPPPPPPPALSGYTTTDSGG 190 Query: 259 GG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEGAGRGNRDGRRPH--G 86 GG R + R + A P A++ V G R G G PH G Sbjct: 191 GGSSGKGHSRDFVLR---RDLFATAPAAAMHGVPLGGEQR---SGTGSPQHSAPPPHSAG 244 Query: 85 MSMGRMGKGAG 53 M + G AG Sbjct: 245 MFISASGTYAG 255 [112][TOP] >UniRef100_UPI000179D41E UPI000179D41E related cluster n=1 Tax=Bos taurus RepID=UPI000179D41E Length = 1416 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/71 (40%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVA---NGSGDTVPPPPPPPPPPPPPPPPTPP 287 P +R ++PS L+L P + E +PPPPPPP PPPPPPPP PP Sbjct: 1301 PSKRGQKPSLSPLVLEPAASQDTIMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPPPPP 1360 Query: 286 PATTDGAPGGG 254 P GGG Sbjct: 1361 PPLPKTPRGGG 1371 [113][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP T AP Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPPTPPPA P Sbjct: 1424 PPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 57.4 bits (137), Expect = 5e-07 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPP 284 T PPPPPPPPPPPPPPPP PPP Sbjct: 1407 TAPPPPPPPPPPPPPPPPPPPP 1428 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -1 Query: 358 SGDTVPPPPPPPPPPPPPPPPTPPP 284 +G PPPPPPPPPPPPPPPP PPP Sbjct: 1405 TGTAPPPPPPPPPPPPPPPPPPPPP 1429 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPP 284 G+ PPPPPPPPPPPPPPPP PPP Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPP 1431 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATT 275 PPPPPPPPPPPPPPPP PPP T Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPT 1440 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP P Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP P Sbjct: 1415 PPPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 1413 PPPPPPPPPPPPPPPPPPPP 1432 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 1414 PPPPPPPPPPPPPPPPPPPP 1433 [114][TOP] >UniRef100_C5CX67 FHA domain containing protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CX67_VARPS Length = 645 Score = 59.7 bits (143), Expect = 1e-07 Identities = 37/102 (36%), Positives = 52/102 (50%), Gaps = 6/102 (5%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASV 170 + PPPPPPPPPPPPPPPP PPPA A ++ A + + A + A P V Sbjct: 378 SAPPPPPPPPPPPPPPPPPPPPAPVPVA-APRVENVAPPAPQQPKPVAAPSPVAATPVPV 436 Query: 169 -----SNVSAGTMGRGVAEGAGRGNRDGRRP-HGMSMGRMGK 62 + S+ + R EGAG + G++P +M R+G+ Sbjct: 437 AAPPSAPASSDELFRAFLEGAGVPDVAGQQPLDAEAMRRLGR 478 [115][TOP] >UniRef100_Q9XW27 Protein Y40B1A.3a, partially confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=Q9XW27_CAEEL Length = 490 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/118 (32%), Positives = 51/118 (43%), Gaps = 5/118 (4%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 + PP P Q + P R A + S T PPPPPPPPPPPPPPPP P Sbjct: 178 IPPPPPPMQRTPRTPGNPMFNSPRDGAYTSMPSGSSSSTAPPPPPPPPPPPPPPPPPPME 237 Query: 283 ATT-----DGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEG 125 T+ GAPG S+ + A+P +S + +S+ R ++ G Sbjct: 238 GTSVIGGPIGAPGAH-----------RNSYSGGSIHASPSSSSAGMSSSGPTRSISTG 284 [116][TOP] >UniRef100_Q4E4C9 Formin, putative n=1 Tax=Trypanosoma cruzi RepID=Q4E4C9_TRYCR Length = 520 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPPATTDG 269 T PPPPPPPPPPPPPPPP PPP+++ G Sbjct: 494 TPPPPPPPPPPPPPPPPPPPPPSSSGG 520 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 346 VPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 +P PPPPPPPPPPPPPP PPP + G Sbjct: 492 LPTPPPPPPPPPPPPPPPPPPPPPSSSGG 520 [117][TOP] >UniRef100_B5WWM0 Protein Y40B1A.3b, partially confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=B5WWM0_CAEEL Length = 504 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/118 (32%), Positives = 51/118 (43%), Gaps = 5/118 (4%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 + PP P Q + P R A + S T PPPPPPPPPPPPPPPP P Sbjct: 178 IPPPPPPMQRTPRTPGNPMFNSPRDGAYTSMPSGSSSSTAPPPPPPPPPPPPPPPPPPME 237 Query: 283 ATT-----DGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEG 125 T+ GAPG S+ + A+P +S + +S+ R ++ G Sbjct: 238 GTSVIGGPIGAPGAH-----------RNSYSGGSIHASPSSSSAGMSSSGPTRSISTG 284 [118][TOP] >UniRef100_C9S8M2 Cytokinesis protein sepA n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9S8M2_9PEZI Length = 842 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 G G PPPPPPPPPPPPPPPP P P +PGGG Sbjct: 179 GQGGAPPPPPPPPPPPPPPPPPPPMPGML--SPGGG 212 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/50 (46%), Positives = 24/50 (48%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 PP P G PPPPPPPPPPPPPPPP P + G P Sbjct: 164 PPPPPPPPPPPPPMPGQGGAPPPPPPPPPPPPPPPPPPPMPGMLSPGGGP 213 [119][TOP] >UniRef100_C8VA31 Putative uncharacterized protein n=1 Tax=Aspergillus nidulans FGSC A4 RepID=C8VA31_EMENI Length = 657 Score = 59.7 bits (143), Expect = 1e-07 Identities = 53/176 (30%), Positives = 67/176 (38%), Gaps = 31/176 (17%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP----PPPPPPP--- 299 PP P P PP P S A G+G PPPPPPPP PPPPPPP Sbjct: 494 PPMPPPPP-------PPAPGSSAPPPPPPPPPGAG--APPPPPPPPGAGAPPPPPPPPGA 544 Query: 298 --PTPPPATTDGAP---------------GGG*DSNARVR-------RKLARSWEAETTA 191 P PPP GAP GG D A +R RK+ S + + +A Sbjct: 545 GAPPPPPPPGAGAPPPPPGGAAPPLPQPSGGRNDLMAAIRASGGGGLRKVKDSEKKDRSA 604 Query: 190 ATPPASVSNVSAGTMGRGVAEGAGRGNRDGRRPHGMSMGRMGKGAG*EETREKGRW 23 A P + S +A T G G +G G ++ + +E + W Sbjct: 605 AMVPGAASESAAATPSTG---GGPQGGLAGALQDALAKRKQKVSGSDDEKDDDDDW 657 Score = 55.5 bits (132), Expect = 2e-06 Identities = 37/92 (40%), Positives = 39/92 (42%), Gaps = 27/92 (29%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPT----PHSRALARDDEVANG-----------SGDTVPPPPPPP 323 PP P P A R + PPT P AR G SG +PPPPPPP Sbjct: 444 PPPPPPVPGASRPVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPP 503 Query: 322 ------PPPPPPP------PPTPPPATTDGAP 263 PPPPPPP PP PPP GAP Sbjct: 504 APGSSAPPPPPPPPPGAGAPPPPPPPPGAGAP 535 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/81 (39%), Positives = 35/81 (43%), Gaps = 16/81 (19%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPP---------PPPPPPPPP 305 PP PR P++ PP P +R S PPPP PPPPPPPPP Sbjct: 433 PPPPPRSPASQP---PPPPPVPGASRPVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPP 489 Query: 304 -------PPPTPPPATTDGAP 263 PPP PPPA AP Sbjct: 490 ASSGPPMPPPPPPPAPGSSAP 510 [120][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 59.7 bits (143), Expect = 1e-07 Identities = 40/125 (32%), Positives = 46/125 (36%), Gaps = 8/125 (6%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP---PPPPPPPPTPP 287 PP P P PP P S L + PPPPPPPP PPPPPPPP PP Sbjct: 134 PPHTPSSPP------PPPPSSAPLPQPP----------PPPPPPPPASAPPPPPPPPPPP 177 Query: 286 PATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSA-----GTMGRGVAEGA 122 P + P D S A ++ PP ++ A T E Sbjct: 178 PISPSLPPSNPPDRGGAFTLPAIMSLTAVSSEIAPPNPITQAPATRAEKATTPTPATENI 237 Query: 121 GRGNR 107 G NR Sbjct: 238 GANNR 242 [121][TOP] >UniRef100_Q86UP3 Zinc finger homeobox protein 4 n=1 Tax=Homo sapiens RepID=ZFHX4_HUMAN Length = 3567 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/65 (43%), Positives = 30/65 (46%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P P A PP P S + + PP PPPPPPPPPPPPP PPP Sbjct: 1961 PPPPPPLPPA-----PPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPP 2015 Query: 277 TDGAP 263 P Sbjct: 2016 PSAPP 2020 [122][TOP] >UniRef100_UPI0000DB75B1 PREDICTED: similar to One cut domain family member 2 (Transcription factor ONECUT-2) (OC-2) n=1 Tax=Apis mellifera RepID=UPI0000DB75B1 Length = 770 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/68 (50%), Positives = 41/68 (60%), Gaps = 3/68 (4%) Frame = +3 Query: 264 GAPSVVAGGGVGGGG---GGGGGGGGGGGGTVSPLPLATSSSRASARLCGVGGSSNRTAD 434 G V +GGG GGGG GGGGGGGGGGGG+ ++SSS +S+ VGGSS+ Sbjct: 190 GGGGVGSGGGGGGGGSNIGGGGGGGGGGGGSGGGGGSSSSSSSSSSSSSSVGGSSSSGVG 249 Query: 435 GWRGRRGG 458 G G GG Sbjct: 250 GGGGGGGG 257 Score = 53.9 bits (128), Expect = 5e-06 Identities = 34/93 (36%), Positives = 43/93 (46%) Frame = +3 Query: 180 GGVAAVVSASQERANFRRTRALLSHPPPGAPSVVAGGGVGGGGGGGGGGGGGGGGTVSPL 359 GG + S+S ++ S G G G GGGG GGGGGGGGG S Sbjct: 222 GGGGSSSSSSSSSSSSSSVGGSSSSGVGGGGGGGGGSGGGGGGSGGGGGGGGGSSGGSSS 281 Query: 360 PLATSSSRASARLCGVGGSSNRTADGWRGRRGG 458 +TSS+ +S+ G GG + A G G GG Sbjct: 282 SSSTSSTSSSSSSGGSGGGAVGGAGGGNGNGGG 314 [123][TOP] >UniRef100_UPI000036B0E9 PREDICTED: hypothetical protein isoform 1 n=1 Tax=Pan troglodytes RepID=UPI000036B0E9 Length = 431 Score = 52.8 bits (125), Expect(2) = 1e-07 Identities = 29/56 (51%), Positives = 33/56 (58%), Gaps = 4/56 (7%) Frame = +3 Query: 231 RTRALLSHPPPGAPSVVAGGGVGGGGGG----GGGGGGGGGGTVSPLPLATSSSRA 386 R + L + PG GGG GGGGGG GGGGGGGGGG SP P + +S RA Sbjct: 137 RQTSKLKNNSPGTAEACGGGGGGGGGGGSGGSGGGGGGGGGGDKSP-PGSAASKRA 191 Score = 26.6 bits (57), Expect(2) = 1e-07 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 178 PAVWPQSSPPPKSAPTSA 231 P P SPPP +APTSA Sbjct: 82 PLSAPPGSPPPSAAPTSA 99 [124][TOP] >UniRef100_UPI0001AF754F hypothetical protein MkanA1_24970 n=1 Tax=Mycobacterium kansasii ATCC 12478 RepID=UPI0001AF754F Length = 333 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +3 Query: 255 PPPGAPSVVAGGGVGGGGGGGGGGGGGGGGTVSPL 359 PP AP AGGG GG GGGGG GGGG G P+ Sbjct: 282 PPADAPQPGAGGGGSGGSGGGGGSGGGGNGEAGPV 316 Score = 30.0 bits (66), Expect(2) = 1e-07 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +1 Query: 106 PCCPAPPLLPLPSP*CQH*RC*RWPAVWP----QSSPPPKSAPTSAAP 237 P P+PP P P P H PA P QS PPP+ P P Sbjct: 220 PQLPSPPQTPAPPPPTAHIVTPPAPAATPPPSRQSPPPPQEPPPPQEP 267 [125][TOP] >UniRef100_UPI0000DA267E Wiskott-Aldrich syndrome-like n=1 Tax=Rattus norvegicus RepID=UPI0000DA267E Length = 501 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/77 (41%), Positives = 36/77 (46%), Gaps = 9/77 (11%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPP---------PPPPPPPP 305 PP P +P V +PP P +R S + PPPPP PPPPPPPP Sbjct: 320 PPPPPSRPGVV---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPP 376 Query: 304 PPPTPPPATTDGAPGGG 254 PPP PPP G P G Sbjct: 377 PPPGPPP--PPGLPSDG 391 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/62 (43%), Positives = 31/62 (50%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P PS+ PP P + +G T PPPPPPPPPPP PPPP P+ Sbjct: 341 PPPPPALPSSAPSGPPPPPP----------LSMAGSTAPPPPPPPPPPPGPPPPPGLPSD 390 Query: 277 TD 272 D Sbjct: 391 GD 392 [126][TOP] >UniRef100_UPI0001A2BBDD hypothetical protein LOC100009637 n=1 Tax=Danio rerio RepID=UPI0001A2BBDD Length = 502 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/73 (45%), Positives = 35/73 (47%), Gaps = 7/73 (9%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPP-------PPPPPPPPPP 299 PP P +PS PP P SR A S PPPPP PPPPPPPPPP Sbjct: 324 PPPPPSRPSMGAP--PPPPPSRGHPPPPPPAPASMPPPPPPPPMSGGAAPPPPPPPPPPP 381 Query: 298 PTPPPATTDGAPG 260 PPP+ DG G Sbjct: 382 GPPPPSEMDGGHG 394 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/69 (42%), Positives = 31/69 (44%), Gaps = 10/69 (14%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPP------ 296 PP R P PP P ++ SG PPPPPPPPPPP PPPP Sbjct: 340 PPSRGHPP-------PPPPAPASMPPPPPPPPMSGGAAPPPPPPPPPPPGPPPPSEMDGG 392 Query: 295 ----TPPPA 281 TPPPA Sbjct: 393 HGESTPPPA 401 [127][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 403 PHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 P S L V NG PPPPPPPPPPPPPPP PPP + P Sbjct: 532 PPSSPLLGSSSVENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPP 578 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -1 Query: 433 SAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPP--------TPPPAT 278 S+ L+ P +P + + ++ + PPPPPPPPPPPPPPPP PPP Sbjct: 526 SSTTLVPPSSPLLGSSSVENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPP 585 Query: 277 TDGAP 263 GAP Sbjct: 586 PPGAP 590 [128][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 403 PHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 P S L V NG PPPPPPPPPPPPPPP PPP + P Sbjct: 544 PPSSPLLGSSSVENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPP 590 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -1 Query: 433 SAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPP--------TPPPAT 278 S+ L+ P +P + + ++ + PPPPPPPPPPPPPPPP PPP Sbjct: 538 SSTTLVPPSSPLLGSSSVENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPP 597 Query: 277 TDGAP 263 GAP Sbjct: 598 PPGAP 602 [129][TOP] >UniRef100_UPI000069F105 Formin-like protein 3 (Formin homology 2 domain-containing protein 3). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069F105 Length = 1108 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -1 Query: 367 ANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 A+ S PPPPPPPPPPPPPPPP PPP T P Sbjct: 603 ASASVPAPPPPPPPPPPPPPPPPPPPPPMPTGKCP 637 [130][TOP] >UniRef100_UPI0001B798A6 UPI0001B798A6 related cluster n=1 Tax=Homo sapiens RepID=UPI0001B798A6 Length = 625 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDG 269 PP P + + V NG PPPPPPPPPPPPPPP PPP G Sbjct: 67 PPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPG 114 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 LPP P + D +G PP PPPPPPPPPPPPP PPP Sbjct: 64 LPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPP 107 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/51 (43%), Positives = 27/51 (52%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 LPP+ + ++ V PPPPPPPPPPPPPPPP P + P Sbjct: 71 LPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVP 121 [131][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/58 (48%), Positives = 31/58 (53%) Frame = -1 Query: 436 PSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 PS L P P R+ + D S PPPPPPPPPPPPPPPP PPP +P Sbjct: 2381 PSVSSLPAKPRPFFRSSSLDI-----SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSP 2433 [132][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/58 (48%), Positives = 31/58 (53%) Frame = -1 Query: 436 PSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 PS L P P R+ + D S PPPPPPPPPPPPPPPP PPP +P Sbjct: 2381 PSVSSLPAKPRPFFRSSSLDI-----SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSP 2433 [133][TOP] >UniRef100_UPI00016E72E0 UPI00016E72E0 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72E0 Length = 1054 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P L + +ANG P PPPPPPPPPPPPP PPP Sbjct: 502 PPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPP 544 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/63 (42%), Positives = 30/63 (47%), Gaps = 10/63 (15%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPP----------PTPPPATTDGAP 263 PP P + LA + + PPPPPPPPPPPPPPP P PPP P Sbjct: 508 PPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAPPLP 567 Query: 262 GGG 254 G G Sbjct: 568 GCG 570 [134][TOP] >UniRef100_UPI00016E72DE UPI00016E72DE