[UP]
[1][TOP] >UniRef100_C1MJ05 Predicted protein (Fragment) n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MJ05_9CHLO Length = 210 Score = 115 bits (288), Expect = 2e-24 Identities = 65/144 (45%), Positives = 77/144 (53%), Gaps = 4/144 (2%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAIT 277 GG G GGGGGGGGGGG G D + GGGG GL W +YL+ALD AP+ TK T Sbjct: 1 GGKGGGGGGGGGGGGGSGGDGASGGGGGGGGGGL-------WAAYLRALDTAPLLTKCFT 53 Query: 278 AGVLVGLGDTLAQ-MLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGV 454 +GVL GD AQ M D R FA G L GP H WY+ L ++V G Sbjct: 54 SGVLNVFGDVFAQFMFEDAARNGCDWRRAGVFALLGFALVGPCLHFWYSSLSKIVAATGA 113 Query: 455 AGIAG---KVAADQLLFAPVFTSI 517 G A +A DQL+FAP F ++ Sbjct: 114 VGNASAGVSLALDQLVFAPSFLAV 137 [2][TOP] >UniRef100_B9IHK6 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IHK6_POPTR Length = 264 Score = 104 bits (259), Expect = 4e-21 Identities = 58/140 (41%), Positives = 82/140 (58%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAIT 277 G GG GG GG GGGGEG+ A++G GG + L SW YL L P+ TKA+T Sbjct: 58 GSGGSGGVGGSAGGGGEGS----GASSGSGGNSNWSFL--SW--YLNLLANYPVLTKAVT 109 Query: 278 AGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVA 457 + +L +GD + Q++ + +LDL R F F GLVL GP H WY L ++V +PG + Sbjct: 110 SAILTFMGDLICQLVIDQ-VPSLDLKRTFLFTLLGLVLVGPTLHIWYLYLSKMVTVPGAS 168 Query: 458 GIAGKVAADQLLFAPVFTSI 517 G ++ ADQ +F+P+F + Sbjct: 169 GAFLRLLADQFVFSPIFIGV 188 [3][TOP] >UniRef100_C1DZV4 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1DZV4_9CHLO Length = 322 Score = 100 bits (249), Expect = 6e-20 Identities = 68/177 (38%), Positives = 83/177 (46%), Gaps = 5/177 (2%) Frame = +2 Query: 2 PAFGARRST-PDEFLSSSTPPLSRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAA 178 P +R ST PD S RG GGGG GG GG GGG G G +S A++ Sbjct: 65 PFAPSRPSTRPDGNAGPSFRRQRRGVARAAEGGGGGGSGGSGGSGGGSGGGGGDS-GASS 123 Query: 179 GGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQ-MLTGTPLGNLDLP 355 G GG GL W YL +L+ P+ TK +T+G+L GD AQ M D Sbjct: 124 GSGGGGL-------WVLYLSSLEKNPLLTKCVTSGILNSAGDLFAQFMFEDAASKGCDWK 176 Query: 356 RLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKV---AADQLLFAPVFTSI 517 R F G L GP H WY L ++V G G A V A DQL+FAP F ++ Sbjct: 177 RAGVFTFLGAALVGPCLHFWYTNLNKIVVATGAVGSAAAVTSLALDQLVFAPTFLAV 233 [4][TOP] >UniRef100_B9HDU1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HDU1_POPTR Length = 286 Score = 100 bits (248), Expect = 8e-20 Identities = 59/146 (40%), Positives = 82/146 (56%), Gaps = 7/146 (4%) Frame = +2 Query: 101 GGGRGG----GGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTS---YLKALDVAPI 259 GGG GG GG GGGGG+G AA+GG G+G R+W+ YL L P+ Sbjct: 75 GGGSGGSGRLGGSSGGGGGQGG-----AASGGSGSGGN----RNWSFLSWYLNLLAKYPV 125 Query: 260 KTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVV 439 TKA+T+ +L +GD + Q++ +LDL R F F GLVL GP H WY L ++V Sbjct: 126 LTKAVTSAILTLMGDLICQLVIDQA-PSLDLKRTFVFTFLGLVLVGPTLHFWYLYLSKLV 184 Query: 440 RLPGVAGIAGKVAADQLLFAPVFTSI 517 LPG +G ++ DQ +F+P+F + Sbjct: 185 TLPGASGAFLRLLVDQFVFSPIFIGV 210 [5][TOP] >UniRef100_A7PTF2 Chromosome chr8 scaffold_29, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PTF2_VITVI Length = 293 Score = 99.0 bits (245), Expect = 2e-19 Identities = 57/135 (42%), Positives = 77/135 (57%) Frame = +2 Query: 113 GGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLV 292 GG GG GG GG G S + G GG G +LL SW YL L+ P+ TKAIT+ L Sbjct: 88 GGSGGTGGFGGFGDGNSGGKSEGSGGGGDWSLL--SW--YLALLEKYPVLTKAITSAFLT 143 Query: 293 GLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGK 472 +GD + Q++ + +LDL R F F GLVL GP H WY L ++V +PG +G + Sbjct: 144 LVGDLICQLVIDQ-VPSLDLKRTFLFTLLGLVLVGPTLHFWYLYLSKLVTIPGASGAFLR 202 Query: 473 VAADQLLFAPVFTSI 517 + DQ LF+P+F + Sbjct: 203 LLLDQFLFSPIFIGV 217 [6][TOP] >UniRef100_A4RU33 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RU33_OSTLU Length = 240 Score = 98.6 bits (244), Expect = 2e-19 Identities = 61/151 (40%), Positives = 71/151 (47%), Gaps = 1/151 (0%) Frame = +2 Query: 68 RGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALD 247 RGA GGG GGGGGGGGGGG G D GGG G + W +YL AL+ Sbjct: 12 RGAARGKSASVGGGNGGGGGGGGGGGGGGD--------GGGDGAAGGVQTLWAAYLNALE 63 Query: 248 VAPIKTKAITAGVLVGLGDTLAQM-LTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNL 424 P+ TK T+GVL LGD AQ +D R F G L GP H WY Sbjct: 64 KNPLATKCATSGVLNALGDLFAQFSFDDAAKKGIDWRRAGVFTFLGGALVGPALHFWYGT 123 Query: 425 LERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 L ++V G A + DQ LFAP F + Sbjct: 124 LGKIVTAQGSAKAFISLVLDQGLFAPAFLCV 154 [7][TOP] >UniRef100_Q8L9G1 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana RepID=Q8L9G1_ARATH Length = 289 Score = 93.6 bits (231), Expect = 7e-18 Identities = 61/151 (40%), Positives = 79/151 (52%) Frame = +2 Query: 65 SRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKAL 244 S G+GG GG G GG GG GGGGG+G+D G G LL SW Y L Sbjct: 81 SGGSGGL----GGSGGGGNGGSGGGGGDGSD----------GKGKKRSLL-SW--YQALL 123 Query: 245 DVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNL 424 +P+ TKA+TA +L +GD + Q LT +LD R F GL L GP H WY Sbjct: 124 SNSPVLTKAVTAALLNLVGDLICQ-LTINKTSSLDKKRTLTFTFLGLGLVGPTLHFWYLY 182 Query: 425 LERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 L +VV G++G ++ DQ +FAP+F + Sbjct: 183 LSKVVTASGLSGAVIRLLLDQFVFAPIFVGV 213 [8][TOP] >UniRef100_A9RI20 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RI20_PHYPA Length = 334 Score = 92.8 bits (229), Expect = 1e-17 Identities = 53/137 (38%), Positives = 74/137 (54%), Gaps = 1/137 (0%) Frame = +2 Query: 98 GGGGRGGG-GGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAI 274 G GG G G GG GG GG+ D GAGL W Y + LD P+ K++ Sbjct: 95 GDGGNGDGIGGSGGDGGDNEDGDDKNQPLAPGAGL-------WFRYTELLDRHPLIVKSL 147 Query: 275 TAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGV 454 TAG+L + D + Q+L + +DL RL F A GL + GP H W+ +L+ V +PG+ Sbjct: 148 TAGLLNAIADLVCQVLVER-VSAVDLRRLLSFVAIGLFMSGPGLHYWFGILKNFVTVPGM 206 Query: 455 AGIAGKVAADQLLFAPV 505 G+ + AADQL+F P+ Sbjct: 207 GGVLLRTAADQLVFTPL 223 [9][TOP] >UniRef100_UPI0000162516 peroxisomal membrane 22 kDa family protein n=1 Tax=Arabidopsis thaliana RepID=UPI0000162516 Length = 288 Score = 92.4 bits (228), Expect = 2e-17 Identities = 61/151 (40%), Positives = 79/151 (52%) Frame = +2 Query: 65 SRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKAL 244 S G+GG GG GGGGG GGGGG+G+D G G LL SW Y L Sbjct: 81 SGGSGGL-----GGSGGGGGGSGGGGGDGSD----------GKGKKWSLL-SW--YQALL 122 Query: 245 DVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNL 424 +P+ TKA+TA +L +GD + Q LT +LD R F GL L GP H WY Sbjct: 123 SNSPVLTKAVTAALLNLVGDLICQ-LTINKTSSLDKKRTLTFTFLGLGLVGPTLHFWYLY 181 Query: 425 LERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 L +VV G++G ++ DQ +FAP+F + Sbjct: 182 LSKVVTASGLSGAVIRLLLDQFVFAPIFVGV 212 [10][TOP] >UniRef100_Q93Z42 AT5g19750/T29J13_170 n=1 Tax=Arabidopsis thaliana RepID=Q93Z42_ARATH Length = 288 Score = 92.4 bits (228), Expect = 2e-17 Identities = 61/151 (40%), Positives = 79/151 (52%) Frame = +2 Query: 65 SRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKAL 244 S G+GG GG GGGGG GGGGG+G+D G G LL SW Y L Sbjct: 81 SGGSGGL-----GGSGGGGGGSGGGGGDGSD----------GKGKKWSLL-SW--YQALL 122 Query: 245 DVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNL 424 +P+ TKA+TA +L +GD + Q LT +LD R F GL L GP H WY Sbjct: 123 SNSPVLTKAVTAALLNLVGDLICQ-LTINKTSSLDKKRTLTFTFLGLGLVGPTLHFWYLY 181 Query: 425 LERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 L +VV G++G ++ DQ +FAP+F + Sbjct: 182 LSKVVTASGLSGAVIRLLLDQFVFAPIFVGV 212 [11][TOP] >UniRef100_UPI0000DD9D8A Os12g0127900 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD9D8A Length = 239 Score = 90.1 bits (222), Expect = 8e-17 Identities = 55/139 (39%), Positives = 71/139 (51%) Frame = +2 Query: 101 GGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITA 280 G GGGGGGGG GE + LL +W YL ALD PI TKA+T+ Sbjct: 73 GVAAGGGGGGGGAKGE----------------MDWRLLLAW--YLLALDKHPITTKAVTS 114 Query: 281 GVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAG 460 VL GD + Q