related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72DE Length = 1032 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P L + +ANG P PPPPPPPPPPPPP PPP Sbjct: 490 PPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPP 532 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/63 (42%), Positives = 30/63 (47%), Gaps = 10/63 (15%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPP----------PTPPPATTDGAP 263 PP P + LA + + PPPPPPPPPPPPPPP P PPP P Sbjct: 496 PPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAPPLP 555 Query: 262 GGG 254 G G Sbjct: 556 GCG 558 [135][TOP] >UniRef100_UPI00016E72DD UPI00016E72DD related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72DD Length = 1092 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P L + +ANG P PPPPPPPPPPPPP PPP Sbjct: 534 PPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPP 576 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/63 (42%), Positives = 30/63 (47%), Gaps = 10/63 (15%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPP----------PTPPPATTDGAP 263 PP P + LA + + PPPPPPPPPPPPPPP P PPP P Sbjct: 540 PPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAPPLP 599 Query: 262 GGG 254 G G Sbjct: 600 GCG 602 [136][TOP] >UniRef100_UPI00016E1FBE UPI00016E1FBE related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1FBE Length = 510 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/91 (37%), Positives = 39/91 (42%), Gaps = 24/91 (26%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLL----PPTPHSRALARDDEVANGSGDTVPPPPPPPP-------- 320 +S +RP Q A LL PP P+ + + A G T P PPPPPP Sbjct: 227 ISAQQRPLQSGAAHLLADTPAPPPPNCMSSPHLTDAAPTPGSTTPAPPPPPPLPPSSTLS 286 Query: 319 ------------PPPPPPPPTPPPATTDGAP 263 PPPPPPPP P PA GAP Sbjct: 287 SAAASPTSTAGHPPPPPPPPLPRPAPPPGAP 317 [137][TOP] >UniRef100_UPI0001951234 Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein). n=1 Tax=Canis lupus familiaris RepID=UPI0001951234 Length = 1045 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/73 (43%), Positives = 38/73 (52%), Gaps = 7/73 (9%) Frame = -1 Query: 460 SPPR---RPR-QPSAVRLL---LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPP 302 SPP +P+ QPS++ + PP P +L PPPPPPPPPPPPPP Sbjct: 828 SPPAVKAKPKWQPSSIPVPSPDFPPPPPESSLV------------FPPPPPPPPPPPPPP 875 Query: 301 PPTPPPATTDGAP 263 PP PPPA P Sbjct: 876 PPPPPPAPAPAPP 888 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/53 (49%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 418 LLPPTPHSRALARDDEVANGSGDTVPP-PPPPPPPPPPPPPPTPPPATTDGAP 263 L+PP L + S PP PPPPPPPPPPPPPP PPPA +P Sbjct: 657 LVPPLSPQPKLVTPHTASQPSPPLPPPHPPPPPPPPPPPPPPPPPPARAPPSP 709 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/95 (32%), Positives = 38/95 (40%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 V P P P L+ PP P PPPPPPPPPPPP P P PPP Sbjct: 845 VPSPDFPPPPPESSLVFPPPPPPPP---------------PPPPPPPPPPPPAPAPAPPP 889 Query: 283 ATTDGAPGGG*DSNARVRRKLARSWEAETTAATPP 179 T D + +K +++ + A PP Sbjct: 890 LTATPTVSPASDKSGSPGKKTSKT--SSPGAKKPP 922 [138][TOP] >UniRef100_Q4S8M8 Chromosome 2 SCAF14705, whole genome shotgun sequence n=1 Tax=Tetraodon nigroviridis RepID=Q4S8M8_TETNG Length = 415 Score = 59.3 bits (142), Expect = 1e-07 Identities = 36/93 (38%), Positives = 48/93 (51%), Gaps = 6/93 (6%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLL----PPTPHSRALARD--DEVANGSGDTVPPPPPPPPPPPPPPP 299 SPP P P+A+ + P TP +R A + ++ G + PPPPPPPPPPPPPPP Sbjct: 297 SPP--PVPPAALSVAYGSSSPLTPSARISALNIVSDLLRKVGVSPPPPPPPPPPPPPPPP 354 Query: 298 PTPPPATTDGAPGGG*DSNARVRRKLARSWEAE 200 P P + P G AR ++L + E E Sbjct: 355 PQASPPSLFTPPSAGSGVEARRLQELHQGPEGE 387 [139][TOP] >UniRef100_Q1LVV3 Novel protein n=1 Tax=Danio rerio RepID=Q1LVV3_DANRE Length = 486 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/66 (42%), Positives = 32/66 (48%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 SPP P + PP P ++ G PPPPPPPPPPP PPPP PPP Sbjct: 340 SPPSPPPFTGNAVSIPPPPPMDLSIPAPPPPPMAGG---PPPPPPPPPPPGPPPPGPPPP 396 Query: 280 TTDGAP 263 + G P Sbjct: 397 SAPGPP 402 [140][TOP] >UniRef100_C0HAJ0 Wiskott-Aldrich syndrome protein homolog n=1 Tax=Salmo salar RepID=C0HAJ0_SALSA Length = 527 Score = 59.3 bits (142), Expect = 1e-07 Identities = 41/126 (32%), Positives = 52/126 (41%), Gaps = 25/126 (19%) Frame = -1 Query: 445 PRQPSAVRLLLPPTP---HSRALARDDEVANGSGDTVPPPPPPPPPPPPPP--------- 302 P PS LPP P H R++ +A + P PPPPPPPPPPP Sbjct: 367 PPPPSVSHSSLPPPPPPGHQRSMPAPPPLAPSAPSRGGPAPPPPPPPPPPPAQSSGDFPP 426 Query: 301 -------PPTPPPATT--DGAPGGG*DSNAR----VRRKLARSWEAETTAATPPASVSNV 161 PP P PA++ DG GGG R + +L R + T + PP Sbjct: 427 PPPPCKGPPPPAPASSGGDGGGGGGGGGGGRGALLDQIRLGRKLKNVTDSPEPPPPAQED 486 Query: 160 SAGTMG 143 S G +G Sbjct: 487 SEGIVG 492 [141][TOP] >UniRef100_A2RUY4 Zgc:158395 protein n=1 Tax=Danio rerio RepID=A2RUY4_DANRE Length = 502 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/73 (45%), Positives = 35/73 (47%), Gaps = 7/73 (9%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPP-------PPPPPPPPPP 299 PP P +PS PP P SR A S PPPPP PPPPPPPPPP Sbjct: 324 PPPPPSRPSMGAP--PPPPPSRGHPPPPPPAPASMPPPPPPPPMSGGAAPPPPPPPPPPP 381 Query: 298 PTPPPATTDGAPG 260 PPP+ DG G Sbjct: 382 GPPPPSEMDGGHG 394 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/69 (42%), Positives = 31/69 (44%), Gaps = 10/69 (14%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPP------ 296 PP R P PP P ++ SG PPPPPPPPPPP PPPP Sbjct: 340 PPSRGHPP-------PPPPAPASMPPPPPPPPMSGGAAPPPPPPPPPPPGPPPPSEMDGG 392 Query: 295 ----TPPPA 281 TPPPA Sbjct: 393 HGESTPPPA 401 [142][TOP] >UniRef100_Q61078 Wiscott-Aldrich Syndrome protein homolog n=1 Tax=Mus musculus RepID=Q61078_MOUSE Length = 520 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/80 (42%), Positives = 36/80 (45%), Gaps = 12/80 (15%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDE----VANGSGDTVPPPPPPPPPPP------P 308 PP PR P PP P A R + G PPPPPPPPPPP P Sbjct: 369 PPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPPPPCPGSGP 428 Query: 307 PPPPTPPPATTDG--APGGG 254 PPP PP + G APGGG Sbjct: 429 APPPLPPTPVSGGSPAPGGG 448 [143][TOP] >UniRef100_Q117D5 Putative uncharacterized protein n=1 Tax=Trichodesmium erythraeum IMS101 RepID=Q117D5_TRIEI Length = 358 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/67 (43%), Positives = 33/67 (49%) Frame = -1 Query: 454 PRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATT 275 P+ + PS+ LP P L + A G PPPPPPPPPPPPPPPP P Sbjct: 224 PKPLKLPSSSTKQLPSLPE---LPQPSPPAQWRGPGFPPPPPPPPPPPPPPPPPPDTTIA 280 Query: 274 DGAPGGG 254 DG G Sbjct: 281 DGIEVSG 287 [144][TOP] >UniRef100_B1KJL7 Putative lipoprotein n=1 Tax=Shewanella woodyi ATCC 51908 RepID=B1KJL7_SHEWM Length = 508 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP T G G Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPETVGMSG 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 352 DTVPPPPPPPPPPPPPPPPTPPP 284 + PPPPPPPPPPPPPPPP PPP Sbjct: 35 EIAPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPP 59 [145][TOP] >UniRef100_A5V8M1 OmpA/MotB domain protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5V8M1_SPHWW Length = 373 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 GS PPPPPPPPPPPPPPPP PPP PG Sbjct: 231 GSPAAPPPPPPPPPPPPPPPPPPPPPPPVVETPG 264 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/46 (50%), Positives = 27/46 (58%) Frame = -1 Query: 400 HSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 HS L+ + + + PPPPPPPPPPPPPPPP PPP P Sbjct: 220 HSALLSLIYNIGSPAAPPPPPPPPPPPPPPPPPPPPPPPVVETPGP 265 [146][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/64 (42%), Positives = 30/64 (46%) Frame = -1 Query: 454 PRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATT 275 PR V L PP + + + PPPPPPPPPPPPPPPP PPP T Sbjct: 382 PREINLAVPVALEKPPDKRKEHVINLERTESEIFAAAPPPPPPPPPPPPPPPPPPPPPTP 441 Query: 274 DGAP 263 P Sbjct: 442 PPPP 445 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPTPPPPPP 446 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/63 (44%), Positives = 32/63 (50%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSN 164 PPPPPPPPPPPPP PP PPP P N VR +E +TPP + + Sbjct: 427 PPPPPPPPPPPPPTPPPPPPRPPSPPPVEKVTVNPIVR--------SEKRVSTPPRTGPS 478 Query: 163 VSA 155 SA Sbjct: 479 TSA 481 [147][TOP] >UniRef100_C1EC31 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EC31_9CHLO Length = 939 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/66 (42%), Positives = 35/66 (53%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 +PP P P L PP P S + S + PPPPPPP PP PPPPP+PPP+ Sbjct: 456 TPPSPPPPPQPPPLPSPPPPSSPS-------PPPSSPSPPPPPPPPSPPSPPPPPSPPPS 508 Query: 280 TTDGAP 263 + +P Sbjct: 509 SPPPSP 514 [148][TOP] >UniRef100_B9EV35 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9EV35_ORYSJ Length = 775 Score = 59.3 bits (142), Expect = 1e-07 Identities = 51/149 (34%), Positives = 63/149 (42%), Gaps = 41/149 (27%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPT--PHSRAL--------ARDDEVANGSG---DTVPPPPPPPP 320 +PP P P+ LLPPT P R+L A E S D PPP P P Sbjct: 26 TPPPTPPLPTP---LLPPTLAPLQRSLVFGRVEGEAMSSEARESSATAVDRTPPPTPRSP 82 Query: 319 PPPPPPPP-----TPPPATTDGAPGGG*DSNARVRRK-----------------LARSWE 206 PPPPPPPP TPPP++ AP GG +++ R L R Sbjct: 83 PPPPPPPPTNGTLTPPPSS---APSGGRATSSEARESPHATSVDDGGRAPPPPPLPRPTS 139 Query: 205 AETTAATPP------ASVSNVSAGTMGRG 137 A T AT P +S S+ S G++ RG Sbjct: 140 ARATPATTPSADGSSSSSSSTSGGSLPRG 168 [149][TOP] >UniRef100_Q5CS67 Signal peptide containing large protein with proline stretches n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CS67_CRYPV Length = 1884 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 T PPPPPPPPPPPPPPPP PPP+ T + G Sbjct: 1179 TPPPPPPPPPPPPPPPPPPPPPSYTSPSNG 1208 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -1 Query: 358 SGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGG 257 SG PPPPPPPPPPPPPPPP PPP + G Sbjct: 1175 SGSFTPPPPPPPPPPPPPPPPPPPPPSYTSPSNG 1208 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = -1 Query: 358 SGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVR 230 S + PPPPPPPPPPPPPPP PPP + +P G S+ R Sbjct: 1174 SSGSFTPPPPPPPPPPPPPPPPPPPPPSYTSPSNGIPSHIPTR 1216 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -1 Query: 367 ANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 + S PPPPPPPPPPPPPPPP+PPP+ Sbjct: 1540 SGSSAPPPPPPPPPPPPPPPPPPPSPPPS 1568 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = -1 Query: 367 ANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 ++GS PPPPPPPPPPPPPPPP PP + +P Sbjct: 1539 SSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPPPSP 1573 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/61 (45%), Positives = 30/61 (49%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 SPP P PS+ PP PHS PPPPPPPP PP PPP+PPP Sbjct: 1407 SPPHPP--PSSGSSAPPPPPHSPP---------------PPPPPPPPSSPPSPPPSPPPY 1449 Query: 280 T 278 T Sbjct: 1450 T 1450 [150][TOP] >UniRef100_A0E3T6 Chromosome undetermined scaffold_77, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0E3T6_PARTE Length = 1215 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/72 (45%), Positives = 37/72 (51%), Gaps = 6/72 (8%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPP------PP 299 SP + Q +A LLPP P L VPPPPPPPPPPPPP PP Sbjct: 629 SPQQVQNQATA---LLPPPPPPPPLPNTQ---------VPPPPPPPPPPPPPSKNGAPPP 676 Query: 298 PTPPPATTDGAP 263 P PPP + +GAP Sbjct: 677 PPPPPPSRNGAP 688 [151][TOP] >UniRef100_A6NG74 Putative uncharacterized protein PCLO n=2 Tax=Homo sapiens RepID=A6NG74_HUMAN Length = 5073 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/58 (48%), Positives = 31/58 (53%) Frame = -1 Query: 436 PSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 PS L P P R+ + D S PPPPPPPPPPPPPPPP PPP +P Sbjct: 2312 PSVSSLPAKPRPFFRSSSLDI-----SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSP 2364 [152][TOP] >UniRef100_Q5ASL5 Putative uncharacterized protein n=1 Tax=Emericella nidulans RepID=Q5ASL5_EMENI Length = 1186 Score = 59.3 bits (142), Expect = 1e-07 Identities = 48/138 (34%), Positives = 56/138 (40%), Gaps = 31/138 (22%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP----PPPPPPP--- 299 PP P P PP P S A G+G PPPPPPPP PPPPPPP Sbjct: 494 PPMPPPPP-------PPAPGSSAPPPPPPPPPGAG--APPPPPPPPGAGAPPPPPPPPGA 544 Query: 298 --PTPPPATTDGAP---------------GGG*DSNARVR-------RKLARSWEAETTA 191 P PPP GAP GG D A +R RK+ S + + +A Sbjct: 545 GAPPPPPPPGAGAPPPPPGGAAPPLPQPSGGRNDLMAAIRASGGGGLRKVKDSEKKDRSA 604 Query: 190 ATPPASVSNVSAGTMGRG 137 A P + S +A T G Sbjct: 605 AMVPGAASESAAATPSTG 622 Score = 55.5 bits (132), Expect = 2e-06 Identities = 37/92 (40%), Positives = 39/92 (42%), Gaps = 27/92 (29%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPT----PHSRALARDDEVANG-----------SGDTVPPPPPPP 323 PP P P A R + PPT P AR G SG +PPPPPPP Sbjct: 444 PPPPPPVPGASRPVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPP 503 Query: 322 ------PPPPPPP------PPTPPPATTDGAP 263 PPPPPPP PP PPP GAP Sbjct: 504 APGSSAPPPPPPPPPGAGAPPPPPPPPGAGAP 535 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/81 (39%), Positives = 35/81 (43%), Gaps = 16/81 (19%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPP---------PPPPPPPPP 305 PP PR P++ PP P +R S PPPP PPPPPPPPP Sbjct: 433 PPPPPRSPASQP---PPPPPVPGASRPVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPP 489 Query: 304 -------PPPTPPPATTDGAP 263 PPP PPPA AP Sbjct: 490 ASSGPPMPPPPPPPAPGSSAP 510 [153][TOP] >UniRef100_B8MSP8 Cytokinesis protein SepA/Bni1 n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8MSP8_TALSN Length = 1793 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/66 (43%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPP------PPP 302 + PP P P PP P S A+ S +PPPPPPPPPPP PPP Sbjct: 1024 IPPPPPPPPPP------PPPPSSGAIPPPPPPPPSSSGAIPPPPPPPPPPPMSAGGIPPP 1077 Query: 301 PPTPPP 284 PP PPP Sbjct: 1078 PPPPPP 1083 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/77 (40%), Positives = 34/77 (44%), Gaps = 11/77 (14%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP-------PPPPPPP 299 PP P PS+ + PP P +G PPPPPPPP PPPPPPP Sbjct: 1044 PPPPPPPPSSSGAIPPPPPPP------PPPPMSAGGIPPPPPPPPPFGMAGGIPPPPPPP 1097 Query: 298 P----TPPPATTDGAPG 260 P PPP G PG Sbjct: 1098 PMSPGVPPPPPPPGPPG 1114 [154][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP T + P Sbjct: 151 PPPPPPPPPPPPPPPPPPPPTTLEPPP 177 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATT 275 PPPPPPPPPPPPPPPP PPP TT Sbjct: 150 PPPPPPPPPPPPPPPPPPPPPTT 172 Score = 58.2 bits (139), Expect = 3e-07 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -1 Query: 355 GDTVPPPPPPPPPPPPPPPPTPPP 284 G+ PPPPPPPPPPPPPPPP PPP Sbjct: 142 GEPAPPPPPPPPPPPPPPPPPPPP 165 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/73 (42%), Positives = 40/73 (54%), Gaps = 2/73 (2%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASV-- 170 PPPPPPPPPPPPPPPP PPP T P +++ + S T++A P +SV Sbjct: 149 PPPPPPPPPPPPPPPPPPPPPPTTLEPPPPPPTSSEPPPPPSTS-ATPTSSAVPSSSVVP 207 Query: 169 SNVSAGTMGRGVA 131 S S+ G G + Sbjct: 208 SEASSTLSGSGAS 220 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 147 PPPPPPPPPPPPPPPPPPPP 166 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 148 PPPPPPPPPPPPPPPPPPPP 167 [155][TOP] >UniRef100_P70315 Wiskott-Aldrich syndrome protein homolog n=2 Tax=Mus musculus RepID=WASP_MOUSE Length = 520 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/80 (42%), Positives = 36/80 (45%), Gaps = 12/80 (15%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDE----VANGSGDTVPPPPPPPPPPP------P 308 PP PR P PP P A R + G PPPPPPPPPPP P Sbjct: 369 PPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPPPPCPGSGP 428 Query: 307 PPPPTPPPATTDG--APGGG 254 PPP PP + G APGGG Sbjct: 429 APPPLPPTPVSGGSPAPGGG 448 [156][TOP] >UniRef100_O08816 Neural Wiskott-Aldrich syndrome protein n=1 Tax=Rattus norvegicus RepID=WASL_RAT Length = 501 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/77 (41%), Positives = 36/77 (46%), Gaps = 9/77 (11%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPP---------PPPPPPPP 305 PP P +P V +PP P +R S + PPPPP PPPPPPPP Sbjct: 320 PPPPPSRPGVV---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPP 376 Query: 304 PPPTPPPATTDGAPGGG 254 PPP PPP G P G Sbjct: 377 PPPGPPP--PPGLPSDG 391 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/62 (43%), Positives = 31/62 (50%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P PS+ PP P + +G T PPPPPPPPPPP PPPP P+ Sbjct: 341 PPPPPALPSSAPSGPPPPPP----------LSMAGSTAPPPPPPPPPPPGPPPPPGLPSD 390 Query: 277 TD 272 D Sbjct: 391 GD 392 [157][TOP] >UniRef100_Q9Y6V0-2 Isoform 2 of Protein piccolo n=1 Tax=Homo sapiens RepID=Q9Y6V0-2 Length = 4866 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/58 (48%), Positives = 31/58 (53%) Frame = -1 Query: 436 PSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 PS L P P R+ + D S PPPPPPPPPPPPPPPP PPP +P Sbjct: 2312 PSVSSLPAKPRPFFRSSSLDI-----SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSP 2364 [158][TOP] >UniRef100_Q9Y6V0 Protein piccolo n=1 Tax=Homo sapiens RepID=PCLO_HUMAN Length = 5183 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/58 (48%), Positives = 31/58 (53%) Frame = -1 Query: 436 PSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 PS L P P R+ + D S PPPPPPPPPPPPPPPP PPP +P Sbjct: 2312 PSVSSLPAKPRPFFRSSSLDI-----SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSP 2364 [159][TOP] >UniRef100_Q96PY5-3 Isoform 2 of Formin-like protein 2 n=1 Tax=Homo sapiens RepID=Q96PY5-3 Length = 1092 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDG 269 PP P + + V NG PPPPPPPPPPPPPPP PPP G Sbjct: 529 PPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPG 576 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 LPP P + D +G PP PPPPPPPPPPPPP PPP Sbjct: 526 LPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPP 569 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/51 (43%), Positives = 27/51 (52%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 LPP+ + ++ V PPPPPPPPPPPPPPPP P + P Sbjct: 533 LPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVP 583 [160][TOP] >UniRef100_Q96PY5 Formin-like protein 2 n=1 Tax=Homo sapiens RepID=FMNL2_HUMAN Length = 1086 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDG 269 PP P + + V NG PPPPPPPPPPPPPPP PPP G Sbjct: 529 PPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPG 576 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 LPP P + D +G PP PPPPPPPPPPPPP PPP Sbjct: 526 LPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPP 569 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/51 (43%), Positives = 27/51 (52%) Frame = -1 Query: 415 LPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 LPP+ + ++ V PPPPPPPPPPPPPPPP P + P Sbjct: 533 LPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVP 583 [161][TOP] >UniRef100_UPI0000F2AF0B PREDICTED: similar to zinc finger protein 503, n=1 Tax=Monodelphis domestica RepID=UPI0000F2AF0B Length = 655 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/77 (44%), Positives = 37/77 (48%), Gaps = 14/77 (18%) Frame = +3 Query: 261 PGAPSVVAGGGVGGGGGGGGGGGGGGGGTVS--------------PLPLATSSSRASARL 398 PGA GGG GGGGGGGGGGGGGGGG VS P T S +SA Sbjct: 187 PGADKKEPGGGGGGGGGGGGGGGGGGGGGVSAEKSGFRVPSATCQPFTPRTGSPSSSASA 246 Query: 399 CGVGGSSNRTADGWRGR 449 C GG + G G+ Sbjct: 247 CSPGGMLPSSGGGPEGK 263 [162][TOP] >UniRef100_UPI000194CA6D PREDICTED: similar to KIAA1902 protein, partial n=1 Tax=Taeniopygia guttata RepID=UPI000194CA6D Length = 859 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/61 (49%), Positives = 32/61 (52%) Frame = -1 Query: 445 PRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGA 266 P S+V L PP P + V NG PPPPPPPPPPPPPPP P P D A Sbjct: 345 PGAASSVPLPPPPPPLPALPGSPEAVPNGPVAVPVPPPPPPPPPPPPPPPPPLP---DAA 401 Query: 265 P 263 P Sbjct: 402 P 402 [163][TOP] >UniRef100_UPI0001795F41 PREDICTED: similar to WASL protein n=1 Tax=Equus caballus RepID=UPI0001795F41 Length = 521 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/77 (40%), Positives = 36/77 (46%), Gaps = 8/77 (10%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPPPP 305 +PP P PS + +PP P +R S + PPPPPPP PPPPPP Sbjct: 337 APP--PPPPSRPGVGVPPPPPNRIYPPPPPALPSSAPSGPPPPPPPLSVAGSVAPPPPPP 394 Query: 304 PPPTPPPATTDGAPGGG 254 PPP P P G P G Sbjct: 395 PPPPPGPPPPPGLPSDG 411 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/64 (42%), Positives = 32/64 (50%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 + PP P PS+ PP P ++A G PPPPPPPPPPP PPPP P Sbjct: 358 IYPPPPPALPSSAPSGPPPPPPPLSVA---------GSVAPPPPPPPPPPPGPPPPPGLP 408 Query: 283 ATTD 272 + D Sbjct: 409 SDGD 412 [164][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/71 (43%), Positives = 32/71 (45%), Gaps = 6/71 (8%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP------PPPPPPPP 296 PP P P A PP P A G PPPPPPPP PPPPPPPP Sbjct: 234 PPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPP 293 Query: 295 TPPPATTDGAP 263 PPPA + P Sbjct: 294 PPPPAYSPPPP 304 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/68 (44%), Positives = 30/68 (44%), Gaps = 3/68 (4%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPP---PPPPPPPTPP 287 P P P A PP P A G PPPPPPPPP PPPPPPP PP Sbjct: 196 PAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPP 255 Query: 286 PATTDGAP 263 PA P Sbjct: 256 PAAYGPPP 263 [165][TOP] >UniRef100_UPI00005A2B62 PREDICTED: similar to Wiskott-Aldrich syndrome gene-like protein isoform 3 n=1 Tax=Canis lupus familiaris RepID=UPI00005A2B62 Length = 514 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/77 (40%), Positives = 36/77 (46%), Gaps = 8/77 (10%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPPPP 305 +PP P PS + +PP P +R S + PPPPPPP PPPPPP Sbjct: 330 APP--PPPPSRPGVGVPPPPPNRMYPPPPPALPSSAPSGPPPPPPPLSLTGSAAPPPPPP 387 Query: 304 PPPTPPPATTDGAPGGG 254 PPP P P G P G Sbjct: 388 PPPPPGPPPPPGLPSDG 404 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/62 (43%), Positives = 31/62 (50%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P PS+ PP P +L +G PPPPPPPPPPP PPPP P+ Sbjct: 353 PPPPPALPSSAPSGPPPPPPPLSL---------TGSAAPPPPPPPPPPPGPPPPPGLPSD 403 Query: 277 TD 272 D Sbjct: 404 GD 405 [166][TOP] >UniRef100_UPI00005A0B77 PREDICTED: similar to Vesicle-associated membrane protein 2 (VAMP-2) (Synaptobrevin 2) n=1 Tax=Canis lupus familiaris RepID=UPI00005A0B77 Length = 203 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP+ AP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPSRPPAAP 86 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -1 Query: 367 ANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 A+ S PPPPPPPPPPPPPPP PPP Sbjct: 51 ASASRSQREPPPPPPPPPPPPPPPPPPP 78 [167][TOP] >UniRef100_UPI00005A2B61 PREDICTED: similar to Wiskott-Aldrich syndrome gene-like protein isoform 1 n=1 Tax=Canis lupus familiaris RepID=UPI00005A2B61 Length = 505 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/77 (40%), Positives = 36/77 (46%), Gaps = 8/77 (10%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPPPP 305 +PP P PS + +PP P +R S + PPPPPPP PPPPPP Sbjct: 321 APP--PPPPSRPGVGVPPPPPNRMYPPPPPALPSSAPSGPPPPPPPLSLTGSAAPPPPPP 378 Query: 304 PPPTPPPATTDGAPGGG 254 PPP P P G P G Sbjct: 379 PPPPPGPPPPPGLPSDG 395 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/62 (43%), Positives = 31/62 (50%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P PS+ PP P +L +G PPPPPPPPPPP PPPP P+ Sbjct: 344 PPPPPALPSSAPSGPPPPPPPLSL---------TGSAAPPPPPPPPPPPGPPPPPGLPSD 394 Query: 277 TD 272 D Sbjct: 395 GD 396 [168][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/60 (48%), Positives = 31/60 (51%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 +PP P P LPP P A A PPPPPPPPPPPPPPPP PPP+ Sbjct: 784 TPPPPPPPPP-----LPPAPPQPAPA-----------PTPPPPPPPPPPPPPPPPPPPPS 827 [169][TOP] >UniRef100_UPI0000ECA84B hypothetical protein LOC419152 n=1 Tax=Gallus gallus RepID=UPI0000ECA84B Length = 777 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 G+G PPPPPPPPPPPPP P PPP + GAPG Sbjct: 106 GAGYLSQPPPPPPPPPPPPPQPPPPPPPSLGAPG 139 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 PPPPPPPPPPP PPPP PP G P G Sbjct: 115 PPPPPPPPPPPQPPPPPPPSLGAPGQPSTG 144 [170][TOP] >UniRef100_UPI000060FE1F hypothetical protein LOC419152 n=1 Tax=Gallus gallus RepID=UPI000060FE1F Length = 529 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 G+G PPPPPPPPPPPPP P PPP + GAPG Sbjct: 122 GAGYLSQPPPPPPPPPPPPPQPPPPPPPSLGAPG 155 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 PPPPPPPPPPP PPPP PP G P G Sbjct: 131 PPPPPPPPPPPQPPPPPPPSLGAPGQPSTG 160 [171][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATT 275 PPPPPPPPPPPPPPPP PPP TT Sbjct: 228 PPPPPPPPPPPPPPPPPPPPPTT 250 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 G+ PPPPPPPPPPPPPPPP PPP P Sbjct: 219 GAAPPPPPPPPPPPPPPPPPPPPPPPPPPPTTP 251 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PP + P Sbjct: 230 PPPPPPPPPPPPPPPPPPPTTPCNTGP 256 [172][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/57 (45%), Positives = 29/57 (50%) Frame = -1 Query: 454 PRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 P+ P P A ++PP P PPPPPPPPPPPPPPPP PPP Sbjct: 10 PKVPYTPIAPERIIPPPP-------------------PPPPPPPPPPPPPPPPPPPP 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/58 (46%), Positives = 27/58 (46%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P P PP P R PPPPPPPPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 [173][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 364 NGSGDTVPPPPPPPPPPPPPPPPTPPP 284 N G+ PPPPPPPPPPPPPPPP PPP Sbjct: 218 NFGGEAPPPPPPPPPPPPPPPPPPPPP 244 Score = 57.4 bits (137), Expect = 5e-07 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATT 275 PPPPPPPPPPPPPPPP PPP T Sbjct: 235 PPPPPPPPPPPPPPPPPPPPCNT 257 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP + P Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPCNTGP 259 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPP 284 G PPPPPPPPPPPPPPPP PPP Sbjct: 221 GEAPPPPPPPPPPPPPPPPPPPPPPP 246 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 228 PPPPPPPPPPPPPPPPPPPP 247 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 229 PPPPPPPPPPPPPPPPPPPP 248 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 230 PPPPPPPPPPPPPPPPPPPP 249 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 231 PPPPPPPPPPPPPPPPPPPP 250 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 232 PPPPPPPPPPPPPPPPPPPP 251 [174][TOP] >UniRef100_C1N0Z7 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N0Z7_9CHLO Length = 1128 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/80 (43%), Positives = 38/80 (47%), Gaps = 15/80 (18%) Frame = -1 Query: 457 PPR----RPRQPSAVRLLLPPTPHSRALARDDEVANG-----SGDTVPPPPPPPPPP--- 314 PPR P+ P + PP P ALA SG PPPPPPPPPP Sbjct: 398 PPRGGLGNPQPPPSGGAKRPPPPPLGALANPPPPPPPPPPPPSGLARPPPPPPPPPPGGL 457 Query: 313 ---PPPPPPTPPPATTDGAP 263 PPPPPP PPP+ GAP Sbjct: 458 AKPPPPPPPPPPPSRLGGAP 477 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/73 (43%), Positives = 34/73 (46%), Gaps = 5/73 (6%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPP-----PPPPP 296 +PP P P L P P S R G+ PPPPPPPPPPP PPPPP Sbjct: 390 TPPPAPPPPPRGGLGNPQPPPSGGAKRPPPPPLGALANPPPPPPPPPPPPSGLARPPPPP 449 Query: 295 TPPPATTDGAPGG 257 PPP PGG Sbjct: 450 PPPP------PGG 456 [175][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/67 (44%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPT-PHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 SPPR P +P PPT P + A PPPPPPPPPPP PPPP+PPP Sbjct: 1179 SPPRAPSEPGRP----PPTAPSPPPPGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPP 1234 Query: 283 ATTDGAP 263 P Sbjct: 1235 PPPSPPP 1241 [176][TOP] >UniRef100_B9S1L1 DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9S1L1_RICCO Length = 820 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/71 (42%), Positives = 33/71 (46%), Gaps = 6/71 (8%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPP------PP 296 PP PRQPS+ L P P ++N PPPPPPPPPP P PP Sbjct: 671 PPLPPRQPSSANSLTEPPPPPPLPPSGRNLSNAPRPPAPPPPPPPPPPSSGPLPSTSIPP 730 Query: 295 TPPPATTDGAP 263 PPPA AP Sbjct: 731 PPPPAPIHPAP 741 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/50 (52%), Positives = 30/50 (60%) Frame = -1 Query: 433 SAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 +A R+ PP P + N S + PPPPPPPPPPPPPPPP PPP Sbjct: 568 TAKRVPQPPPPPN---------FNKSVSSSPPPPPPPPPPPPPPPPLPPP 608 [177][TOP] >UniRef100_Q4WCV2 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus fumigatus RepID=Q4WCV2_ASPFU Length = 643 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/78 (41%), Positives = 36/78 (46%), Gaps = 13/78 (16%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPP--- 311 PP PR P+ L P PH A + + VPPPPPPP PPPP Sbjct: 410 PPPPPRSPATPPQLPPKVPHVPTSAAGPPPPPPARNPVPPPPPPPVPAASRPTPPPPVTS 469 Query: 310 --PPPPPTPPPATTDGAP 263 PPPPP PPP +T P Sbjct: 470 AVPPPPPPPPPPSTSVPP 487 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/71 (43%), Positives = 36/71 (50%), Gaps = 4/71 (5%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPP----PPPPPPP 296 V PP P P+A R PP P + A+ +VPP PPPPPP PP PPPP Sbjct: 447 VPPPPPPPVPAASRPT-PPPPVTSAVPPPPPPPPPPSTSVPPSPPPPPPVSSGPPAPPPP 505 Query: 295 TPPPATTDGAP 263 PPP + G P Sbjct: 506 PPPPPSIGGPP 516 Score = 55.8 bits (133), Expect = 1e-06 Identities = 49/170 (28%), Positives = 65/170 (38%), Gaps = 24/170 (14%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP------PPPPPPP 299 SPP P S PP P ++ PPPPPPPP PPPPPPP Sbjct: 488 