L + LDL R F F GLVL GP H WY L ++V + G +G Sbjct: 115 AVLTLTGDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWYLYLSKLVMINGASG 173 Query: 461 IAGKVAADQLLFAPVFTSI 517 ++ DQ +F+P+F + Sbjct: 174 AIARLLLDQFIFSPIFIGV 192 [12][TOP] >UniRef100_Q2QY93 Mpv17/PMP22 family protein, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q2QY93_ORYSJ Length = 293 Score = 90.1 bits (222), Expect = 8e-17 Identities = 55/139 (39%), Positives = 71/139 (51%) Frame = +2 Query: 101 GGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITA 280 G GGGGGGGG GE + LL +W YL ALD PI TKA+T+ Sbjct: 73 GVAAGGGGGGGGAKGE----------------MDWRLLLAW--YLLALDKHPITTKAVTS 114 Query: 281 GVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAG 460 VL GD + Q L + LDL R F F GLVL GP H WY L ++V + G +G Sbjct: 115 AVLTLTGDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWYLYLSKLVMINGASG 173 Query: 461 IAGKVAADQLLFAPVFTSI 517 ++ DQ +F+P+F + Sbjct: 174 AIARLLLDQFIFSPIFIGV 192 [13][TOP] >UniRef100_Q01D06 Peroxisomal membrane protein MPV17 and related proteins (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01D06_OSTTA Length = 238 Score = 90.1 bits (222), Expect = 8e-17 Identities = 56/152 (36%), Positives = 71/152 (46%), Gaps = 1/152 (0%) Frame = +2 Query: 65 SRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKAL 244 +R G GG GG GGGG GG G + F ++ G G+ AL W +YL AL Sbjct: 4 TRARRGTATRATNGGNGGNGGGGNGGNGGNGDGFGSSNDGQNGGVRAL----WAAYLGAL 59 Query: 245 DVAPIKTKAITAGVLVGLGDTLAQMLTGTPLG-NLDLPRLFRFAAFGLVLQGPVGHAWYN 421 + P+ TK T+GVL LGD AQ +D R F G L GP H WY Sbjct: 60 EKNPLPTKMATSGVLNALGDLFAQFAFDDAANKGVDWRRAGIFTILGSFLVGPALHFWYG 119 Query: 422 LLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 L ++V G A +A DQ +FAP F + Sbjct: 120 TLGKIVTAQGSAKAFISLALDQGVFAPTFLCV 151 [14][TOP] >UniRef100_B9GBN8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9GBN8_ORYSJ Length = 268 Score = 90.1 bits (222), Expect = 8e-17 Identities = 55/139 (39%), Positives = 71/139 (51%) Frame = +2 Query: 101 GGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITA 280 G GGGGGGGG GE + LL +W YL ALD PI TKA+T+ Sbjct: 73 GVAAGGGGGGGGAKGE----------------MDWRLLLAW--YLLALDKHPITTKAVTS 114 Query: 281 GVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAG 460 VL GD + Q L + LDL R F F GLVL GP H WY L ++V + G +G Sbjct: 115 AVLTLTGDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWYLYLSKLVMINGASG 173 Query: 461 IAGKVAADQLLFAPVFTSI 517 ++ DQ +F+P+F + Sbjct: 174 AIARLLLDQFIFSPIFIGV 192 [15][TOP] >UniRef100_Q2HUU8 WD-40 repeat n=1 Tax=Medicago truncatula RepID=Q2HUU8_MEDTR Length = 245 Score = 89.4 bits (220), Expect = 1e-16 Identities = 61/184 (33%), Positives = 90/184 (48%), Gaps = 14/184 (7%) Frame = +2 Query: 8 FGARRSTPDEFLSSSTPPLSRGAGGPPPPP--------------GGGGRGGGGGGGGGGG 145 F + TP +F +TPP +R PPP G G GG GG GG GG Sbjct: 24 FSPQPPTPLQF--PTTPPFNRF-----PPPFAQLRFRHSRLSALSGDGSGGTGGDGGSGG 76 Query: 146 EGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLT 325 + ++ + GG + L SW Y+ L P+ KA+T+ +L +GD + Q++ Sbjct: 77 WNSGDNEADDGGGTWSFL------SW--YMALLAKYPVPVKALTSAILNLIGDLICQLVI 128 Query: 326 GTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPV 505 + DL R F F+ GLVL GP H WY L ++V LPG +G ++ DQ +F+P+ Sbjct: 129 DK-VQTPDLKRTFLFSFLGLVLVGPTLHFWYLYLSQLVTLPGTSGAILRLVLDQFVFSPI 187 Query: 506 FTSI 517 F + Sbjct: 188 FLGV 191 [16][TOP] >UniRef100_B8BLU6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BLU6_ORYSI Length = 269 Score = 89.0 bits (219), Expect = 2e-16 Identities = 53/134 (39%), Positives = 70/134 (52%) Frame = +2 Query: 116 GGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVG 295 GGGGGGGGG +G + LL +W YL ALD PI TKA+T+ VL Sbjct: 77 GGGGGGGGGAKGE--------------MDWRLLLAW--YLLALDKHPITTKAVTSAVLTL 120 Query: 296 LGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKV 475 GD + Q L + LDL R F GLVL GP H WY L ++V + G +G ++ Sbjct: 121 TGDLICQ-LAIDKVPKLDLKRTLVFTFLGLVLVGPTLHVWYLYLSKLVMINGASGAIARL 179 Query: 476 AADQLLFAPVFTSI 517 DQ +F+P+F + Sbjct: 180 LLDQFIFSPIFIGV 193 [17][TOP] >UniRef100_UPI0000DD9AFA Os11g0131200 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD9AFA Length = 274 Score = 88.6 bits (218), Expect = 2e-16 Identities = 53/133 (39%), Positives = 70/133 (52%) Frame = +2 Query: 119 GGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGL 298 GGG GGGG +GA + LL +W YL ALD PI TKA+T+ VL Sbjct: 112 GGGAGGGGAKGA--------------MDWRLLLAW--YLLALDKHPITTKAVTSAVLTLT 155 Query: 299 GDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKVA 478 GD + Q L + LDL R F F GLVL GP H WY L ++V + G +G ++ Sbjct: 156 GDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWYLYLSKLVTINGASGAIARLL 214 Query: 479 ADQLLFAPVFTSI 517 DQ +F+P+F + Sbjct: 215 LDQFIFSPIFIGV 227 [18][TOP] >UniRef100_Q2RB03 Mpv17/PMP22 family protein, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q2RB03_ORYSJ Length = 285 Score = 88.6 bits (218), Expect = 2e-16 Identities = 53/133 (39%), Positives = 70/133 (52%) Frame = +2 Query: 119 GGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGL 298 GGG GGGG +GA + LL +W YL ALD PI TKA+T+ VL Sbjct: 77 GGGAGGGGAKGA--------------MDWRLLLAW--YLLALDKHPITTKAVTSAVLTLT 120 Query: 299 GDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKVA 478 GD + Q L + LDL R F F GLVL GP H WY L ++V + G +G ++ Sbjct: 121 GDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWYLYLSKLVTINGASGAIARLL 179 Query: 479 ADQLLFAPVFTSI 517 DQ +F+P+F + Sbjct: 180 LDQFIFSPIFIGV 192 [19][TOP] >UniRef100_B9G978 Putative uncharacterized protein n=2 Tax=Oryza sativa RepID=B9G978_ORYSJ Length = 283 Score = 88.6 bits (218), Expect = 2e-16 Identities = 53/133 (39%), Positives = 70/133 (52%) Frame = +2 Query: 119 GGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGL 298 GGG GGGG +GA + LL +W YL ALD PI TKA+T+ VL Sbjct: 77 GGGAGGGGAKGA--------------MDWRLLLAW--YLLALDKHPITTKAVTSAVLTLT 120 Query: 299 GDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKVA 478 GD + Q L + LDL R F F GLVL GP H WY L ++V + G +G ++ Sbjct: 121 GDLICQ-LAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWYLYLSKLVTINGASGAIARLL 179 Query: 479 ADQLLFAPVFTSI 517 DQ +F+P+F + Sbjct: 180 LDQFIFSPIFIGV 192 [20][TOP] >UniRef100_A9RY14 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RY14_PHYPA Length = 311 Score = 84.7 bits (208), Expect = 3e-15 Identities = 50/139 (35%), Positives = 67/139 (48%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAIT 277 GGGG GG GG GG G D S GG A + + +W Y+ P+ TKAIT Sbjct: 80 GGGGGDNGGNGGDYGGGGRDGSSGGDDAGGRAPESSSGILAW--YMDRTQKNPVTTKAIT 137 Query: 278 AGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVA 457 A +L LGD Q++ +D+ R G +L GP H WY L +VV G+ Sbjct: 138 AAILNLLGDIFCQLVIDKS-DKVDVKRTAVITFLGFILVGPTLHTWYLALSKVVTATGLT 196 Query: 458 GIAGKVAADQLLFAPVFTS 514 G ++ DQ LF+P F + Sbjct: 197 GAGVRLLLDQFLFSPAFVA 215 [21][TOP] >UniRef100_C4IYE0 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4IYE0_MAIZE Length = 260 Score = 80.1 bits (196), Expect(2) = 8e-14 Identities = 46/116 (39%), Positives = 64/116 (55%) Frame = +2 Query: 170 AAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLD 349 A A GGGA + L +W YL ALD PI TKA+T+ L GD + Q++ + LD Sbjct: 73 APAAGGGARDWRMFL-AW--YLMALDKNPIVTKAVTSAALTLAGDLICQLVIDR-VPELD 128 Query: 350 LPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 L R F F GL L GP H WY L ++V + G +G ++ DQ +F+P+F + Sbjct: 129 LRRTFVFTFLGLALVGPTLHVWYLYLSKLVTISGASGAIARLILDQFIFSPIFIGV 184 Score = 20.4 bits (41), Expect(2) = 8e-14 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +3 Query: 3 RLLVPAGPPPMSFSLRRRHRCRGGRAARRHPPVAAAGVAAVAVAVVVGRAR 155 RL + PPP +L R ARR P AA G AR Sbjct: 31 RLALRLPPPPRPAALSAPPAAVQPREARRVQPPRAASCCQDPAPAAGGGAR 81 [22][TOP] >UniRef100_Q2QQ39 Peroxisomal membrane protein 22 kDa, putative, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q2QQ39_ORYSJ Length = 269 Score = 80.1 bits (196), Expect = 8e-14 Identities = 51/172 (29%), Positives = 80/172 (46%), Gaps = 13/172 (7%) Frame = +2 Query: 41 LSSSTPPLSRGAGGPPPPP-------------GGGGRGGGGGGGGGGGEGADESFSAAAG 