SPPPPPPVSSGPPAPPPPPPPPPSIGGP-----------PPPPPPPPAPGGSAPPPPPPP 536 Query: 298 -----PTPPPATTDGAP------GGG*DSNARVR-------RKLARSWEAETTAATPPAS 173 P PPP + AP GG D A +R RK+ S + + +AA P S Sbjct: 537 PGAGAPPPPPPASGAAPPLPKPTGGREDLLAAIRASGGGGLRKVKDSEKRDRSAALVPGS 596 Query: 172 VSNVSAGTMGRGVAEGAGRGNRDGRRPHGMSMGRMGKGAG*EETREKGRW 23 + +A G GA +G G ++ + +E + W Sbjct: 597 ATESTAPAPSSG---GAAQGGLAGALQDALAKRKQKVSGSDDEKDDDDDW 643 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/70 (44%), Positives = 33/70 (47%), Gaps = 5/70 (7%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPP-----PPPPPT 293 PP P PS PP P V++G PP PPPPPPPP PPPPP Sbjct: 474 PPPPPPPPSTSVPPSPPPP--------PPVSSG-----PPAPPPPPPPPPSIGGPPPPPP 520 Query: 292 PPPATTDGAP 263 PPPA AP Sbjct: 521 PPPAPGGSAP 530 [178][TOP] >UniRef100_Q0CGJ5 Putative uncharacterized protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CGJ5_ASPTN Length = 600 Score = 58.9 bits (141), Expect = 2e-07 Identities = 50/170 (29%), Positives = 64/170 (37%), Gaps = 24/170 (14%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP----PPPPPPP-- 299 S P P PS+ PP P S G PPPPPPPP PPPPPPP Sbjct: 434 SVPPPPPPPSSHIPPPPPPPSSTGPTAPPPPPPAPGGGAPPPPPPPPGAGAPPPPPPPGA 493 Query: 298 --PTPPPATTDGAP------GGG*DSNARVR----------RKLARSWEAETTAATPPAS 173 P PPP AP GG D A +R RK+ + + + +AA P Sbjct: 494 GAPPPPPPPGGAAPPLPKPAGGRDDLMAAIRASGGAGAGGLRKVRDTEKRDRSAAMVPGG 553 Query: 172 VSNVSAGTMGRGVAEGAGRGNRDGRRPHGMSMGRMGKGAG*EETREKGRW 23 + SA T G G +G G ++ + +E + W Sbjct: 554 ANESSAPTPSSG---GGPQGGLAGALQDALAKRKQKVSGSDDEKDDDDDW 600 [179][TOP] >UniRef100_C5FD36 Proline-rich protein LAS17 n=1 Tax=Microsporum canis CBS 113480 RepID=C5FD36_NANOT Length = 633 Score = 58.9 bits (141), Expect = 2e-07 Identities = 37/119 (31%), Positives = 53/119 (44%), Gaps = 16/119 (13%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP---------PPPPPP 305 PP P ++ PP P ++ G PPPPPPP PPPPPP Sbjct: 489 PPLPPTNTASAPAAPPPPPPPPPMS--------GGPPAPPPPPPPLPVSGGPPAPPPPPP 540 Query: 304 PPPTPPPATTDGAPGGG*DSNARVR-------RKLARSWEAETTAATPPASVSNVSAGT 149 PPP + GAP G D A +R RK++ + + + +AA P S ++ S+ + Sbjct: 541 PPPGGSMPSLPGAPPGKDDLMASIRASSGRGLRKVSEAEKRDRSAAIVPGSAADTSSAS 599 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/72 (40%), Positives = 32/72 (44%), Gaps = 5/72 (6%) Frame = -1 Query: 463 VSPPRRPRQPS--AVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPP---PPPPP 299 VS P P P + +PP P L + S PPPPPPPPP PP PP Sbjct: 464 VSAPSHPAPPPLPTINAPVPPPPPPPPLPPTN---TASAPAAPPPPPPPPPMSGGPPAPP 520 Query: 298 PTPPPATTDGAP 263 P PPP G P Sbjct: 521 PPPPPLPVSGGP 532 [180][TOP] >UniRef100_B5DME8 GA28837 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DME8_DROPS Length = 686 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/57 (54%), Positives = 35/57 (61%) Frame = +3 Query: 249 SHPPPGAPSVVAGGGVGGGGGGGGGGGGGGGGTVSPLPLATSSSRASARLCGVGGSS 419 S P PGA S GGG G GGGGGGGGGGGGG PL A ++S + G+ GSS Sbjct: 198 SEPDPGAASA-GGGGAGSGGGGGGGGGGGGGPNGGPLVAADAAS-----IAGINGSS 248 [181][TOP] >UniRef100_UPI000194BDE1 PREDICTED: zinc finger homeodomain 4 n=1 Tax=Taeniopygia guttata RepID=UPI000194BDE1 Length = 3535 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -1 Query: 370 VANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGA 266 ++ S +T PPPPPPPPPPPPPPPPTP ++ GA Sbjct: 1981 ISPSSPETPPPPPPPPPPPPPPPPPTPSQPSSAGA 2015 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 T PPPPPPPPPPPPPPPP PPP + G Sbjct: 3067 TPPPPPPPPPPPPPPPPPPPPPPPSSSLSG 3096 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGG 257 PPPPPPPPPPPPPPPP PPP + G Sbjct: 3068 PPPPPPPPPPPPPPPPPPPPPPPSSSLSG 3096 [182][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP + AP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPRVSTPAP 104 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/64 (43%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPT--PHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPP 287 SPP PS PP+ P + +L ++ S PPPPPPP PPPPPPPP+ P Sbjct: 450 SPPSSTPSPSPSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQP 509 Query: 286 PATT 275 P T+ Sbjct: 510 PPTS 513 [183][TOP] >UniRef100_UPI00004296C7 SET binding protein 1 n=2 Tax=Mus musculus RepID=UPI00004296C7 Length = 1582 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/69 (44%), Positives = 39/69 (56%), Gaps = 2/69 (2%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRA-LARDDEVANGSGDTVPPPPPPPPP-PPPPPPPTPPP 284 P +R ++PS L L P A +A + V + + + P PPPPPPP PPPPPPP PPP Sbjct: 1471 PSKRGQKPSLSPLALEPASGQDAVMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPPPPP 1530 Query: 283 ATTDGAPGG 257 A GG Sbjct: 1531 PLPKTARGG 1539 [184][TOP] >UniRef100_UPI0001A2BF4C Hypothetical protein. n=1 Tax=Danio rerio RepID=UPI0001A2BF4C Length = 354 Score = 58.5 bits (140), Expect = 2e-07 Identities = 44/128 (34%), Positives = 53/128 (41%), Gaps = 20/128 (15%) Frame = -1 Query: 424 RLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP------ 263 R PP P S A A+G PPPP PPP P PPPPP PPP + GAP Sbjct: 104 RASAPPPPPS---APPPAPASGP----PPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPP 156 Query: 262 -----------GGG*D---SNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEG 125 GGG D ++A KL + + ++ P AS S+ G G G Sbjct: 157 SGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAASASSGGGGGGSSGGGGG 216 Query: 124 AGRGNRDG 101 G G G Sbjct: 217 GGGGGGGG 224 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 36/88 (40%), Positives = 39/88 (44%), Gaps = 20/88 (22%) Frame = +3 Query: 255 PPPGAPSVVAGGGV---------GGGGGGGGGGGGGGGGTVSPLPLAT-----------S 374 PPP P +GGG GGGGGGGGGGGGG GG S L A Sbjct: 136 PPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGP 195 Query: 375 SSRASARLCGVGGSSNRTADGWRGRRGG 458 + ASA G GG S+ G G GG Sbjct: 196 APAASASSGGGGGGSSGGGGGGGGGGGG 223 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 80 RHAVGSPPVPVAPPRPFCHSPP 145 R A PP P APP PP Sbjct: 103 RRASAPPPPPSAPPPAPASGPP 124 Score = 53.1 bits (126), Expect = 9e-06 Identities = 42/120 (35%), Positives = 50/120 (41%), Gaps = 7/120 (5%) Frame = +3 Query: 6 SPPPNHHLPFSLVSSHPAPLPIRPIDMPWGLRPSLLPRPAPSATPLPIVPALTLLTLAGG 185 +PPP P +S P P P P P P P P PS P P GG Sbjct: 107 APPPPPSAPPPAPASGPPPPPGPP---PAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGG 163 Query: 186 VAAV-------VSASQERANFRRTRALLSHPPPGAPSVVAGGGVGGGGGGGGGGGGGGGG 344 ++++ A R+ S P A S +GGG GG GGGGGGGGGGGG Sbjct: 164 GGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAASASSGGGGGGSSGGGGGGGGGGGG 223 [185][TOP] >UniRef100_UPI000184A096 Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Canis lupus familiaris RepID=UPI000184A096 Length = 3623 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/66 (39%), Positives = 29/66 (43%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 +PP P P PP P + G+ PPP PPPPPPPPPPP PPP Sbjct: 2009 TPPPPPPPPPPPLPAAPPQPPPLGPGKLPSAGAGAAPLQAPPPTPPPPPPPPPPPPPPPP 2068 Query: 280 TTDGAP 263 P Sbjct: 2069 PPSAPP 2074 [186][TOP] >UniRef100_Q5ZK52 Putative uncharacterized protein n=1 Tax=Gallus gallus RepID=Q5ZK52_CHICK Length = 576 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 G+G PPPPPPPPPPPPP P PPP GAPG Sbjct: 169 GAGYLSQPPPPPPPPPPPPPQPPPPPPPNLGAPG 202 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 PPPPPPPPPPP PPPP PP G P G Sbjct: 178 PPPPPPPPPPPQPPPPPPPNLGAPGQPSTG 207 [187][TOP] >UniRef100_Q4TB69 Chromosome 11 SCAF7190, whole genome shotgun sequence n=1 Tax=Tetraodon nigroviridis RepID=Q4TB69_TETNG Length = 452 Score = 58.5 bits (140), Expect = 2e-07 Identities = 44/137 (32%), Positives = 50/137 (36%), Gaps = 3/137 (2%) Frame = -1 Query: 409 PTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVR 230 P SR+LA + S PPP PPPPPPPPPPPP P P T Sbjct: 333 PLRPSRSLALMRQKRRMSSPPPPPPLPPPPPPPPPPPPPPRPPT---------------- 376 Query: 229 RKLARSWEAETTAATPPASVSNVSAGTMGRGVAEGAGRG---NRDGRRPHGMSMGRMGKG 59 PP + + A T G G GRG R GR G + G +G Sbjct: 377 --------------CPPTAAARAPARTADAGERGGEGRGRRRRRAGRGGTGANWGIRRRG 422 Query: 58 AG*EETREKGRWWLGGG 8 G GR GG Sbjct: 423 GGRRGEVRAGREDRTGG 439 [188][TOP] >UniRef100_A4QN64 Zgc:162320 protein n=1 Tax=Danio rerio RepID=A4QN64_DANRE Length = 412 Score = 58.5 bits (140), Expect = 2e-07 Identities = 44/128 (34%), Positives = 53/128 (41%), Gaps = 20/128 (15%) Frame = -1 Query: 424 RLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP------ 263 R PP P S A A+G PPPP PPP P PPPPP PPP + GAP Sbjct: 162 RASAPPPPPS---APPPAPASGP----PPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPP 214 Query: 262 -----------GGG*D---SNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEG 125 GGG D ++A KL + + ++ P AS S+ G G G Sbjct: 215 SGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAASASSGGGGGGSSGGGGG 274 Query: 124 AGRGNRDG 101 G G G Sbjct: 275 GGGGGGGG 282 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 36/88 (40%), Positives = 39/88 (44%), Gaps = 20/88 (22%) Frame = +3 Query: 255 PPPGAPSVVAGGGV---------GGGGGGGGGGGGGGGGTVSPLPLAT-----------S 374 PPP P +GGG GGGGGGGGGGGGG GG S L A Sbjct: 194 PPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGP 253 Query: 375 SSRASARLCGVGGSSNRTADGWRGRRGG 458 + ASA G GG S+ G G GG Sbjct: 254 APAASASSGGGGGGSSGGGGGGGGGGGG 281 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 80 RHAVGSPPVPVAPPRPFCHSPP 145 R A PP P APP PP Sbjct: 161 RRASAPPPPPSAPPPAPASGPP 182 Score = 53.1 bits (126), Expect = 9e-06 Identities = 42/120 (35%), Positives = 50/120 (41%), Gaps = 7/120 (5%) Frame = +3 Query: 6 SPPPNHHLPFSLVSSHPAPLPIRPIDMPWGLRPSLLPRPAPSATPLPIVPALTLLTLAGG 185 +PPP P +S P P P P P P P P PS P P GG Sbjct: 165 APPPPPSAPPPAPASGPPPPPGPP---PAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGG 221 Query: 186 VAAV-------VSASQERANFRRTRALLSHPPPGAPSVVAGGGVGGGGGGGGGGGGGGGG 344 ++++ A R+ S P A S +GGG GG GGGGGGGGGGGG Sbjct: 222 GGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAASASSGGGGGGSSGGGGGGGGGGGG 281 [189][TOP] >UniRef100_B9EK88 Zinc finger protein 318 n=1 Tax=Mus musculus RepID=B9EK88_MOUSE Length = 2025 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/71 (42%), Positives = 36/71 (50%), Gaps = 20/71 (28%) Frame = -1 Query: 433 SAVRLLLPPTPHSRALARDDEVANGSGDT--------------------VPPPPPPPPPP 314 S+ LLLPP S+A ++ V GS + +PPPPPPPPPP Sbjct: 1208 SSSDLLLPPDIISKAFGGEEVVLKGSPEEKVELAEKNEPSQVPEQMLALLPPPPPPPPPP 1267 Query: 313 PPPPPPTPPPA 281 PPPPPP PP A Sbjct: 1268 PPPPPPPPPQA 1278 [190][TOP] >UniRef100_B0V2M3 Zinc finger protein 318 n=3 Tax=Mus musculus RepID=B0V2M3_MOUSE Length = 2237 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/71 (42%), Positives = 36/71 (50%), Gaps = 20/71 (28%) Frame = -1 Query: 433 SAVRLLLPPTPHSRALARDDEVANGSGDT--------------------VPPPPPPPPPP 314 S+ LLLPP S+A ++ V GS + +PPPPPPPPPP Sbjct: 1420 SSSDLLLPPDIISKAFGGEEVVLKGSPEEKVELAEKNEPSQVPEQMLALLPPPPPPPPPP 1479 Query: 313 PPPPPPTPPPA 281 PPPPPP PP A Sbjct: 1480 PPPPPPPPPQA 1490 [191][TOP] >UniRef100_Q1NB62 OmpA/MotB n=1 Tax=Sphingomonas sp. SKA58 RepID=Q1NB62_9SPHN Length = 358 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAPG 260 G+ + PPPPPPPPPPPPPPP PPP + PG Sbjct: 213 GAPEEAAPPPPPPPPPPPPPPPPPPPPVAECQPG 246 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PP A P Sbjct: 221 PPPPPPPPPPPPPPPPPPPVAECQPGP 247 [192][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/55 (49%), Positives = 30/55 (54%), Gaps = 8/55 (14%) Frame = -1 Query: 424 RLLLPPTPHSRALARDDEVAN--------GSGDTVPPPPPPPPPPPPPPPPTPPP 284 R LP P R+LA ++ G PPPPPPPPPPPPPPPP PPP Sbjct: 344 RNCLPSRPMQRSLAECKSFSSYPIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPP 398 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPP 402 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPP 403 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPP 404 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPP 405 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPP 406 [193][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/66 (45%), Positives = 34/66 (51%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 SPP P PS LL P P S R + + PPPP PPPPP PPPPP+PPP Sbjct: 495 SPPFVPPPPSP--LLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 552 Query: 280 TTDGAP 263 + P Sbjct: 553 PSPPPP 558 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/66 (42%), Positives = 30/66 (45%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPA 281 SPP P PS PP P S PPPP PPPPP PPPPP+PPP Sbjct: 521 SPPSPPPPPSPPPPPSPPPPPSP----------------PPPPSPPPPPSPPPPPSPPPP 564 Query: 280 TTDGAP 263 + P Sbjct: 565 PSPPPP 570 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/64 (42%), Positives = 29/64 (45%) Frame = -1 Query: 454 PRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPATT 275 P RP PS PP P S PPPP PPPPP PPPPP+PPP + Sbjct: 517 PPRPSPPSPPPPPSPPPPPSP----------------PPPPSPPPPPSPPPPPSPPPPPS 560 Query: 274 DGAP 263 P Sbjct: 561 PPPP 564 [194][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/58 (48%), Positives = 28/58 (48%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P PS PP P S PPPPPPPPPPPPPPPP PPP Sbjct: 215 PPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/58 (46%), Positives = 28/58 (48%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P P + LPP P PPPPPPPPPPPPPPPP PPP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/58 (44%), Positives = 29/58 (50%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P P PP+P + + PPPPPPPPPPPPPPPP PPP Sbjct: 211 PPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/65 (43%), Positives = 30/65 (46%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P P LPP+P PPPPPPPPPPPPPPPP PPP Sbjct: 661 PPPPPPPPPPPPPPLPPSP----------------PPPPPPPPPPPPPPPPPPPPPPPHP 704 Query: 277 TDGAP 263 +P Sbjct: 705 PPPSP 709 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 SPP P PS L PP P PPPPPPPPPPPPPPPP PPP Sbjct: 228 SPP--PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP +P Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP P Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP P P + PP P PPPPPPPPPPPPPPPP PPP Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP P Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPP 288 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPP 289 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPP 290 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPP 291 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPP 292 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPP 293 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPP 294 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPP 295 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPP 296 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPP 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPP 298 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPP 299 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPP 300 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPP 301 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPP 302 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPP 303 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPP 304 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPP 305 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPP 306 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPP 307 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPP 308 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPP 309 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPP 310 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPP 311 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPP 312 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPP 313 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPP 314 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPP 315 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPP 316 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPP 317 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPP 318 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPP 319 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPP 320 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPP 321 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPP 322 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPP 323 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPP 324 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPP 325 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPP 326 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPP 327 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPP 328 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPP 329 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPP 330 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPP 331 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPP 332 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPP 333 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPP 334 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPP 335 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPP 336 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPP 337 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPP 338 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPP 339 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPP 340 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPP 341 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPP 342 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPP 343 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPP 344 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPP 345 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPP 346 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPP 347 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPP 348 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPP 349 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPP 350 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPP 351 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPP 352 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPP 353 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPP 354 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPP 355 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPP 356 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPP 357 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPP 358 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPP 359 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPP 360 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPP 361 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPP 362 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPP 363 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPP 364 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPP 365 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPP 366 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPP 367 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPP 368 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPP 369 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPP 370 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPP 371 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPP 372 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPP 373 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPP 374 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPP 375 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPP 376 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPP 377 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPP 378 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPP 379 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPP 380 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPP 381 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPP 382 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPP 383 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPP 384 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPP 385 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPP 386 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPP 387 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPP 388 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPP 389 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPP 390 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPP 391 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPP 392 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPP 393 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPP 394 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPP 395 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPP 396 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPP 397 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPP 398 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPP 399 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPP 400 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPP 401 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPP 402 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPP 403 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPP 404 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPP 405 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPP 406 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPP 407 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPP 408 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPP 409 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPP 410 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPP 411 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPP 412 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPP 413 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPP 414 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPP 415 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPP 416 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPP 417 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPP 418 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPP 419 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPP 420 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPP 421 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPP 422 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPP 423 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPP 424 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPP 425 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPP 426 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPP 427 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPP 428 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPP 429 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPP 430 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPP 431 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPP 432 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPP 433 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPP 434 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPP 435 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPP 436 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPP 437 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPP 438 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPP 439 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPP 440 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPP 441 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPP 442 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPP 443 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPP 444 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPP 445 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPP 446 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPP 447 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPP 448 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPP 449 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPP 450 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPP 451 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPP 452 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPP 453 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPP 454 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPP 455 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPP 456 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPP 457 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPP 458 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPP 459 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPP 460 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPP 461 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPP 462 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPP 463 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPP 464 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPP 465 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPP 466 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPP 467 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPP 468 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPP 469 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPP 470 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPP 471 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPP 472 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPP 473 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPP 474 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPP 475 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPP 476 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPP 477 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPP 478 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPP 479 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPP 480 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPP 481 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPP 482 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPP 483 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPP 484 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPP 485 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPP 486 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPP 487 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPP 488 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPP 489 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPP 490 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPP 491 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPP 492 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPP 493 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPP 494 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPP 495 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPP 496 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPP 497 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPP 498 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPP 499 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPP 500 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPP 501 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPP 502 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPP 503 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPP 504 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPP 505 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPP 506 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPP 507 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPP 508 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPP 509 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPP 510 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPP 511 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPP 512 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPP 513 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPP 514 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPP 515 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPP 516 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPP 517 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPP 518 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPP 519 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPP 520 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPP 521 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPP 522 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPP 523 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPP 524 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPP 525 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPP 526 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPP 527 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPP 528 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPP 529 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPP 530 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPP 531 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPP 532 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPP 533 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPP 534 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPP 535 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPP 536 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPP 537 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPP 538 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPP 539 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPP 540 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPP 541 