181 +SSS P + PPPPP G R GGG G G AA G Sbjct: 36 ISSSKRPSPSPSPPPPPPPPLPVAPSTSAFVQTAGRRSGGGAGAG-----------AAVG 84 Query: 182 GGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRL 361 G + +W YL +++ P+ TK++TA + + D +QM+T P +LDL R Sbjct: 85 SG--------VVAW--YLGSIEARPVLTKSVTAAAIFTVADLSSQMITLGPEDSLDLVRT 134 Query: 362 FRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 R A++GL++ GP H W+N + +++ V K+ Q ++ P+ S+ Sbjct: 135 LRMASYGLLISGPSLHIWFNFVSKLLPKQDVMNTFKKMFLGQAVYGPIINSV 186 [23][TOP] >UniRef100_Q0IN47 Os12g0508100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q0IN47_ORYSJ Length = 240 Score = 80.1 bits (196), Expect = 8e-14 Identities = 51/172 (29%), Positives = 80/172 (46%), Gaps = 13/172 (7%) Frame = +2 Query: 41 LSSSTPPLSRGAGGPPPPP-------------GGGGRGGGGGGGGGGGEGADESFSAAAG 181 +SSS P + PPPPP G R GGG G G AA G Sbjct: 36 ISSSKRPSPSPSPPPPPPPPLPVAPSTSAFVQTAGRRSGGGAGAG-----------AAVG 84 Query: 182 GGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRL 361 G + +W YL +++ P+ TK++TA + + D +QM+T P +LDL R Sbjct: 85 SG--------VVAW--YLGSIEARPVLTKSVTAAAIFTVADLSSQMITLGPEDSLDLVRT 134 Query: 362 FRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 R A++GL++ GP H W+N + +++ V K+ Q ++ P+ S+ Sbjct: 135 LRMASYGLLISGPSLHIWFNFVSKLLPKQDVMNTFKKMFLGQAVYGPIINSV 186 [24][TOP] >UniRef100_A8J1X1 Peroxisomal membrane MPV17/PMP22-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1X1_CHLRE Length = 270 Score = 80.1 bits (196), Expect = 8e-14 Identities = 46/137 (33%), Positives = 68/137 (49%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAIT 277 GG G G GGG GGG G + G+G G + W Y+ L+ P+ TK++T Sbjct: 58 GGAGTGAGGGHGGGSIRGKPVGSGGSGEPSGSGGGFV---GW--YMSCLEANPLLTKSLT 112 Query: 278 AGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVA 457 +L LGD Q+ ++D+ R F G+ L GP H WY++L ++V G Sbjct: 113 CALLNALGDIFCQLFIEKS-SSIDVKRTGTFTFLGMFLVGPTLHFWYSILNKLVPAGGAT 171 Query: 458 GIAGKVAADQLLFAPVF 508 G ++ DQ +FAP+F Sbjct: 172 GAVLQLLLDQGVFAPLF 188 [25][TOP] >UniRef100_B4FYT6 Mpv17 / PMP22 family protein n=1 Tax=Zea mays RepID=B4FYT6_MAIZE Length = 263 Score = 79.7 bits (195), Expect = 1e-13 Identities = 52/160 (32%), Positives = 74/160 (46%) Frame = +2 Query: 38 FLSSSTPPLSRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLR 217 F+SS PP + P PPP R G G S A G GAG G + Sbjct: 36 FISSKPPPST-----PLPPPVPPARLSPVGSAFG-----PPSRKTGAVGAGAGAGVV--- 82 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 W YL LD P+ TK++TA V+ D +QMLT P +LD R R A++G ++ G Sbjct: 83 GW--YLGLLDARPVLTKSVTAAVIFTAADVSSQMLTLGPEDSLDFLRTMRMASYGFLISG 140 Query: 398 PVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 P H W+N + ++ V K+ Q ++ P+ S+ Sbjct: 141 PSLHLWFNFISKLFPKKDVVNTLKKMFIGQAVYGPIINSV 180 [26][TOP] >UniRef100_A9S0H1 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp. patens RepID=A9S0H1_PHYPA Length = 166 Score = 79.0 bits (193), Expect = 2e-13 Identities = 41/96 (42%), Positives = 55/96 (57%) Frame = +2 Query: 230 YLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGH 409 Y K L PIKTKAIT G+L +GD Q+ G LD R+ FGL + GP H Sbjct: 1 YTKVLIEHPIKTKAITLGILNCVGDIFTQLYVEKS-GGLDYRRVASMTTFGLFIVGPTLH 59 Query: 410 AWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 WY+ L RVV+ G G+A ++ DQ +FAP+F ++ Sbjct: 60 YWYSFLNRVVKASGPKGVAIRLVLDQFIFAPIFIAV 95 [27][TOP] >UniRef100_C5Y3Z5 Putative uncharacterized protein Sb05g001860 n=1 Tax=Sorghum bicolor RepID=C5Y3Z5_SORBI Length = 270 Score = 78.6 bits (192), Expect = 2e-13 Identities = 46/113 (40%), Positives = 62/113 (54%) Frame = +2 Query: 179 GGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPR 358 GGGGA + L +W YL ALD PI TKA+T+ VL GD + Q++ + LDL R Sbjct: 86 GGGGAKDWRVFL-AW--YLMALDKNPIATKAVTSAVLTLAGDLICQLVIDQ-VPELDLRR 141 Query: 359 LFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 F F GL L P H WY L ++V + G G ++ DQ +FAP+F + Sbjct: 142 TFVFTFLGLALVAPTLHFWYLYLSKLVTISGAPGAIARLILDQFIFAPIFIGV 194 [28][TOP] >UniRef100_B4FIN2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FIN2_MAIZE Length = 351 Score = 78.6 bits (192), Expect = 2e-13 Identities = 48/161 (29%), Positives = 73/161 (45%), Gaps = 22/161 (13%) Frame = +2 Query: 101 GGGRGGGGGGGGGGGEGADESFSAAA--GGGGAGLGALLL-------------------- 214 GGG G G GGGGG + D + A G L LL Sbjct: 98 GGGAGSGASGGGGGNKMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPE 157 Query: 215 RSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQ 394 +W++Y +AL P+ K + +GV+ LGD +AQ G P+ + D R+FR G L Sbjct: 158 HNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKPIFDFDRARMFRSGLVGFTLH 217 Query: 395 GPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 G + H +Y++ E + + KVA DQ +++ ++ SI Sbjct: 218 GSLSHYYYHICEALFPFKDWWVVPAKVAFDQTIWSAIWNSI 258 [29][TOP] >UniRef100_A5BE71 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BE71_VITVI Length = 404 Score = 76.3 bits (186), Expect = 1e-12 Identities = 39/96 (40%), Positives = 57/96 (59%) Frame = +2 Query: 230 YLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGH 409 YL L+ P+ TKAIT+ L +GD + Q++ + +LDL R F F GLVL GP H Sbjct: 213 YLALLEKYPVLTKAITSAFLTLVGDLICQLVIDQ-VPSLDLKRTFLFTLLGLVLVGPTLH 271 Query: 410 AWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 WY L ++V +PG +G ++ DQ LF+P+F + Sbjct: 272 FWYLYLSKLVTIPGASGAFLRLLLDQFLFSPIFIGV 307 [30][TOP] >UniRef100_UPI0001A2BF4C Hypothetical protein. n=1 Tax=Danio rerio RepID=UPI0001A2BF4C Length = 354 Score = 76.3 bits (186), Expect = 1e-12 Identities = 34/58 (58%), Positives = 36/58 (62%), Gaps = 2/58 (3%) Frame = -1 Query: 222 QERRSRAPSPAP--PPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGG 55 +ERR+ AP P P PPPA A P PPP P PPPPP PPPP GGG PPAP G Sbjct: 101 RERRASAPPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSG 158 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGGGGGPPAPRDSGGVD 49 AP+ PPPP P PPPPPPP PP PPPP GGGG GG D Sbjct: 118 APASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGD 172 Score = 55.8 bits (133), Expect = 2e-06 Identities = 31/68 (45%), Positives = 35/68 (51%), Gaps = 21/68 (30%) Frame = +2 Query: 56 PPLSRGAGGPPPPPGGGGRGGGGGGGGGGGEGA---------------DES------FSA 172 PP S G P PPP GG GGGGGGGGGGG+G D+S SA Sbjct: 142 PPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAASA 201 Query: 173 AAGGGGAG 196 ++GGGG G Sbjct: 202 SSGGGGGG 209 [31][TOP] >UniRef100_A4QN64 Zgc:162320 protein n=1 Tax=Danio rerio RepID=A4QN64_DANRE Length = 412 Score = 76.3 bits (186), Expect = 1e-12 Identities = 34/58 (58%), Positives = 36/58 (62%), Gaps = 2/58 (3%) Frame = -1 Query: 222 QERRSRAPSPAP--PPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGG 55 +ERR+ AP P P PPPA A P PPP P PPPPP PPPP GGG PPAP G Sbjct: 159 RERRASAPPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSG 216 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGGGGGPPAPRDSGGVD 49 AP+ PPPP P PPPPPPP PP PPPP GGGG GG D Sbjct: 176 APASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGD 230 Score = 55.8 bits (133), Expect = 2e-06 Identities = 31/68 (45%), Positives = 35/68 (51%), Gaps = 21/68 (30%) Frame = +2 Query: 56 PPLSRGAGGPPPPPGGGGRGGGGGGGGGGGEGA---------------DES------FSA 172 PP S G P PPP GG GGGGGGGGGGG+G D+S SA Sbjct: 200 PPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAASA 259 Query: 173 AAGGGGAG 196 ++GGGG G Sbjct: 260 SSGGGGGG 267 [32][TOP] >UniRef100_C5YP25 Putative uncharacterized protein Sb08g016300 n=1 Tax=Sorghum bicolor RepID=C5YP25_SORBI Length = 231 Score = 75.9 bits (185), Expect = 2e-12 Identities = 49/159 (30%), Positives = 70/159 (44%) Frame = +2 Query: 41 LSSSTPPLSRGAGGPPPPPGGGGRGGGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRS 220 L SS PP S P PPP R G G A G GAG G + Sbjct: 36 LISSKPPPS----APLPPPVPPARPSPVGSAFGS---LSRKTGALGAGAGAGAGVV---G 85 Query: 221 WTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGP 400 W YL LD P+ TK++TA + + D +QML+ P + D R R A++G ++ GP Sbjct: 86 W--YLGVLDARPVLTKSVTAAAIFTVADLSSQMLSLGPEDSFDYLRTMRMASYGFLISGP 143 Query: 401 VGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 H W+N + + V K+ Q ++ P+ S+ Sbjct: 144 TLHLWFNFISKFFPKKDVVNTLKKMFLGQAVYGPIINSV 182 [33][TOP] >UniRef100_C5WU73 Putative uncharacterized protein Sb01g015680 n=1 Tax=Sorghum bicolor RepID=C5WU73_SORBI Length = 367 Score = 75.9 bits (185), Expect = 2e-12 Identities = 47/162 (29%), Positives = 72/162 (44%), Gaps = 22/162 (13%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEGADESFSAAA--GGGGAGLGALLL------------------- 214 GG G G G GGG G + D + A G L LL Sbjct: 112 GGSGSGSGASGGGDGNKMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMP 171 Query: 215 -RSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVL 391 +W++Y +AL P+ K + +GV+ LGD +AQ G P+ + D R+FR G L Sbjct: 172 EHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKPIFDFDRARMFRSGLVGFTL 231 Query: 392 QGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 G + H +Y++ E + + KVA DQ +++ ++ SI Sbjct: 232 HGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTIWSAIWNSI 273 [34][TOP] >UniRef100_Q75IB3 Os03g0583800 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q75IB3_ORYSJ Length = 358 Score = 74.3 bits (181), Expect = 4e-12 Identities = 49/165 (29%), Positives = 71/165 (43%), Gaps = 25/165 (15%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEG---ADESFSAAA--GGGGAGLGALLL---------------- 214 GGG GG GG G GGG+G D + A G L LL Sbjct: 101 GGGFAGGSGGAGAGGGDGNKMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILR 160 Query: 215 ----RSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFG 382 +W++Y +AL P+ K + +GV+ LGD +AQ G P+ D R+FR G Sbjct: 161 YMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKPIFEFDRARMFRSGLVG 220 Query: 383 LVLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 L G + H +Y+ E + + KV DQ ++ ++ SI Sbjct: 221 FTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWNSI 265 [35][TOP] >UniRef100_Q10HL5 Peroxisomal membrane protein, putative, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q10HL5_ORYSJ Length = 301 Score = 74.3 bits (181), Expect = 4e-12 Identities = 49/165 (29%), Positives = 71/165 (43%), Gaps = 25/165 (15%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEG---ADESFSAAA--GGGGAGLGALLL---------------- 214 GGG GG GG G GGG+G D + A G L LL Sbjct: 101 GGGFAGGSGGAGAGGGDGNKMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILR 160 Query: 215 ----RSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFG 382 +W++Y +AL P+ K + +GV+ LGD +AQ G P+ D R+FR G Sbjct: 161 YMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKPIFEFDRARMFRSGLVG 220 Query: 383 LVLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 L G + H +Y+ E + + KV DQ ++ ++ SI Sbjct: 221 FTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWNSI 265 [36][TOP] >UniRef100_Q10HL4 Peroxisomal membrane protein, putative, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q10HL4_ORYSJ Length = 306 Score = 74.3 bits (181), Expect = 4e-12 Identities = 49/165 (29%), Positives = 71/165 (43%), Gaps = 25/165 (15%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEG---ADESFSAAA--GGGGAGLGALLL---------------- 214 GGG GG GG G GGG+G D + A G L LL Sbjct: 101 GGGFAGGSGGAGAGGGDGNKMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILR 160 Query: 215 ----RSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFG 382 +W++Y +AL P+ K + +GV+ LGD +AQ G P+ D R+FR G Sbjct: 161 YMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKPIFEFDRARMFRSGLVG 220 Query: 383 LVLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 L G + H +Y+ E + + KV DQ ++ ++ SI Sbjct: 221 FTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWNSI 265 [37][TOP] >UniRef100_B8AL69 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AL69_ORYSI Length = 369 Score = 74.3 bits (181), Expect = 4e-12 Identities = 49/165 (29%), Positives = 71/165 (43%), Gaps = 25/165 (15%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEG---ADESFSAAA--GGGGAGLGALLL---------------- 214 GGG GG GG G GGG+G D + A G L LL Sbjct: 98 GGGFAGGSGGAGAGGGDGNKMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILR 157 Query: 215 ----RSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFG 382 +W++Y +AL P+ K + +GV+ LGD +AQ G P+ D R+FR G Sbjct: 158 YMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKPIFEFDRARMFRSGLVG 217 Query: 383 LVLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 L G + H +Y+ E + + KV DQ ++ ++ SI Sbjct: 218 FTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWNSI 262 [38][TOP] >UniRef100_Q2KIY1 Peroxisomal membrane protein 2 n=1 Tax=Bos taurus RepID=PXMP2_BOVIN Length = 196 Score = 73.2 bits (178), Expect = 1e-11 Identities = 45/116 (38%), Positives = 67/116 (57%), Gaps = 7/116 (6%) Frame = +2 Query: 191 AGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTP-----LGNLDLP 355 AGLG L R+ + YL+ L + P+ TKA T+G+L LG+ LAQ++ LD+ Sbjct: 12 AGLGPLPRRALSQYLRLLRLYPVLTKAATSGILSALGNFLAQLIEKKQKKENCSQKLDVS 71 Query: 356 RLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAG--KVAADQLLFAPVFTSI 517 R+A +G GP+GH +Y L+ER + P +AG ++ D+LLFAP F S+ Sbjct: 72 GPLRYAIYGFFFTGPLGHFFYLLMERWI--PSEVPLAGIKRLLLDRLLFAPAFLSL 125 [39][TOP] >UniRef100_B6U032 Mpv17 / PMP22 family protein n=1 Tax=Zea mays RepID=B6U032_MAIZE Length = 353 Score = 72.8 bits (177), Expect = 1e-11 Identities = 46/162 (28%), Positives = 71/162 (43%), Gaps = 22/162 (13%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEGADESFSAA--AGGGGAGLGALLL------------------- 214 GGG G GGGG G + D + A L LL Sbjct: 99 GGGAGSGASGGGGDGNKMLDRGINTAIVLAASTYALTKLLTVDQDYWHGWTIFEILRYMP 158 Query: 215 -RSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVL 391 +W++Y +AL P+ K + +GV+ LGD +AQ G P+ + D R+FR G L Sbjct: 159 EHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKPIFDFDRARMFRSGLVGFTL 218 Query: 392 QGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 G + H +Y++ E + + KVA DQ +++ ++ SI Sbjct: 219 HGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTVWSAIWNSI 260 [40][TOP] >UniRef100_UPI00015B4CDF PREDICTED: similar to ENSANGP00000013271 n=1 Tax=Nasonia vitripennis RepID=UPI00015B4CDF Length = 184 Score = 72.0 bits (175), Expect = 2e-11 Identities = 38/95 (40%), Positives = 51/95 (53%), Gaps = 1/95 (1%) Frame = +2 Query: 227 SYLKALDVAPIKTKAITAGVLVGLGDTLAQ-MLTGTPLGNLDLPRLFRFAAFGLVLQGPV 403 SY K L P+ ++ AGVL+GLGD +AQ + P+ +LD R +F G V+ GP Sbjct: 7 SYQKLLTRHPLGMQSFQAGVLMGLGDQIAQNFIEKRPVKDLDFMRTAKFFTIGFVIAGPA 66 Query: 404 GHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVF 508 WY +L+R G + KV DQ LFAP F Sbjct: 67 TRTWYGILDRHFGSKGATAVLKKVTCDQFLFAPTF 101 [41][TOP] >UniRef100_B6Q311 Actin associated protein Wsp1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q311_PENMQ Length = 627 Score = 71.6 bits (174), Expect = 3e-11 Identities = 47/138 (34%), Positives = 57/138 (41%), Gaps = 8/138 (5%) Frame = -1 Query: 459 PATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSIC-ASVSPRPTNT 283 P P SR+ HA P P R P +LP +P ++ AS+ P P Sbjct: 402 PPAPPSRSPA-----HAPPPPPPREVP-----------QLPPKIPHAVAPASIPPPPPAR 445 Query: 282 PAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPP-------PP 124 + L + +R + S AP P PPPP P PPPPP PP Sbjct: 446 APIAPPQLPPSNTRLVPPPPPAPSSGAPPPPPPPPPPPPSSGIPPPPPPPPPPPSSGAPP 505 Query: 123 PPPPRPPPPGGGGGPPAP 70 PPPP PPPP G PP P Sbjct: 506 PPPPPPPPPASSGAPPPP 523 Score = 67.0 bits (162), Expect = 7e-10 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 7/56 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGGGGPPAPRDSGG 55 P P PPPP + S AP PPPPPPP PPPP PPPPGG PP P GG Sbjct: 491 PPPPPPPPPS----SGAPPPPPPPPPPPASSGAPPPPPPPPPGGAAPPPLPSVGGG 542 [42][TOP] >UniRef100_C0NQ83 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NQ83_AJECG Length = 642 Score = 71.2 bits (173), Expect = 4e-11 Identities = 52/155 (33%), Positives = 61/155 (39%), Gaps = 17/155 (10%) Frame = -1 Query: 468 PAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRL--PSGVPVSICASVSPR 295 P +PG ++ HA P P P A+ + L P VPV + +P Sbjct: 376 PRREVSPGLPPALPPKIPHATPPPP-PPRPQASPTSTPQSQHLLPPQTVPVPLPVRPAPP 434 Query: 294 PTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP--- 124 PT+ PA A S P P PPPP A S+ P PPPPPPP Sbjct: 435 PTSAPAPPPPPPAPAPGPV------PSSSPTPPPPPPPPPAPAPASTGPVPPPPPPPTTG 488 Query: 123 ----PP--------PPRPPPPGGGGGPPAPRDSGG 55 PP PP PPPP GG PP P S G Sbjct: 489 LPRPPPRSAPSNSVPPPPPPPSGGAPPPPPPPSAG 523 Score = 66.6 bits (161), Expect = 1e-09 Identities = 53/155 (34%), Positives = 63/155 (40%), Gaps = 14/155 (9%) Frame = -1 Query: 492 SSWSAATLPAMPATP--------GSRTTRSNRLYHAWPTGPWR--TSPNAAKRNKRGRSR 343 SS S A P +PA P G R + +L P P R SP Sbjct: 335 SSGSNAARPGVPAPPLPPKTPLEGERKVSAPQLPSRNPVLPPRREVSPGLPPA------- 387 Query: 342 LPSGVPVSICASVSPRP----TNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPA 175 LP +P + PRP T+TP L+ L + AP+P PPPPA Sbjct: 388 LPPKIPHATPPPPPPRPQASPTSTPQSQHLLPPQTVPVPLPVRPAPPPTSAPAPPPPPPA 447 Query: 174 AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 A + SP PPPPPPPPP P P G PP P Sbjct: 448 PAPGPVPSSSPTPPPPPPPPPAPAPASTGPVPPPP 482 [43][TOP] >UniRef100_B3N3N0 GG24397 n=1 Tax=Drosophila erecta RepID=B3N3N0_DROER Length = 1462 Score = 70.9 bits (172), Expect = 5e-11 Identities = 35/76 (46%), Positives = 42/76 (55%), Gaps = 10/76 (13%) Frame = -1 Query: 252 ATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGG 91 +T+ A D ++ + AP P PPPP + AP PPPPPPP PPPP PPPPG Sbjct: 875 STNSAKDEDEEKPHAAAPPPPPPPPPPPAFAAPAPPPPPPPPPLANYGAPPPPPPPPPGS 934 Query: 90 GGG----PPAPRDSGG 55 G PPAP + GG Sbjct: 935 GSAPPPPPPAPLEGGG 950 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/50 (54%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 70 AP+P PPPP + AP PPPPPPP PPPP P P GGG P P Sbjct: 906 APAPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPLEGGGAIPPP 955 [44][TOP] >UniRef100_Q9FMG9 Similarity to 22 kDa peroxisomal membrane protein n=1 Tax=Arabidopsis thaliana RepID=Q9FMG9_ARATH Length = 248 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/96 (36%), Positives = 53/96 (55%) Frame = +2 Query: 230 YLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGH 409 YL+ L+ P TK+IT V+ D +QM+T P G+ DL R R A+FGL+ GP H Sbjct: 82 YLRKLESHPFMTKSITTSVIYMAADLTSQMITMEPTGSFDLIRTARMASFGLIFLGPSQH 141 Query: 410 AWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 W++ L +++ V K+ Q+LF PV ++ Sbjct: 142 LWFSYLSKILPKRDVLTTFKKIMMGQVLFGPVSNTV 177 [45][TOP] >UniRef100_Q8LEC1 Contains similarity to 22 kDa peroxisomal membrane protein n=1 Tax=Arabidopsis thaliana RepID=Q8LEC1_ARATH Length = 255 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/96 (36%), Positives = 53/96 (55%) Frame = +2 Query: 230 YLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGH 409 YL+ L+ P TK+IT V+ D +QM+T P G+ DL R R A+FGL+ GP H Sbjct: 83 YLRKLESHPFMTKSITTSVIYMAADLTSQMITMEPTGSFDLIRTARMASFGLIFLGPSQH 142 Query: 410 AWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 W++ L +++ V K+ Q+LF PV ++ Sbjct: 143 LWFSYLSKILPKRDVLTTFKKIMMGQVLFGPVSNTV 178 [46][TOP] >UniRef100_A0JQ86 At5g43140 n=1 Tax=Arabidopsis thaliana RepID=A0JQ86_ARATH Length = 254 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/96 (36%), Positives = 53/96 (55%) Frame = +2 Query: 230 YLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGH 409 YL+ L+ P TK+IT V+ D +QM+T P G+ DL R R A+FGL+ GP H Sbjct: 82 YLRKLESHPFMTKSITTSVIYMAADLTSQMITMEPTGSFDLIRTARMASFGLIFLGPSQH 141 Query: 410 AWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 W++ L +++ V K+ Q+LF PV ++ Sbjct: 142 LWFSYLSKILPKRDVLTTFKKIMMGQVLFGPVSNTV 177 [47][TOP] >UniRef100_A9V6E2 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V6E2_MONBE Length = 2389 Score = 70.5 bits (171), Expect = 7e-11 Identities = 35/68 (51%), Positives = 37/68 (54%), Gaps = 8/68 (11%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGG--PPAPRDSGGVDE 46 P P PPPP A S P PPPPPP PPPPP PPPPGG G PP P G Sbjct: 1217 PPPPPPPPGGA---SGPPPPPPPPPPGGASGPPPPPPPPPPGGASGPPPPPPPPPPGASS 1273 Query: 45 ERNSSGVD 22 NS+G+D Sbjct: 1274 GANSAGMD 1281 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 7/62 (11%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAPRDSGGVDE 46 A P PPPP +S P PPPPPP PPPPP PPPPG G +S G+D Sbjct: 1227 ASGPPPPPPPPPPGGASGPPPPPPPPPPGGASGPPPPPPPPPPGASSG----ANSAGMDA 1282 Query: 45 ER 40 R Sbjct: 1283 LR 1284 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 8/48 (16%) Frame = -1 Query: 189 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGG--------GPPAP 70 PPPP SSAPS PPPP PP PP PPPPG GG PP P Sbjct: 1326 PPPPPLPPTGSSAPSAPPPPGPPVPPGPPPPGVGGADVESMSRAPPPP 1373 Score = 55.1 bits (131), Expect = 3e-06 Identities = 44/144 (30%), Positives = 51/144 (35%), Gaps = 21/144 (14%) Frame = -1 Query: 402 TGPWRTSPNAAKRNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DV 223 +GP P G P P + P P P + A ALR + Sbjct: 1228 SGPPPPPPPPPPGGASGPPPPPPPPPPGGASGPPPPPPPPPPGASSGANSAGMDALRKQI 1287 Query: 222 QERRSR-------------APSPAPPPPAAAEKDSSAPSPPPPPPP--------PPPPRP 106 + RS P P PPPP ++AP PPPP PP PPPP P Sbjct: 1288 ERSRSTRSGSLSQLKQGAGGPPPPPPPPPPPVTGNAAPPPPPPLPPTGSSAPSAPPPPGP 1347 Query: 105 PPPGGGGGPPAPRDSGGVDEERNS 34 P P G P P GG D E S Sbjct: 1348 PVPPG----PPPPGVGGADVESMS 1367 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/33 (66%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = -1 Query: 150 PSPPPPPP------PPPPPRPPPPGGGGGPPAP 70 P PPPPPP PPPPP PPPPGG GPP P Sbjct: 1216 PPPPPPPPPGGASGPPPPPPPPPPGGASGPPPP 1248 [48][TOP] >UniRef100_C9S8M2 Cytokinesis protein sepA n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9S8M2_9PEZI Length = 842 Score = 70.5 bits (171), Expect = 7e-11 Identities = 39/109 (35%), Positives = 45/109 (41%), Gaps = 6/109 (5%) Frame = -1 Query: 378 NAAKRNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAP 199 N K+ S G + V+P T+TP + +V P Sbjct: 123 NKFKKYDASDSEDGEGTTMESAPLVTPAGTDTPKI---------------EVTSAAPPPP 167 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPP------GGGGGPPAP 70 P PPPP AP PPPPPPPPPPP PPPP GGGPP P Sbjct: 168 PPPPPPPPPMPGQGGAPPPPPPPPPPPPPPPPPPPMPGMLSPGGGPPPP 216 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP +P PPPPPPPPP PP PG G PP P Sbjct: 192 PPPPPPPPPPPMPGMLSPGGGPPPPPPPPPPPPMPGAPGMPPPP 235 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP PPPPPPPPPPP P PG PP P Sbjct: 195 PPPPPPPPMPGMLSPGGGPPPPPPPPPPPPMPGAPGMPPPPPPP 238 [49][TOP] >UniRef100_C8V0K5 Cytokinesis protein sepA (Forced expression inhibition of growth A)(Protein FH1/2) [Source:UniProtKB/Swiss-Prot;Acc:P78621] n=1 Tax=Aspergillus nidulans FGSC A4 RepID=C8V0K5_EMENI Length = 1789 Score = 70.5 bits (171), Expect = 7e-11 Identities = 32/63 (50%), Positives = 35/63 (55%), Gaps = 11/63 (17%) Frame = -1 Query: 225 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPP-----------PPPPPPPRPPPPGGGGGP 79 V + + P P PPPPA +AP PPPP PPPPPPP PPPPGG GGP Sbjct: 1008 VDKATAAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGP 1067 Query: 78 PAP 70 P P Sbjct: 1068 PPP 1070 Score = 70.5 bits (171), Expect = 7e-11 Identities = 31/54 (57%), Positives = 32/54 (59%), Gaps = 9/54 (16%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAP 70 AP P PPPP +AP PPPPPP PPPPP PPPPGG GGPP P Sbjct: 1032 APPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPP 1085 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 70 AP P PPPP P PPPPPPPP PPP PPPPGG GGPP P Sbjct: 1049 APPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPP 1098 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAPRDSGGV 52 P PPPP P PPPPPP PPPPP PPP G G PP P G V Sbjct: 1067 PPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPPGTV 1119 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/47 (51%), Positives = 27/47 (57%), Gaps = 12/47 (25%) Frame = -1 Query: 174 AAEKDSSAPSPPPP------------PPPPPPPRPPPPGGGGGPPAP 70 A +K ++AP PPPP PPPPPPP PPPPG G PP P Sbjct: 1007 AVDKATAAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPP 1053 [50][TOP] >UniRef100_C6HS16 Actin associated protein Wsp1 n=1 Tax=Ajellomyces capsulatus H143 RepID=C6HS16_AJECH Length = 610 Score = 70.5 bits (171), Expect = 7e-11 Identities = 56/163 (34%), Positives = 68/163 (41%), Gaps = 25/163 (15%) Frame = -1 Query: 468 