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPP 542 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPP 543 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPP 544 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPP 545 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPP 546 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPP 547 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPP 548 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPP 549 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPP 550 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPP 551 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPP 552 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPP 553 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPP 554 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPP 555 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPP 556 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPP 557 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPP 558 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPP 559 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPP 560 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPP 561 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPP 562 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPP 563 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPP 564 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPP 565 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPP 566 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPP 567 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPP 568 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPP 569 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPP 570 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPP 571 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPP 572 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPP 573 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPP 574 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPP 575 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPP 576 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPP 577 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPP 578 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPP 579 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPP 580 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPP 581 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPP 582 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPP 583 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPP 584 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPP 585 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPP 586 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPP 587 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPP 588 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPP 589 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPP 590 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPP 591 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPP 592 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPP 593 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPP 594 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPP 595 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPP 596 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPP 597 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPP 598 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPP 599 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPP 600 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPP 601 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPP 602 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPP 603 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPP 604 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPP 605 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPP 606 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPP 607 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPP 608 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPP 609 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPP 610 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPP 611 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPP 612 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPP 613 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPP 614 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPP 615 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPP 616 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPP 617 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPP 618 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPP 619 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPP 620 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPP 621 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPP 622 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPP 623 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPP 624 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPP 625 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPP 626 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPP 627 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPP 628 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPP 629 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPP 630 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPP 631 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPP 632 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPP 633 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPP 634 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPP 635 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPP 636 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPP 637 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPP 638 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPP 639 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPP 640 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPP 641 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPP 642 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPP 643 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPP 644 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPP 645 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPP 646 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPP 647 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPP 648 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPP 649 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPP 650 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPP 651 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPP 652 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPP 653 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPP 654 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPP 655 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPP 656 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPP 657 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPP 658 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPP 659 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPP 660 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPP 661 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPP 662 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPP 663 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPP 664 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPP 665 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 647 PPPPPPPPPPPPPPPPPPPP 666 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 648 PPPPPPPPPPPPPPPPPPPP 667 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 649 PPPPPPPPPPPPPPPPPPPP 668 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 650 PPPPPPPPPPPPPPPPPPPP 669 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 651 PPPPPPPPPPPPPPPPPPPP 670 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 652 PPPPPPPPPPPPPPPPPPPP 671 [195][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/59 (45%), Positives = 31/59 (52%), Gaps = 6/59 (10%) Frame = -1 Query: 442 RQPSAVRLLLPPTPHSRALARDDEVANGSGD------TVPPPPPPPPPPPPPPPPTPPP 284 RQ + L +P R + V N + PPPPPPPPPPPPPPPPTPPP Sbjct: 394 RQVREINLAVPAALEKPPEKRKEHVINLQRSETEIFASTPPPPPPPPPPPPPPPPTPPP 452 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = -1 Query: 400 HSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 H L R + S PPPPPPPPPPPPP PP PPP Sbjct: 417 HVINLQRSETEIFASTPPPPPPPPPPPPPPPPTPPPPPP 455 [196][TOP] >UniRef100_C5Y9W0 Putative uncharacterized protein Sb06g019060 n=1 Tax=Sorghum bicolor RepID=C5Y9W0_SORBI Length = 852 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = -1 Query: 400 HSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 H++ + + A S T PPPPPPPPPPPPPPPP PPP Sbjct: 353 HAKEAGAETDAA--SRKTAPPPPPPPPPPPPPPPPPPPP 389 [197][TOP] >UniRef100_A9TWA3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWA3_PHYPA Length = 2209 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/73 (43%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPP----PT 293 +PPRRP P LPP+ G + PPPPPPPPPPPPPPP P Sbjct: 1562 APPRRPPPP------LPPSL--------------PGKSAPPPPPPPPPPPPPPPGRSAPP 1601 Query: 292 PPPATTDGAPGGG 254 PPP P GG Sbjct: 1602 PPPPPPPPLPLGG 1614 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 13/80 (16%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP--------PPPPPP 302 PP P P R PP P RA G PPPPPPPP PPPPPP Sbjct: 1604 PPPPPPLPLGGRAAPPPPPGGRAAPPPPP----GGRAAPPPPPPPPLPPGGRAAPPPPPP 1659 Query: 301 PPTPP-----PATTDGAPGG 257 PP PP P PGG Sbjct: 1660 PPLPPGGRAAPPPPPPPPGG 1679 Score = 53.1 bits (126), Expect = 9e-06 Identities = 33/77 (42%), Positives = 33/77 (42%), Gaps = 12/77 (15%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP------PPPPPP-- 302 PP P A PP P RA G G PPPPPPPP PPPPPP Sbjct: 1659 PPPLPPGGRAAPPPPPPPPGGRAAPPPPPPPGGRG--APPPPPPPPGGRGVAPPPPPPPG 1716 Query: 301 ----PPTPPPATTDGAP 263 PP PPP GAP Sbjct: 1717 GRGAPPPPPPPGGRGAP 1733 [198][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/53 (50%), Positives = 29/53 (54%) Frame = -1 Query: 442 RQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 RQP +V L P EV + PPPPPPPPPPPPPPPP PPP Sbjct: 14 RQPPSVPFLWEEKPGIPKKDWKPEVTAVNPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPP 74 [199][TOP] >UniRef100_Q9BL72 Frl (Formin related gene in leukocytes) homolog protein 1, partially confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=Q9BL72_CAEEL Length = 1115 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/90 (40%), Positives = 45/90 (50%), Gaps = 12/90 (13%) Frame = -1 Query: 454 PRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPPPPPP 299 P RP P V + PP P + LA ANG+ +PPPPPPP PPPPPPPP Sbjct: 530 PPRPAPPP-VSSIPPPPPIAGLLA-----ANGTNVPIPPPPPPPLPQNLSGAPPPPPPPP 583 Query: 298 P----TPPPATTDGAPGGG*DSNARVRRKL 221 P PPP G G ++A+ +K+ Sbjct: 584 PMLGGPPPPPPPPGGLMGPASNDAKTIKKI 613 [200][TOP] >UniRef100_B4QT65 GD21099 n=1 Tax=Drosophila simulans RepID=B4QT65_DROSI Length = 360 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 340 PPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPP PPP G PG Sbjct: 141 PPPPPPPPPPPPPPPPPPPPPPPGVPG 167 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP G P Sbjct: 143 PPPPPPPPPPPPPPPPPPPPPGVPGNP 169 [201][TOP] >UniRef100_B4N832 GK11982 n=1 Tax=Drosophila willistoni RepID=B4N832_DROWI Length = 503 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = -1 Query: 397 SRALARDDEVANGSGDTVPPP---PPPPPPPPPPPPPTPPPATTDGAPGGG 254 +RA +D++A+ T PP PPPPPPPPPPPPP P PA + PG G Sbjct: 361 TRADRAEDQLAHYQQTTAAPPSPHPPPPPPPPPPPPPPPLPALSRAGPGAG 411 [202][TOP] >UniRef100_Q2HG22 Putative uncharacterized protein n=1 Tax=Chaetomium globosum RepID=Q2HG22_CHAGB Length = 441 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%), Gaps = 4/34 (11%) Frame = -1 Query: 343 PPPPPPPPPP----PPPPPPTPPPATTDGAPGGG 254 PPPPPPPPPP PPPPPP PPPA APG G Sbjct: 4 PPPPPPPPPPGFGGPPPPPPPPPPAAAAAAPGRG 37 [203][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/55 (47%), Positives = 29/55 (52%) Frame = -1 Query: 448 RPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 R + P + PP P + G G PPPPPPPPPPPPPPPP PPP Sbjct: 242 RGKDPIQEGIRPPPPPPGDPF----QEITGPGPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPP 294 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPP 295 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPP 296 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPP 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPP 298 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPP 299 [204][TOP] >UniRef100_A2R4H0 Function: sepA function in A. nidulans requires a preceding mitosis n=1 Tax=Aspergillus niger CBS 513.88 RepID=A2R4H0_ASPNC Length = 1811 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/71 (43%), Positives = 33/71 (46%), Gaps = 6/71 (8%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPP------PPPPP 296 PP P P AV + PP P G +PPPPPPPPPPP PPPPP Sbjct: 1029 PPPPPPPPGAVGIPPPPPP-------PPPPPPGGAVGIPPPPPPPPPPPGGKVGIPPPPP 1081 Query: 295 TPPPATTDGAP 263 PPP G P Sbjct: 1082 PPPPPGGAGFP 1092 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/41 (58%), Positives = 25/41 (60%), Gaps = 5/41 (12%) Frame = -1 Query: 367 ANGSGDTVPPPPPPPPPPP-----PPPPPTPPPATTDGAPG 260 A G+ PPPPPPPPPPP PPPPP PPP GA G Sbjct: 1018 AKGAPAPPPPPPPPPPPPPGAVGIPPPPPPPPPPPPGGAVG 1058 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/68 (41%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPP---PPPPTPP 287 PP P P + +PP P +V +PPPPPPPPPP PPPP PP Sbjct: 1045 PPPPPPPPPGGAVGIPPPPPPPPPPPGGKVG------IPPPPPPPPPPGGAGFPPPPPPP 1098 Query: 286 PATTDGAP 263 P + GAP Sbjct: 1099 PGASFGAP 1106 [205][TOP] >UniRef100_A1DL75 Actin associated protein Wsp1, putative n=1 Tax=Neosartorya fischeri NRRL 181 RepID=A1DL75_NEOFI Length = 638 Score = 58.5 bits (140), Expect = 2e-07 Identities = 55/196 (28%), Positives = 72/196 (36%), Gaps = 49/196 (25%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPP---------PPPPP 311 V PP P P+A R PP P + A+ + S PPPPPP PPPPP Sbjct: 447 VPPPAPPPVPAASRPT-PPPPATSAVPPPPPPPSASVPPPPPPPPPASAGPPAPPPPPPP 505 Query: 310 ----PPPPPTPPPATTDGAP-----------------------------GGG*DSNARVR 230 PPPPP PPPA AP GG D A +R Sbjct: 506 SIAGPPPPPPPPPAPGGSAPPPPPPPPGASAPPPPPPAGGAAPPLPKPTGGRDDLLAAIR 565 Query: 229 -------RKLARSWEAETTAATPPASVSNVSAGTMGRGVAEGAGRGNRDGRRPHGMSMGR 71 RK+ S + + +AA P S + +A T G GA +G G ++ + Sbjct: 566 ASGGGGLRKVKDSEKRDRSAALVPGSAAESTAPTPSSG---GAAQGGLAGALQDALAKRK 622 Query: 70 MGKGAG*EETREKGRW 23 +E + W Sbjct: 623 QKVSGSDDEKDDDDDW 638 [206][TOP] >UniRef100_Q99PP2 Zinc finger protein 318 (Fragment) n=1 Tax=Mus musculus RepID=ZN318_MOUSE Length = 2064 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/71 (42%), Positives = 36/71 (50%), Gaps = 20/71 (28%) Frame = -1 Query: 433 SAVRLLLPPTPHSRALARDDEVANGSGDT--------------------VPPPPPPPPPP 314 S+ LLLPP S+A ++ V GS + +PPPPPPPPPP Sbjct: 1247 SSSDLLLPPDIISKAFGGEEVVLKGSPEEKVELAEKNEPSQVPEQMLALLPPPPPPPPPP 1306 Query: 313 PPPPPPTPPPA 281 PPPPPP PP A Sbjct: 1307 PPPPPPPPPQA 1317 [207][TOP] >UniRef100_P33485 Probable nuclear antigen n=2 Tax=Suid herpesvirus 1 RepID=VNUA_SUHVK Length = 1733 Score = 58.5 bits (140), Expect = 2e-07 Identities = 45/122 (36%), Positives = 45/122 (36%), Gaps = 10/122 (8%) Frame = -1 Query: 361 GSGDTVPPPPPP-------PPPPPPPPPPTPPPATTDG---APGGG*DSNARVRRKLARS 212 G D PPP PP PPPPPPPPPP PPPA GGG RR R Sbjct: 266 GDRDDPPPPSPPPRPPPPLPPPPPPPPPPQPPPAGGSARRRRRGGGPPGRGGRRRGGKRR 325 Query: 211 WEAETTAATPPASVSNVSAGTMGRGVAEGAGRGNRDGRRPHGMSMGRMGKGAG*EETREK 32 T AA A G G G DG G G GAG E E Sbjct: 326 RAEGTEAAAADAEEEEDGDGDEDEDEDRAEGEGREDG----GEGPRGAGGGAG-ESESES 380 Query: 31 GR 26 GR Sbjct: 381 GR 382 [208][TOP] >UniRef100_Q9Z180 SET-binding protein n=1 Tax=Mus musculus RepID=SETBP_MOUSE Length = 1535 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/69 (44%), Positives = 39/69 (56%), Gaps = 2/69 (2%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRA-LARDDEVANGSGDTVPPPPPPPPP-PPPPPPPTPPP 284 P +R ++PS L L P A +A + V + + + P PPPPPPP PPPPPPP PPP Sbjct: 1424 PSKRGQKPSLSPLALEPASGQDAVMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPPPPP 1483 Query: 283 ATTDGAPGG 257 A GG Sbjct: 1484 PLPKTARGG 1492 [209][TOP] >UniRef100_P08001 Acrosin heavy chain n=1 Tax=Sus scrofa RepID=ACRO_PIG Length = 415 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/59 (45%), Positives = 31/59 (52%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 +PP RP PS + PP R + + PPP PPPPPPPPPPPP PPP Sbjct: 307 APPVRP--PSVQTPVRPPWYFQRPPGPSQQPGSRPRPPAPPPAPPPPPPPPPPPPPPPP 363 [210][TOP] >UniRef100_UPI0000F2B89E PREDICTED: similar to IA-1 n=1 Tax=Monodelphis domestica RepID=UPI0000F2B89E Length = 573 Score = 58.5 bits (140), Expect = 2e-07 Identities = 55/160 (34%), Positives = 71/160 (44%), Gaps = 19/160 (11%) Frame = +3 Query: 6 SPP--PNHHLPFSLVSSHP-APLPIRPID-MPWGLRPSLLPRPAPSATPLPIV----PAL 161 SPP + P +L++S P APL + P +P L P LP P P A P P+ A+ Sbjct: 44 SPPLSGSERAPAALLASAPSAPLLLPPPPPLPLPLPPRELPPPPPVAGPKPVQFGNPEAV 103 Query: 162 TLLTLAGGVAAVVSASQERANFRRTRALLSHPPPGAPSVVAGGGVGGGGGGGGGGGGGGG 341 L V +++ F R+ L S P A S + GGGGGGGG GGGGG Sbjct: 104 YPAPLYSPTRPVSREHEKKKYFERSFNLGS--PVSAESFPTPAALLGGGGGGGGAGGGGG 161 Query: 342 GTVSPLPL-----------ATSSSRASARLCGVGGSSNRT 428 GT PL A S++ A+ G GG T Sbjct: 162 GTCGGDPLLFAPADLKMGTAFSAAAAAGAEAGGGGGGRGT 201 [211][TOP] >UniRef100_Q29FX9 GA12282 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=Q29FX9_DROPS Length = 703 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/60 (46%), Positives = 39/60 (65%), Gaps = 4/60 (6%) Frame = +3 Query: 261 PGAPSVVAGGGVGGGGGGGGGGGGGGGGTV----SPLPLATSSSRASARLCGVGGSSNRT 428 P +P+ + G GGGGGGGGGGGGGGGG+ SP ++ +SS +S+ GG S+R+ Sbjct: 82 PNSPAAGSSGSSGGGGGGGGGGGGGGGGSSAGQHSPCAISAASSSSSSGSASGGGQSSRS 141 [212][TOP] >UniRef100_P14651 Homeobox protein Hox-B3 n=1 Tax=Homo sapiens RepID=HXB3_HUMAN Length = 431 Score = 51.6 bits (122), Expect(2) = 2e-07 Identities = 29/56 (51%), Positives = 33/56 (58%), Gaps = 4/56 (7%) Frame = +3 Query: 231 RTRALLSHPPPGAPSVVAGGGVGGGGGG----GGGGGGGGGGTVSPLPLATSSSRA 386 R + L + PG GGG GGGGGG GGGGGGGGGG SP P + +S RA Sbjct: 137 RQTSKLKNNSPGTAEGCGGGGGGGGGGGSGGSGGGGGGGGGGDKSP-PGSAASKRA 191 Score = 26.6 bits (57), Expect(2) = 2e-07 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 178 PAVWPQSSPPPKSAPTSA 231 P P SPPP +APTSA Sbjct: 82 PLSAPPGSPPPSAAPTSA 99 [213][TOP] >UniRef100_B7ZAD0 cDNA, FLJ79144, highly similar to Homeobox protein Hox-B3 n=2 Tax=Homo sapiens RepID=B7ZAD0_HUMAN Length = 358 Score = 51.6 bits (122), Expect(2) = 2e-07 Identities = 29/56 (51%), Positives = 33/56 (58%), Gaps = 4/56 (7%) Frame = +3 Query: 231 RTRALLSHPPPGAPSVVAGGGVGGGGGG----GGGGGGGGGGTVSPLPLATSSSRA 386 R + L + PG GGG GGGGGG GGGGGGGGGG SP P + +S RA Sbjct: 64 RQTSKLKNNSPGTAEGCGGGGGGGGGGGSGGSGGGGGGGGGGDKSP-PGSAASKRA 118 Score = 26.6 bits (57), Expect(2) = 2e-07 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 178 PAVWPQSSPPPKSAPTSA 231 P P SPPP +APTSA Sbjct: 9 PLSAPPGSPPPSAAPTSA 26 [214][TOP] >UniRef100_UPI0000E2171E PREDICTED: Wiskott-Aldrich syndrome gene-like protein isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E2171E Length = 495 Score = 58.2 bits (139), Expect = 3e-07 Identities = 38/128 (29%), Positives = 49/128 (38%), Gaps = 8/128 (6%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPPPPP 302 PP P +PS +PP P +R S + PPPPPP PPPPPPP Sbjct: 313 PPPPPSRPSVA---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 369 Query: 301 PPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEGA 122 PP P P G P G + TTA A + + G + V + + Sbjct: 370 PPPPGPPPPPGLPSDG-------------DHQVPTTAGNKAALLDQIREGAQLKKVEQNS 416 Query: 121 GRGNRDGR 98 + GR Sbjct: 417 RPVSCSGR 424 [215][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 58.2 bits (139), Expect = 3e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -1 Query: 358 SGDTVPPPPPPPPPPPPPPPPTPPP 284 +G ++PPPPPPPPPPPPPPPP PPP Sbjct: 455 AGASLPPPPPPPPPPPPPPPPPPPP 479 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTD 272 PPPPPPPPPPPPPPPP PPP D Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPLD 487 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/53 (43%), Positives = 27/53 (50%), Gaps = 7/53 (13%) Frame = -1 Query: 421 LLLPPTPHSRALARDDE-------VANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 L + P H R + + + PPPPPPPPPPPPPPPP PPP Sbjct: 428 LFVSPPTHGRPVIASPSYPCHSAPIPHAGASLPPPPPPPPPPPPPPPPPPPPP 480 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/64 (46%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLP----PTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPP 296 VSPP R P P P PH+ G+ PPPPPPPPPPPPPPPP Sbjct: 430 VSPPTHGR-PVIASPSYPCHSAPIPHA-----------GASLPPPPPPPPPPPPPPPPPP 477 Query: 295 TPPP 284 PPP Sbjct: 478 PPPP 481 [216][TOP] >UniRef100_UPI0000D9A917 PREDICTED: similar to Wiskott-Aldrich syndrome gene-like protein n=1 Tax=Macaca mulatta RepID=UPI0000D9A917 Length = 435 Score = 58.2 bits (139), Expect = 3e-07 Identities = 38/128 (29%), Positives = 49/128 (38%), Gaps = 8/128 (6%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPPPPP 302 PP P +PS +PP P +R S + PPPPPP PPPPPPP Sbjct: 253 PPPPPSRPSVA---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 309 Query: 301 PPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEGA 122 PP P P G P G + TTA A + + G + V + + Sbjct: 310 PPPPGPPPPTGLPSDG-------------DHQVPTTAGNKAALLDQIREGAQLKKVEQNS 356 Query: 121 GRGNRDGR 98 + GR Sbjct: 357 RPVSCSGR 364 [217][TOP] >UniRef100_UPI0001B7A397 jumonji domain containing 3 n=1 Tax=Rattus norvegicus RepID=UPI0001B7A397 Length = 1638 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/58 (46%), Positives = 31/58 (53%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP PS L P R + ++ G +PPPPPPPPPPPPPPPP PPP Sbjct: 210 PPAALSGPSGEEGLSPGGKRRRGCS-SEQAGLPPGLPLPPPPPPPPPPPPPPPPPPPP 266 [218][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -1 Query: 376 DEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 D V + D PPPPPPPPPPPPPPPP PPP Sbjct: 457 DYVRTYAHDASPPPPPPPPPPPPPPPPPPPP 487 Score = 57.8 bits (138), Expect = 4e-07 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP + +P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPVETSP 503 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -1 Query: 367 ANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 A+ + PPPPPPPPPPPPPPPP PPP Sbjct: 463 AHDASPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPP 491 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPP 492 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPP 493 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPP 494 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPP 495 [219][TOP] >UniRef100_A4FPI4 Endo-1,4-beta-glucanase n=1 Tax=Saccharopolyspora erythraea NRRL 2338 RepID=A4FPI4_SACEN Length = 386 Score = 58.2 bits (139), Expect = 3e-07 Identities = 44/123 (35%), Positives = 51/123 (41%), Gaps = 15/123 (12%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPPATTDGAPG--GG*DSNARVRRKLA-------------R 215 +VP PP PP P PP P P GA G GG ++A A Sbjct: 204 SVPEPPAPPAAAPAPPAPAAPEGAGAGAGGGTGGGGASAAGAASAAGGVGGGAPDLSPGG 263 Query: 214 SWEAETTAATPPASVSNVSAGTMGRGVAEGAGRGNRDGRRPHGMSMGRMGKGAG*EETRE 35 S A +ATPPA + SAG G A AG G G P GM G MG G +E + Sbjct: 264 SSGAAEPSATPPAVAA--SAGAAAGGAAAAAGGGMAGGMMPMGMMGGAMGAQGGAQERQN 321 Query: 34 KGR 26 K R Sbjct: 322 KSR 324 [220][TOP] >UniRef100_B4W5S8 OmpA family protein n=1 Tax=Brevundimonas sp. BAL3 RepID=B4W5S8_9CAUL Length = 385 Score = 58.2 bits (139), Expect = 3e-07 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPP 284 G+ + PPPPPPPPPPPPPPPP PPP Sbjct: 242 GAEEAAPPPPPPPPPPPPPPPPPPPP 267 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPA 281 PPPPPPPPPPPPPPPP PPPA Sbjct: 250 PPPPPPPPPPPPPPPPPPPPA 270 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPP 268 [221][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -1 Query: 355 GDTVPPPPPPPPPPPPPPPPTPPP 284 G VPPPPPPPPPPPPPPPP PPP Sbjct: 211 GAPVPPPPPPPPPPPPPPPPPPPP 234 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP AP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPAP 242 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDG 269 PPPPPPPPPPPPPPPP P P G Sbjct: 223 PPPPPPPPPPPPPPPPPPAPVCQQG 247 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PP P Sbjct: 222 PPPPPPPPPPPPPPPPPPPAPVCQQGP 248 [222][TOP] >UniRef100_Q015R2 RhoA GTPase effector DIA/Diaphanous (ISS) n=1 Tax=Ostreococcus tauri RepID=Q015R2_OSTTA Length = 1105 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/53 (52%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTP---PPATTDGAP 263 PP P +RA + AN + PPPPPPPPPPPPPPPP P P T AP Sbjct: 452 PPPPFARA-----QSANANVSAPPPPPPPPPPPPPPPPPRPSLGPIVPTPPAP 499 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/74 (40%), Positives = 32/74 (43%), Gaps = 9/74 (12%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPP------- 299 PP P++ PP P AR PPPPPPPPPPPPPPP Sbjct: 433 PPPPPKRIGCDITHPPPPPPPPPFARAQSANANVSAPPPPPPPPPPPPPPPPPRPSLGPI 492 Query: 298 -PTPP-PATTDGAP 263 PTPP P AP Sbjct: 493 VPTPPAPPPVPRAP 506 [223][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP PG Sbjct: 91 PPPPPPPPPPPPPPPPPPPPPPPPPVPG 118 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -1 Query: 349 TVPPPPPPPPPPPPPPPPTPPP 284 T PPPPPPPPPPPPPPPP PPP Sbjct: 71 TPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG 254 PPPPPPPPPPPPPPPP PPP P G Sbjct: 89 PPPPPPPPPPPPPPPPPPPPPPPPPPPVPG 118 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPP 96 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPP 97 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPP 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPP 99 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPP 100 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPP 101 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPP 102 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPP 103 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPP 104 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 86 PPPPPPPPPPPPPPPPPPPP 105 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 87 PPPPPPPPPPPPPPPPPPPP 106 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 88 PPPPPPPPPPPPPPPPPPPP 107 [224][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/53 (50%), Positives = 29/53 (54%) Frame = -1 Query: 442 RQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 RQP +V L P EV + PPPPPPPPPPPPPPPP PPP Sbjct: 14 RQPPSVPFLWEEKPGIPKKDWKPEVTAVNPAPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPP 74 [225][TOP] >UniRef100_C3ZR57 Putative uncharacterized protein (Fragment) n=1 Tax=Branchiostoma floridae RepID=C3ZR57_BRAFL Length = 1018 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/67 (47%), Positives = 36/67 (53%), Gaps = 3/67 (4%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPP---TPP 287 PP P Q A + P P S A A ++ +GD PPPPPPPPP PPPPPP PP Sbjct: 540 PPAEPYQTDAGNKV--PRPSSLAPAAGAP-SSSAGDLPPPPPPPPPPAPPPPPPPGMPPP 596 Query: 286 PATTDGA 266 P GA Sbjct: 597 PPPLPGA 603 [226][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PPP PG Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPQQPLPG 86 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP PP G PG Sbjct: 62 PPPPPPPPPPPPPPPPPPPQQPLPGNPG 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPP 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPP 284 PPPPPPPPPPPPPPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPP 77 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 Query: 346 VPPPPPPPPPPPPPPPPTPPP 284 VP PPPPPPPPPPPPPP PPP Sbjct: 50 VPAPPPPPPPPPPPPPPPPPP 70 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPG 260 PPPPPPPPPPPPPPPP P G PG Sbjct: 65 PPPPPPPPPPPPPPPPQQPLPGNPGPPG 92 [227][TOP] >UniRef100_B4PVU3 GE23484 n=1 Tax=Drosophila yakuba RepID=B4PVU3_DROYA Length = 291 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -1 Query: 361 GSGDTVPPPPPPPPPPPPPPPPTPPPATTDGAP 263 G PPPPPPPPPPPPPPPP P P GAP Sbjct: 66 GKPKVKPPPPPPPPPPPPPPPPPPAPPAPPGAP 98 [228][TOP] >UniRef100_B4HH21 GM26598 n=1 Tax=Drosophila sechellia RepID=B4HH21_DROSE Length = 359 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAP 263 PPPPPPPPPPPPPPPP PPP G P Sbjct: 143 PPPPPPPPPPPPPPPPPPPPPGVPGNP 169 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 340 PPPPPPPPPPPPPPPTPPPATTDGAPG 260 P PPPPPPPPPPPPP PPP G PG Sbjct: 141 PSPPPPPPPPPPPPPPPPPPPPPGVPG 167 [229][TOP] >UniRef100_A9V1R7 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V1R7_MONBE Length = 1099 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/71 (42%), Positives = 34/71 (47%), Gaps = 6/71 (8%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPP------PPPPP 296 PP+ P P+A PP P +G T PPPPPPPPP PPPPP Sbjct: 373 PPKAPMPPTA-----PPAPGG---------PEATGTTASAPPPPPPPPPGVSGGAPPPPP 418 Query: 295 TPPPATTDGAP 263 PPP + GAP Sbjct: 419 PPPPGGSGGAP 429 [230][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 58.2 bits (139), Expect = 3e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -1 Query: 358 SGDTVPPPPPPPPPPPPPPPPTPPP 284 +G ++PPPPPPPPPPPPPPPP PPP Sbjct: 836 AGASLPPPPPPPPPPPPPPPPPPPP 860 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDG 269 PPPPPPPPPPPPPPPP PPPA G Sbjct: 848 PPPPPPPPPPPPPPPPPPPPALDVG 872 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTD 272 PPPPPPPPPPPPPPPP PPP D Sbjct: 847 PPPPPPPPPPPPPPPPPPPPPALD 870 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 6/52 (11%) Frame = -1 Query: 421 LLLPPTPHSRALARDDE------VANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 L + P H R + + + PPPPPPPPPPPPPPPP PPP Sbjct: 810 LFVSPPTHGRPVIASPSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPP 861 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSN 242 PPPPPPPPPPPPPPPP PPP A G SN Sbjct: 843 PPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSN 876 [231][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 58.2 bits (139), Expect = 3e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -1 Query: 358 SGDTVPPPPPPPPPPPPPPPPTPPP 284 +G ++PPPPPPPPPPPPPPPP PPP Sbjct: 914 AGASLPPPPPPPPPPPPPPPPPPPP 938 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDG 269 PPPPPPPPPPPPPPPP PPPA G Sbjct: 926 PPPPPPPPPPPPPPPPPPPPALDVG 950 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTD 272 PPPPPPPPPPPPPPPP PPP D Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPALD 948 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 6/52 (11%) Frame = -1 Query: 421 LLLPPTPHSRALARDDE------VANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 L + P H R + + + PPPPPPPPPPPPPPPP PPP Sbjct: 888 LFVSPPTHGRPVIASPSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPP 939 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSN 242 PPPPPPPPPPPPPPPP PPP A G SN Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSN 954 [232][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 58.2 bits (139), Expect = 3e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -1 Query: 358 SGDTVPPPPPPPPPPPPPPPPTPPP 284 +G ++PPPPPPPPPPPPPPPP PPP Sbjct: 914 AGASLPPPPPPPPPPPPPPPPPPPP 938 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDG 269 PPPPPPPPPPPPPPPP PPPA G Sbjct: 926 PPPPPPPPPPPPPPPPPPPPALDVG 950 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTD 272 PPPPPPPPPPPPPPPP PPP D Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPALD 948 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 6/52 (11%) Frame = -1 Query: 421 LLLPPTPHSRALARDDE------VANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 L + P H R + + + PPPPPPPPPPPPPPPP PPP Sbjct: 888 LFVSPPTHGRPVIASPSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPP 939 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSN 242 PPPPPPPPPPPPPPPP PPP A G SN Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSN 954 [233][TOP] >UniRef100_A8K180 cDNA FLJ76749, highly similar to Homo sapiens Wiskott-Aldrich syndrome-like (WASL), mRNA n=1 Tax=Homo sapiens RepID=A8K180_HUMAN Length = 505 Score = 58.2 bits (139), Expect = 3e-07 Identities = 38/128 (29%), Positives = 49/128 (38%), Gaps = 8/128 (6%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPPPPP 302 PP P +PS +PP P +R S + PPPPPP PPPPPPP Sbjct: 323 PPPPPSRPSVA---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 Query: 301 PPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEGA 122 PP P P G P G + TTA A + + G + V + + Sbjct: 380 PPPPGPPPPPGLPSDG-------------DHQVPTTAGNKAALLDQIREGAQLKKVEQNS 426 Query: 121 GRGNRDGR 98 + GR Sbjct: 427 RPVSCSGR 434 [234][TOP] >UniRef100_A4D0Y1 Wiskott-Aldrich syndrome-like n=1 Tax=Homo sapiens RepID=A4D0Y1_HUMAN Length = 485 Score = 58.2 bits (139), Expect = 3e-07 Identities = 38/128 (29%), Positives = 49/128 (38%), Gaps = 8/128 (6%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPPPPP 302 PP P +PS +PP P +R S + PPPPPP PPPPPPP Sbjct: 303 PPPPPSRPSVA---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 359 Query: 301 PPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEGA 122 PP P P G P G + TTA A + + G + V + + Sbjct: 360 PPPPGPPPPPGLPSDG-------------DHQVPTTAGNKAALLDQIREGAQLKKVEQNS 406 Query: 121 GRGNRDGR 98 + GR Sbjct: 407 RPVSCSGR 414 [235][TOP] >UniRef100_B8M4W4 Actin associated protein Wsp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M4W4_TALSN Length = 648 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/83 (38%), Positives = 37/83 (44%), Gaps = 18/83 (21%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPP---------- 308 PP +P PS R + PP P + + +P PPPPPPPPPP Sbjct: 453 PPPQP-SPSNTRPVPPPPPPAPSSGAPPPPPPPPPSGIPQPPPPPPPPPPSGIPQPPPPP 511 Query: 307 --------PPPPTPPPATTDGAP 263 PPPP PPPAT GAP Sbjct: 512 PPPPSFGAPPPPPPPPATGSGAP 534 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/76 (40%), Positives = 38/76 (50%), Gaps = 9/76 (11%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPP------PPPPPPPPP- 299 PP+ P +A + PP P +RA + + + VPPPPPP PPPPPPPPP Sbjct: 430 PPKIPHTGAAASI--PPPPPARAPIPPPQPSPSNTRPVPPPPPPAPSSGAPPPPPPPPPS 487 Query: 298 --PTPPPATTDGAPGG 257 P PPP P G Sbjct: 488 GIPQPPPPPPPPPPSG 503 [236][TOP] >UniRef100_B8M4W3 Actin associated protein Wsp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M4W3_TALSN Length = 822 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/83 (38%), Positives = 37/83 (44%), Gaps = 18/83 (21%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPP---------- 308 PP +P PS R + PP P + + +P PPPPPPPPPP Sbjct: 453 PPPQP-SPSNTRPVPPPPPPAPSSGAPPPPPPPPPSGIPQPPPPPPPPPPSGIPQPPPPP 511 Query: 307 --------PPPPTPPPATTDGAP 263 PPPP PPPAT GAP Sbjct: 512 PPPPSFGAPPPPPPPPATGSGAP 534 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/76 (40%), Positives = 38/76 (50%), Gaps = 9/76 (11%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPP------PPPPPPPPP- 299 PP+ P +A + PP P +RA + + + VPPPPPP PPPPPPPPP Sbjct: 430 PPKIPHTGAAASI--PPPPPARAPIPPPQPSPSNTRPVPPPPPPAPSSGAPPPPPPPPPS 487 Query: 298 --PTPPPATTDGAPGG 257 P PPP P G Sbjct: 488 GIPQPPPPPPPPPPSG 503 [237][TOP] >UniRef100_B8M2E3 Adenylyl cyclase-associated protein n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M2E3_TALSN Length = 533 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/45 (55%), Positives = 28/45 (62%), Gaps = 8/45 (17%) Frame = -1 Query: 373 EVANGSGDTVPP--------PPPPPPPPPPPPPPTPPPATTDGAP 263 ++ +GS T PP PPPPPPPPPPPPPP PPP GAP Sbjct: 247 QIQSGSIKTAPPAPAPAAGAPPPPPPPPPPPPPPPPPPPADLGAP 291 [238][TOP] >UniRef100_A7EUH8 Putative uncharacterized protein n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7EUH8_SCLS1 Length = 1723 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/56 (51%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPP-----PPPPPPPTPPPATTDGAPG 260 PP P + VA G G PPPPPPPPP PPPPPPP PPP G PG Sbjct: 1007 PPPPPPPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPPPPPPPPPP----GMPG 1058 [239][TOP] >UniRef100_A1CMR3 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus clavatus RepID=A1CMR3_ASPCL Length = 642 Score = 58.2 bits (139), Expect = 3e-07 Identities = 47/135 (34%), Positives = 53/135 (39%), Gaps = 22/135 (16%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP------PPPPPPPPP 296 PP P P V + PP P SG PPPPPPP PPPPPPPPP Sbjct: 493 PPPPPPPPPPVSHVPPPRPPPPP---------SSGGPPPPPPPPPAPGGFAPPPPPPPPP 543 Query: 295 ------TPPPA----------TTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSN 164 P PA G GGG RK+ S + + +AA P S + Sbjct: 544 GGAAPHLPQPAGDRGDLLAAIRASGGKGGG------GLRKVKDSDKKDRSAALVPGSAAE 597 Query: 163 VSAGTMGRGVAEGAG 119 SA T G G A G Sbjct: 598 SSAPTPGGGGAAAQG 612 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/82 (34%), Positives = 35/82 (42%), Gaps = 17/82 (20%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPP-------------- 320 PP PR P+ L P PH+ A + + + PPPPPP Sbjct: 414 PPPPPRSPATPPQLPPKVPHAPTSAAGPPPPPPARNPISSPPPPPPVPAASRPIPPPPAA 473 Query: 319 ---PPPPPPPPTPPPATTDGAP 263 PPPPPPPP PPP+ + P Sbjct: 474 SAVPPPPPPPPPPPPSASIPPP 495 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/79 (39%), Positives = 35/79 (44%), Gaps = 13/79 (16%) Frame = -1 Query: 460 SPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPP------PPPPPPPPP 299 SPP P P+A R + PP A+ PPPPPP PPPPPPPPP Sbjct: 453 SPPPPPPVPAASRPIPPPP-----------AASAVPPPPPPPPPPPPSASIPPPPPPPPP 501 Query: 298 PT-------PPPATTDGAP 263 P PPP + G P Sbjct: 502 PVSHVPPPRPPPPPSSGGP 520 [240][TOP] >UniRef100_C4KK37 Putative uncharacterized protein n=1 Tax=Sulfolobus islandicus M.16.4 RepID=C4KK37_SULIK Length = 1356 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/71 (40%), Positives = 37/71 (52%), Gaps = 7/71 (9%) Frame = -1 Query: 463 VSPPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPP----PPPP---PPPPP 305 +SPP P P R+++PP+P T+ PPP PPPP PPPPP Sbjct: 1242 ISPPPSPPPPPPPRVIIPPSP-----------------TISPPPSPSPPPPPIISPPPPP 1284 Query: 304 PPPTPPPATTD 272 PPP PPP+ T+ Sbjct: 1285 PPPPPPPSPTE 1295 [241][TOP] >UniRef100_O00401 Neural Wiskott-Aldrich syndrome protein n=1 Tax=Homo sapiens RepID=WASL_HUMAN Length = 505 Score = 58.2 bits (139), Expect = 3e-07 Identities = 38/128 (29%), Positives = 49/128 (38%), Gaps = 8/128 (6%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPPPPP 302 PP P +PS +PP P +R S + PPPPPP PPPPPPP Sbjct: 323 PPPPPSRPSVA---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 Query: 301 PPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSNVSAGTMGRGVAEGA 122 PP P P G P G + TTA A + + G + V + + Sbjct: 380 PPPPGPPPPPGLPSDG-------------DHQVPTTAGNKAALLDQIREGAQLKKVEQNS 426 Query: 121 GRGNRDGR 98 + GR Sbjct: 427 RPVSCSGR 434 [242][TOP] >UniRef100_Q5NCY0 Lysine-specific demethylase 6B n=1 Tax=Mus musculus RepID=KDM6B_MOUSE Length = 1641 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/58 (46%), Positives = 31/58 (53%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPP 284 PP PS L P R + ++ G +PPPPPPPPPPPPPPPP PPP Sbjct: 210 PPAALSGPSGEEGLSPGGKRRRGCS-SEQAGLPPGLPLPPPPPPPPPPPPPPPPPPPP 266 [243][TOP] >UniRef100_UPI0000E5AC2D CXXC finger 4 n=1 Tax=Homo sapiens RepID=UPI0000E5AC2D Length = 367 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/53 (52%), Positives = 33/53 (62%) Frame = +3 Query: 285 GGGVGGGGGGGGGGGGGGGGTVSPLPLATSSSRASARLCGVGGSSNRTADGWR 443 GGG GGGGGGGGGGGGGGGG S A+SS+ +S+ + GG G R Sbjct: 115 GGGGGGGGGGGGGGGGGGGGRKSSSAAASSSASSSSAILPAGGGGGGGGGGSR 167 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/56 (51%), Positives = 33/56 (58%), Gaps = 7/56 (12%) Frame = +3 Query: 285 GGGVGGGGGGGGGGGGGGGGTVSPLPLATSSSRASARLC-------GVGGSSNRTA 431 GGG GGGGGGGGGGGGGGGG A SSS +S+ G GG +RT+ Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGRKSSSAAASSSASSSSAILPAGGGGGGGGGGSRTS 169 [244][TOP] >UniRef100_B3MMU1 GF15119 n=1 Tax=Drosophila ananassae RepID=B3MMU1_DROAN Length = 885 Score = 58.2 bits (139), Expect = 3e-07 Identities = 41/118 (34%), Positives = 55/118 (46%), Gaps = 7/118 (5%) Frame = +3 Query: 126 PSATPLPIVPALTLLTLAGGVAAVVSASQERANFR---RTRALLSHPPPGAPSVVAGGG- 293 PS + A G A +A +R+ R R R+ S+P G +G G Sbjct: 74 PSTSTAAAATAAAAAGQVTGSGAGSAAGHQRSGGRSGQRRRSSSSNPHAGTTKATSGSGG 133 Query: 294 ---VGGGGGGGGGGGGGGGGTVSPLPLATSSSRASARLCGVGGSSNRTADGWRGRRGG 458 GGGGGGGGGGGGGGGG V S+ R+S+ + +++R G GR GG Sbjct: 134 AGSAGGGGGGGGGGGGGGGGGVKQSVSRNSNIRSSSSNSTMASANHR---GGGGRGGG 188 [245][TOP] >UniRef100_Q5VUA4 Zinc finger protein 318 n=1 Tax=Homo sapiens RepID=ZN318_HUMAN Length = 2279 Score = 57.4 bits (137), Expect(2) = 3e-07 Identities = 29/73 (39%), Positives = 36/73 (49%), Gaps = 17/73 (23%) Frame = -1 Query: 433 SAVRLLLPPTPHSRALARDDEVANGSGDT-----------------VPPPPPPPPPPPPP 305 S+ LLLPP S+A ++ + GS + +PPPPPPPPPPPPP Sbjct: 1395 SSADLLLPPDIISKAFGGEEVILKGSPEEKVVLAEKSEPSHLPEQILPPPPPPPPPPPPP 1454 Query: 304 PPPTPPPATTDGA 266 PP P PA A Sbjct: 1455 PPVIPHPAAPSAA 1467 Score = 20.4 bits (41), Expect(2) = 3e-07 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 279 PRMAHPVVGETATPGCGG 226 P ++PVV +T +PG G Sbjct: 1475 PVKSNPVVSQTLSPGFVG 1492 [246][TOP] >UniRef100_UPI0000E20F8D PREDICTED: zinc finger protein 318 n=1 Tax=Pan troglodytes RepID=UPI0000E20F8D Length = 2086 Score = 57.4 bits (137), Expect(2) = 3e-07 Identities = 29/73 (39%), Positives = 36/73 (49%), Gaps = 17/73 (23%) Frame = -1 Query: 433 SAVRLLLPPTPHSRALARDDEVANGSGDT-----------------VPPPPPPPPPPPPP 305 S+ LLLPP S+A ++ + GS + +PPPPPPPPPPPPP Sbjct: 1207 SSADLLLPPDIISKAFGGEEVILKGSPEEKVVLAEKSEPSHLPEQILPPPPPPPPPPPPP 1266 Query: 304 PPPTPPPATTDGA 266 PP P PA A Sbjct: 1267 PPVIPHPAAPSAA 1279 Score = 20.4 bits (41), Expect(2) = 3e-07 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 279 PRMAHPVVGETATPGCGG 226 P ++PVV +T +PG G Sbjct: 1287 PVKSNPVVSQTLSPGFVG 1304 [247][TOP] >UniRef100_C5C593 Putative uncharacterized protein n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C593_BEUC1 Length = 403 Score = 57.4 bits (137), Expect(2) = 3e-07 Identities = 33/84 (39%), Positives = 40/84 (47%), Gaps = 18/84 (21%) Frame = -1 Query: 460 SPPRR---PRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPP--------- 317 +PP+R PR A P P +R +E+A G T+PP PPPPPP Sbjct: 10 TPPQRDWLPRYAPAPPASASPLPGTRP-PTPEELAQSLGVTLPPAPPPPPPPPPGPSPSS 68 Query: 316 ------PPPPPPPTPPPATTDGAP 263 PPPPPPP PP+ T G P Sbjct: 69 IAQPGYPPPPPPPGHPPSATSGLP 92 Score = 20.4 bits (41), Expect(2) = 3e-07 Identities = 7/17 (41%), Positives = 8/17 (47%) Frame = -2 Query: 189 PHRRPASATSVLALWGG 139 PH P T + LW G Sbjct: 133 PHEAPDDETVPVGLWAG 149 [248][TOP] >UniRef100_UPI0001926FBC PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBC Length = 315 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/55 (50%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Frame = -1 Query: 412 PPTPHSRALARDDEVANGSGDTVPPPPPPPPPPP-----PPPPPTPPPATTDGAP 263 PP P A DD+ +GSG PPPPPPPPPPP PPP PPP AP Sbjct: 123 PPPPPPPPPATDDDDTSGSGILPPPPPPPPPPPPCETPCALPPPPPPPMDMGCAP 177 [249][TOP] >UniRef100_UPI0001818C5C Wiskott-Aldrich syndrome-like n=1 Tax=Pongo abelii RepID=UPI0001818C5C Length = 505 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/76 (39%), Positives = 34/76 (44%), Gaps = 8/76 (10%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPP--------PPPPPPP 302 PP P +PS +PP P +R S + PPPPPP PPPPPPP Sbjct: 323 PPPPPSRPSVA---VPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 Query: 301 PPTPPPATTDGAPGGG 254 PP P P G P G Sbjct: 380 PPPPGPPPPPGLPSDG 395 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/62 (45%), Positives = 30/62 (48%) Frame = -1 Query: 457 PPRRPRQPSAVRLLLPPTPHSRALARDDEVANGSGDTVPPPPPPPPPPPPPPPPTPPPAT 278 PP P PS+ PP P S G G PPPPPPPPPPP PPPP P+ Sbjct: 344 PPPPPALPSSAPSGPPPPPPS---------VLGVGPVAPPPPPPPPPPPGPPPPPGLPSD 394 Query: 277 TD 272 D Sbjct: 395 GD 396 [250][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 57.8 bits (138), Expect = 4e-07 Identities = 32/78 (41%), Positives = 37/78 (47%) Frame = -1 Query: 343 PPPPPPPPPPPPPPPPTPPPATTDGAPGGG*DSNARVRRKLARSWEAETTAATPPASVSN 164 PPPPPPPPPPPPPPPP PPAT+ P +RKLA A P ++ Sbjct: 2340 PPPPPPPPPPPPPPPPPLPPATSPKPP-------TYPKRKLA------AAAPVAPTAIVT 2386 Query: 163 VSAGTMGRGVAEGAGRGN 110 A + A A R N Sbjct: 2387 AHADAIPTVEATAARRSN 2404