PAMPA----TPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRL--PSGVPVSICAS 307 P +PA +PG ++ HA P P P A+ + L P VPV + Sbjct: 338 PVLPARREVSPGLPPALPPKIPHATPPPP-PPRPQASPTSTPQSQHLLPPQTVPVPLPVR 396 Query: 306 VSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPA----AAEKDSSAPSPP 139 +P PT+TPA A A S +P+P PPPP A S+ P PP Sbjct: 397 PAPPPTSTPAPPPPPPAPAPGPA--------PSSSPTPPPPPPPLPAPAPAPASTGPVPP 448 Query: 138 PPPPP-------PP--------PPRPPPPGGGGGPPAPRDSGG 55 PPPPP PP PP PPPP GG PP P S G Sbjct: 449 PPPPPTTGLPRPPPRSAPSNSVPPPPPPPSGGAPPPPPPPSAG 491 [51][TOP] >UniRef100_P78621 Cytokinesis protein sepA n=1 Tax=Emericella nidulans RepID=SEPA_EMENI Length = 1790 Score = 70.5 bits (171), Expect = 7e-11 Identities = 32/63 (50%), Positives = 35/63 (55%), Gaps = 11/63 (17%) Frame = -1 Query: 225 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPP-----------PPPPPPPRPPPPGGGGGP 79 V + + P P PPPPA +AP PPPP PPPPPPP PPPPGG GGP Sbjct: 1009 VDKATAAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGP 1068 Query: 78 PAP 70 P P Sbjct: 1069 PPP 1071 Score = 70.5 bits (171), Expect = 7e-11 Identities = 31/54 (57%), Positives = 32/54 (59%), Gaps = 9/54 (16%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAP 70 AP P PPPP +AP PPPPPP PPPPP PPPPGG GGPP P Sbjct: 1033 APPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPP 1086 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 70 AP P PPPP P PPPPPPPP PPP PPPPGG GGPP P Sbjct: 1050 APPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPP 1099 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAPRDSGGV 52 P PPPP P PPPPPP PPPPP PPP G G PP P G V Sbjct: 1068 PPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPPGTV 1120 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/47 (51%), Positives = 27/47 (57%), Gaps = 12/47 (25%) Frame = -1 Query: 174 AAEKDSSAPSPPPP------------PPPPPPPRPPPPGGGGGPPAP 70 A +K ++AP PPPP PPPPPPP PPPPG G PP P Sbjct: 1008 AVDKATAAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPP 1054 [52][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 70.1 bits (170), Expect = 9e-11 Identities = 37/96 (38%), Positives = 44/96 (45%), Gaps = 6/96 (6%) Frame = -1 Query: 339 PSGVPVSICASV------SPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPP 178 P G P CA+ P + + + L L A L +P P+PPPP Sbjct: 182 PPGYPSGFCAAAIFDTTCECCPISQASTLPLPLPNAPPSPLPPSPPPPPPPSPPPSPPPP 241 Query: 177 AAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S PSPPPPPPPPPPP PPPP PP+P Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 +P P PPPP + S P PPPPPPPPPPP PPPP PP P Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 64.7 bits (156), Expect = 4e-09 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P PPPP+ P PPPPPPPPPPP PPPP PP P Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 64.3 bits (155), Expect = 5e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP PSPPPPPPPPPPP PPPP PP P Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/50 (54%), Positives = 27/50 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGV 52 P P PPPP S P PPPPPPPPPPP PPPP PP D V Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQCSV 310 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S PSP PPPP P PPPPPP PPPP PPPP PP P Sbjct: 248 SPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P PPPP P PP PPPPPPPP PPPP PP P Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P P PPPPPPPPP PPPP PP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPP PPPP PP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP P PP P PPPPPPPPPP PPPP PP P Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 [53][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/51 (56%), Positives = 29/51 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVD 49 P P PPPP P PPPPPPPPPPP PPPP PP P GGVD Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVD 85 Score = 66.6 bits (161), Expect = 1e-09 Identities = 31/66 (46%), Positives = 34/66 (51%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGVD 22 P P PPPP P PPPPPPPPPPP PPPP PP P GG + R + Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVDCRQVWYLY 93 Query: 21 RRAPKA 4 R P+A Sbjct: 94 IRTPRA 99 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/49 (55%), Positives = 27/49 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGG 55 P P PPPP P PPPPPPPPPPP PPPP PP P GG Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGG 81 Score = 63.5 bits (153), Expect = 8e-09 Identities = 29/62 (46%), Positives = 29/62 (46%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGVD 22 P P PPPP P PPPPPPPPPPP PPPP PP P GVD Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVD 85 Query: 21 RR 16 R Sbjct: 86 CR 87 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 [54][TOP] >UniRef100_B4MTT1 GK23771 n=1 Tax=Drosophila willistoni RepID=B4MTT1_DROWI Length = 1512 Score = 69.7 bits (169), Expect = 1e-10 Identities = 34/66 (51%), Positives = 40/66 (60%), Gaps = 7/66 (10%) Frame = -1 Query: 228 DVQE--RRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPP----RPPPPG-GGGGPPAP 70 ++QE ++ AP P PPPP AA S+ P PPPPPPPPPPP PPPP GGPP P Sbjct: 919 EIQESNKQQTAPPPPPPPPPAAPTISAGPPPPPPPPPPPPPGIPAPPPPPNLSVGGPPPP 978 Query: 69 RDSGGV 52 G+ Sbjct: 979 PPPPGI 984 [55][TOP] >UniRef100_B4I348 GM18116 n=1 Tax=Drosophila sechellia RepID=B4I348_DROSE Length = 1519 Score = 69.7 bits (169), Expect = 1e-10 Identities = 31/66 (46%), Positives = 37/66 (56%), Gaps = 7/66 (10%) Frame = -1 Query: 246 SRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGG 88 + +L+ D + + AP P PPPP D+ P PPPPPPP PPPP PPPPG G Sbjct: 932 NESLKEDGDKPHAVAPPPPPPPPPPPAFDAPPPPPPPPPPPPLANYGAPPPPPPPPPGSG 991 Query: 87 GGPPAP 70 PP P Sbjct: 992 SAPPPP 997 Score = 57.0 bits (136), Expect = 8e-07 Identities = 29/72 (40%), Positives = 31/72 (43%), Gaps = 5/72 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAPRDSGGVDEERN 37 P P PPPP + P PPPPPP PPPPP P GG G PP P G + Sbjct: 964 PPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIQGGSGIPPPPPPLGASPSKTT 1023 Query: 36 SSGVDRRAPKAG 1 S P G Sbjct: 1024 ISPAPLPDPAEG 1035 [56][TOP] >UniRef100_A0DA74 Chromosome undetermined scaffold_43, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0DA74_PARTE Length = 1401 Score = 69.7 bits (169), Expect = 1e-10 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGG--PPAPRDSGGVDEERNSS 31 P P PPPP K SAP PPPPP P PP PPPP GG PP PR GG D + +S Sbjct: 870 PPPPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAPPLPPGPRPPGGPDPQFGAS 928 Score = 68.2 bits (165), Expect = 3e-10 Identities = 29/52 (55%), Positives = 29/52 (55%), Gaps = 8/52 (15%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP--------PPPPPRPPPPGGGGGPPAP 70 P P PPPP K P PPPPPP PPPPP PPPPGG G PP P Sbjct: 807 PPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPP 858 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/53 (58%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAP 70 R P P PPPP K SAP PPPPPP PPPPP PPPPG GPP P Sbjct: 823 RPPPPPPPPPPPGGK--SAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPP 873 Score = 63.9 bits (154), Expect = 6e-09 Identities = 32/59 (54%), Positives = 32/59 (54%), Gaps = 9/59 (15%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGG--GGGPPAPRDSGG 55 AP P PPPP K AP PPPPPP PPPPP PPPPG G PP P GG Sbjct: 839 APPPPPPPPPPGGK--GAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGG 895 [57][TOP] >UniRef100_B8CE52 Predicted protein (Fragment) n=1 Tax=Thalassiosira pseudonana CCMP1335 RepID=B8CE52_THAPS Length = 211 Score = 69.3 bits (168), Expect = 1e-10 Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 4/105 (3%) Frame = +2 Query: 212 LRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVL 391 L +W SY L++API+TKA+T+ + +GD +AQ G +G +D R+ R GL+ Sbjct: 39 LDNWRSYTNVLNMAPIQTKAVTSATVYTIGDMIAQRTEGRGMGEVDRWRVGRSLMAGLIG 98 Query: 392 QGPVGHAWYNLLE----RVVRLPGVAGIAGKVAADQLLFAPVFTS 514 GP+ H WY++ E + L KV DQ F P++ + Sbjct: 99 HGPMSHVWYHVSEDFFDNTLSLHAWWDFIPKVIVDQTFFGPIWNN 143 [58][TOP] >UniRef100_A9URK6 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9URK6_MONBE Length = 216 Score = 69.3 bits (168), Expect = 1e-10 Identities = 42/99 (42%), Positives = 57/99 (57%), Gaps = 2/99 (2%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 ++ SY +AL P+ TKAITAG++ + D AQ+L LD RL +F F ++L Sbjct: 2 AFRSYSRALQTQPVLTKAITAGIISMIADGAAQLLVEHAPA-LDWERLLKFGGFSMLLVA 60 Query: 398 PVGHAWYNLLERVVRLPGVA--GIAGKVAADQLLFAPVF 508 P+ H WYN+L R LPG A + +V ADQ LF P F Sbjct: 61 PLLHYWYNVLNRF--LPGAAFKTVLLRVFADQALFTPPF 97 [59][TOP] >UniRef100_UPI000175F433 PREDICTED: similar to formin-like 1 n=1 Tax=Danio rerio RepID=UPI000175F433 Length = 1102 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/56 (53%), Positives = 32/56 (57%), Gaps = 6/56 (10%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPPAPRDSGG 55 AP P PPPP ++ P PPPPPP PPPPP PPPPGGG PP P G Sbjct: 577 APPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSG 632 Score = 67.4 bits (163), Expect = 6e-10 Identities = 30/53 (56%), Positives = 32/53 (60%), Gaps = 6/53 (11%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGPPAP 70 S A +P PPPP + AP PPPPPPPP PPP PPPP GGGPP P Sbjct: 573 SPAAAPPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPP 625 Score = 64.3 bits (155), Expect = 5e-09 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 7/54 (12%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP--PPPPRPPPPGGG-----GGPPAP 70 + AP P PPPP + + P PPPPPPP PPP PPPPG G G PPAP Sbjct: 590 AEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAP 643 Score = 60.5 bits (145), Expect = 7e-08 Identities = 32/58 (55%), Positives = 32/58 (55%), Gaps = 10/58 (17%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGG----PPAPRDSGG 55 S APP PAAA P PPPPPP PPPPP PPPP G GG PP P GG Sbjct: 568 SQAPPSPAAAP-----PPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGG 620 [60][TOP] >UniRef100_UPI0001A2D69A UPI0001A2D69A related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D69A Length = 1058 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/56 (53%), Positives = 32/56 (57%), Gaps = 6/56 (10%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPPAPRDSGG 55 AP P PPPP ++ P PPPPPP PPPPP PPPPGGG PP P G Sbjct: 524 APPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSG 579 Score = 67.4 bits (163), Expect = 6e-10 Identities = 30/53 (56%), Positives = 32/53 (60%), Gaps = 6/53 (11%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGPPAP 70 S A +P PPPP + AP PPPPPPPP PPP PPPP GGGPP P Sbjct: 520 SPAAAPPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPP 572 Score = 64.3 bits (155), Expect = 5e-09 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 7/54 (12%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP--PPPPRPPPPGGG-----GGPPAP 70 + AP P PPPP + + P PPPPPPP PPP PPPPG G G PPAP Sbjct: 537 AEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAP 590 Score = 60.5 bits (145), Expect = 7e-08 Identities = 32/58 (55%), Positives = 32/58 (55%), Gaps = 10/58 (17%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGG----PPAPRDSGG 55 S APP PAAA P PPPPPP PPPPP PPPP G GG PP P GG Sbjct: 515 SQAPPSPAAAP-----PPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGG 567 [61][TOP] >UniRef100_A0D1C0 Chromosome undetermined scaffold_34, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D1C0_PARTE Length = 1131 Score = 69.3 bits (168), Expect = 1e-10 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 10/63 (15%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEK-DSSAPSPPPPPPPP-------PPPRPPPPG--GGGGPPAPRD 64 +S+ P P PPPP+ + ++SAP PPPPPPPP PPP PPPPG GG PP P Sbjct: 610 KSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPP 669 Query: 63 SGG 55 GG Sbjct: 670 PGG 672 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/93 (36%), Positives = 39/93 (41%), Gaps = 3/93 (3%) Frame = -1 Query: 339 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 160 P P S + V P P P+V + + AP P PPPP Sbjct: 602 PPPPPPSAKSQVPPPPPPPPSVP----------------KSTNNSAPPPPPPPPPPPGGK 645 Query: 159 SSAPSPPPPPPPPP---PPRPPPPGGGGGPPAP 70 + AP PPPPPP PP PPPP GG PP P Sbjct: 646 TGAPPPPPPPPGAKAGGPPPPPPPPGGKAPPLP 678 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/67 (43%), Positives = 30/67 (44%), Gaps = 15/67 (22%) Frame = -1 Query: 225 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP---------------PPPRPPPPGG 91 VQ +A P PPPP SA S PPPPPP PPP PPPPGG Sbjct: 585 VQAAPQKAAPPPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGG 644 Query: 90 GGGPPAP 70 G P P Sbjct: 645 KTGAPPP 651 [62][TOP] >UniRef100_C6HGV1 Cytokinesis protein SepA/Bni1 n=1 Tax=Ajellomyces capsulatus H143 RepID=C6HGV1_AJECH Length = 1711 Score = 69.3 bits (168), Expect = 1e-10 Identities = 31/54 (57%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPGGGGGPPAPRDSG 58 AP P PPPP S P PPPPPPPPP PP PPPPG GG PP P G Sbjct: 974 APPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPG 1027 Score = 67.0 bits (162), Expect = 7e-10 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAPRDSGGV 52 P P PPPP P PPPPPP PPPPP PPPP G GGPP P G+ Sbjct: 963 PPPPPPPPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGM 1016 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/58 (51%), Positives = 30/58 (51%), Gaps = 10/58 (17%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP----------PPPPPRPPPPGGGGGPPAPRDSG 58 P P PPPP AP PPPPPP PPPPP PPPPG GG PP P G Sbjct: 958 PGPPPPPPPPPPPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPG 1015 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 70 P PPPP P PPPPPP PPPPP PP G GG PP P Sbjct: 992 PPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPP 1037 [63][TOP] >UniRef100_C0NZQ8 Cytokinesis protein SepA/Bni1 n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NZQ8_AJECG Length = 1741 Score = 69.3 bits (168), Expect = 1e-10 Identities = 31/54 (57%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPGGGGGPPAPRDSG 58 AP P PPPP S P PPPPPPPPP PP PPPPG GG PP P G Sbjct: 1004 APPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPG 1057 Score = 67.0 bits (162), Expect = 7e-10 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAPRDSGGV 52 P P PPPP P PPPPPP PPPPP PPPP G GGPP P G+ Sbjct: 993 PPPPPPPPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGM 1046 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/58 (51%), Positives = 30/58 (51%), Gaps = 10/58 (17%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP----------PPPPPRPPPPGGGGGPPAPRDSG 58 P P PPPP AP PPPPPP PPPPP PPPPG GG PP P G Sbjct: 988 PGPPPPPPPPPPPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPG 1045 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 70 P PPPP P PPPPPP PPPPP PP G GG PP P Sbjct: 1022 PPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPP 1067 [64][TOP] >UniRef100_B8PFG8 Predicted protein n=1 Tax=Postia placenta Mad-698-R RepID=B8PFG8_POSPM Length = 476 Score = 68.9 bits (167), Expect = 2e-10 Identities = 52/163 (31%), Positives = 60/163 (36%), Gaps = 10/163 (6%) Frame = -1 Query: 468 PAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRG--RSRLPSGVPVSICASVSPR 295 P P P + R + A PT P +P + RS P+ P A PR Sbjct: 241 PQAPPPPPAAAPRPSPPRSAAPTPPRSAAPTPPRSAAPTPPRSAAPTPAPP---APPPPR 297 Query: 294 PTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPP----- 130 PT P A+ R PS PPPP P PPPPP Sbjct: 298 PTAAPPAPP---PPPARPAVAPPPPPTRPAPPSGGPPPPPPPAPSGGPPPPPPPPPPPPA 354 Query: 129 ---PPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGVDRRAP 10 PPPPPP PPPP GG PP P S+G+ AP Sbjct: 355 GGAPPPPPPPPPPPSGGMPPPPPPPPPAGGSPGPSAGLPAPAP 397 [65][TOP] >UniRef100_C5XYG8 Putative uncharacterized protein Sb04g008000 n=1 Tax=Sorghum bicolor RepID=C5XYG8_SORBI Length = 205 Score = 68.6 bits (166), Expect = 2e-10 Identities = 45/126 (35%), Positives = 63/126 (50%), Gaps = 1/126 (0%) Frame = +2 Query: 128 GGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDT 307 GG G GEG + GG G+L R+W YL L P++TK ITAG L G+ DT Sbjct: 5 GGAGRGEGKRD-------GGKGEEGSLARRAWRQYLLQLQQHPLRTKMITAGCLAGVSDT 57 Query: 308 LAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVR-LPGVAGIAGKVAAD 484 +AQ L+G ++ RL FG GP GH + +L+ + + IA KV + Sbjct: 58 VAQKLSG--YQKIEKRRLLLKMLFGFAYGGPFGHFLHKILDYIFQGKKDTKTIAKKVLLE 115 Query: 485 QLLFAP 502 Q+ +P Sbjct: 116 QVTSSP 121 [66][TOP] >UniRef100_A0D550 Chromosome undetermined scaffold_38, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D550_PARTE Length = 493 Score = 68.6 bits (166), Expect = 3e-10 Identities = 32/71 (45%), Positives = 40/71 (56%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEE 43 Q++ AP P PPPP K + P PPPPPPPPPPP PPPPG PPA + +D+ Sbjct: 357 QQQNKSAPPPPPPPPPPPPK-GAPPPPPPPPPPPPPPGPPPPGQLPPPPAGARAKLLDDL 415 Query: 42 RNSSGVDRRAP 10 + + R P Sbjct: 416 NTDNPLARLKP 426 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Frame = -1 Query: 186 PPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPPAP 70 PPP + S+ P PPPPPP PPPPP PPPP GPP P Sbjct: 353 PPPQQQQNKSAPPPPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPP 397 [67][TOP] >UniRef100_Q54SP2 Formin-B n=1 Tax=Dictyostelium discoideum RepID=FORB_DICDI Length = 1126 Score = 68.6 bits (166), Expect = 3e-10 Identities = 36/95 (37%), Positives = 41/95 (43%), Gaps = 4/95 (4%) Frame = -1 Query: 324 VSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPS 145 +S+ + P TN G TS + P P PPPPA P Sbjct: 515 LSVSVTTPPSDTN----------GTTSPPIEAPSSPSLGAPPPPPPPPPAPPVSGGGPPP 564 Query: 144 PPPPPPPP----PPPRPPPPGGGGGPPAPRDSGGV 52 PPPPPPP PPP PPPP GG PP P GG+ Sbjct: 565 PPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPPGGM 599 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/70 (45%), Positives = 35/70 (50%), Gaps = 4/70 (5%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPRDSGGVDEERN 37 AP P PPPP A P PPPPPPPP PP PPPP GGPP P G ++ Sbjct: 544 APPPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPPGGMKKPG 603 Query: 36 SSGVDRRAPK 7 + V PK Sbjct: 604 APAVPNLPPK 613 [68][TOP] >UniRef100_B8BXV6 Predicted protein (Fragment) n=1 Tax=Thalassiosira pseudonana CCMP1335 RepID=B8BXV6_THAPS Length = 194 Score = 68.2 bits (165), Expect = 3e-10 Identities = 42/114 (36%), Positives = 57/114 (50%), Gaps = 15/114 (13%) Frame = +2 Query: 221 WTSYLKALDVAPIKTKAITAGVLVGLGDTLAQML------------TGTPLGNLDLPRLF 364 WTSYL AL+ P+ K++TAGV++G D Q + T +D+ R Sbjct: 6 WTSYLNALESDPLLVKSVTAGVILGAADLSGQAIQQSLAKANSDDATTITDSGVDIARFL 65 Query: 365 RFAAFGLVLQGPVGHAWYNLLERVVRL---PGVAGIAGKVAADQLLFAPVFTSI 517 RFA FG +LQ P H +Y LL+ + P A KV DQ + AP+FT I Sbjct: 66 RFAFFGFILQAPWNHFYYLLLDGALPPTPDPFTATTGIKVLVDQFIQAPIFTVI 119 [69][TOP] >UniRef100_A2X2L3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2X2L3_ORYSI Length = 206 Score = 68.2 bits (165), Expect = 3e-10 Identities = 44/130 (33%), Positives = 65/130 (50%), Gaps = 1/130 (0%) Frame = +2 Query: 116 GGGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVG 295 G GG G GGEG + G+L R+W YL+ L + P++TK ITAG L G Sbjct: 9 GRGGVRGRGGEGEE--------------GSLARRAWRQYLRQLQLHPLRTKMITAGCLAG 54 Query: 296 LGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVR-LPGVAGIAGK 472 + D++AQ L+G ++ RL FG GP GH + +L+ + + IA K Sbjct: 55 VSDSVAQKLSG--YQRIEKRRLLLKMLFGFAYGGPFGHFLHKVLDYIFKGKKDTKTIAKK 112 Query: 473 VAADQLLFAP 502 V +Q+ +P Sbjct: 113 VLLEQITSSP 122 [70][TOP] >UniRef100_A8NN84 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NN84_COPC7 Length = 550 Score = 68.2 bits (165), Expect = 3e-10 Identities = 48/147 (32%), Positives = 56/147 (38%), Gaps = 6/147 (4%) Frame = -1 Query: 492 SSWSAATLPAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSIC 313 SS ++A PA P P + P P R PN A R P Sbjct: 309 SSVASAPPPAPPRRPAVSSPNP-------PPPPSRPQPNGAAATPPPPPRRP-------- 353 Query: 312 ASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPP 133 A +P P P V + + ++ P P PPPP AP PPPP Sbjct: 354 ALSNPAPPPRPPVPTRAVAEEDTTSV-----STPPPPPPPPPPPPGPPAATGGAPPPPPP 408 Query: 132 PP------PPPPPRPPPPGGGGGPPAP 70 PP PPPPP PPPP GG PP P Sbjct: 409 PPPPGGAAPPPPPPPPPPPGGAVPPPP 435 Score = 65.9 bits (159), Expect = 2e-09 Identities = 50/155 (32%), Positives = 66/155 (42%), Gaps = 21/155 (13%) Frame = -1 Query: 456 ATPGSRTTRSNRLYHAWPTGPWRTSPNA-----AKRNKRGRSRLPSGVPVSICASVSPRP 292 ++ G T +N A P+ P P A+ + + P S+ ++ P P Sbjct: 260 SSAGDHTPIANGRPPAPPSRPQTLEPPQPPRPPARPSSASKPPAPPRPVSSVASAPPPAP 319 Query: 291 TNTPAVMALVLMGATSR------ALR*DVQERRSRAPSPAPPPP------AAAEKDSSAP 148 PAV + SR A RR +PAPPP A AE+D+++ Sbjct: 320 PRRPAVSSPNPPPPPSRPQPNGAAATPPPPPRRPALSNPAPPPRPPVPTRAVAEEDTTSV 379 Query: 147 SPPPPPPPPPPPRPPPPGGGGG----PPAPRDSGG 55 S PPPPPPPPPP P PP GG PP P GG Sbjct: 380 STPPPPPPPPPPPPGPPAATGGAPPPPPPPPPPGG 414 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/50 (56%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPP------PPRPPPPGGGGGPPA 73 AP P PPPP +AP PPPPPPPPP PP PPPP GG G P+ Sbjct: 402 APPPPPPPPPPG---GAAPPPPPPPPPPPGGAVPPPPPPPPPAGGSGAPS 448 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPA 73 P P PPPP P PPPPP PPPPP PPP GG G P A Sbjct: 404 PPPPPPPPPGGAAPPPPPPPPPPPGGAVPPPPPPPPPAGGSGAPSA 449 [71][TOP] >UniRef100_A1CMR3 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus clavatus RepID=A1CMR3_ASPCL Length = 642 Score = 68.2 bits (165), Expect = 3e-10 Identities = 29/49 (59%), Positives = 30/49 (61%), Gaps = 4/49 (8%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 70 A P PPPP +S P PPPPPPPP PPPRPPPP GGPP P Sbjct: 475 AVPPPPPPPPPPPPSASIPPPPPPPPPPVSHVPPPRPPPPPSSGGPPPP 523 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 5/56 (8%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPGGGGGPPAPRDSG 58 S P P PPPP + S P PPPPPPP P PP PPPP GG P P+ +G Sbjct: 504 SHVPPPRPPPPPS----SGGPPPPPPPPPAPGGFAPPPPPPPPPGGAAPHLPQPAG 555 Score = 60.1 bits (144), Expect = 9e-08 Identities = 41/100 (41%), Positives = 44/100 (44%), Gaps = 6/100 (6%) Frame = -1 Query: 351 RSRLPSGVPVSICASVSPR-PTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPA 175 RS P G P PR P P + V TS A R+ SP PPPP Sbjct: 406 RSPAPPGPPPP-----PPRSPATPPQLPPKVPHAPTSAAGPPPPPPARNPISSPPPPPPV 460 Query: 174 AAEKDSSAPSPPPP-----PPPPPPPRPPPPGGGGGPPAP 70 A +S P PPPP PPPPPPP PPPP PP P Sbjct: 461 PA---ASRPIPPPPAASAVPPPPPPPPPPPPSASIPPPPP 497 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/52 (48%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAPRDSGG 55 P P PPPP + P PPP PPPPPPP P P G PP P GG Sbjct: 494 PPPPPPPPPVSHVPPPRPPPPPSSGGPPPPPPPPPAPGGFAPPPPPPPPPGG 545 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/58 (46%), Positives = 29/58 (50%), Gaps = 14/58 (24%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP----------PPP----PPPPPRPPPPGGGGGPPAP 70 P P PPPP+A+ P PPP PPP PPPPP PPP GG PP P Sbjct: 481 PPPPPPPPSASIPPPPPPPPPPVSHVPPPRPPPPPSSGGPPPPPPPPPAPGGFAPPPP 538 [72][TOP] >UniRef100_A3AJX8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3AJX8_ORYSJ Length = 332 Score = 67.8 bits (164), Expect = 4e-10 Identities = 43/136 (31%), Positives = 59/136 (43%), Gaps = 25/136 (18%) Frame = +2 Query: 98 GGGGRGGGGGGGGGGGEG---ADESFSAAA--GGGGAGLGALLL---------------- 214 GGG GG GG G GGG+G D + A G L LL Sbjct: 98 GGGFAGGSGGAGAGGGDGNKMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILR 157 Query: 215 ----RSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFG 382 +W++Y +AL P+ K + +GV+ LGD +AQ G P+ D R+FR G Sbjct: 158 YMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKPIFEFDRARMFRSGLVG 217 Query: 383 LVLQGPVGHAWYNLLE 430 L G + H +Y+ E Sbjct: 218 FTLHGSLSHYYYHFCE 233 [73][TOP] >UniRef100_A3CE59 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3CE59_ORYSJ Length = 929 Score = 67.8 bits (164), Expect = 4e-10 Identities = 36/76 (47%), Positives = 44/76 (57%), Gaps = 2/76 (2%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVD 49 ++++R R P P P P A A S+ P PPP PP PPP PPPPG GGPP P G Sbjct: 588 NIEKRAPRVPRPPPAPSATANTASALPPPPPRPPGAPPP-PPPPGKPGGPPPPPPRPG-S 645 Query: 48 EERNSSGVDR--RAPK 7 RN +G D+ RAP+ Sbjct: 646 LPRNLAGGDKVHRAPE 661 [74][TOP] >UniRef100_A0DEW5 Chromosome undetermined scaffold_48, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0DEW5_PARTE Length = 1120 Score = 67.8 bits (164), Expect = 4e-10 Identities = 31/56 (55%), Positives = 34/56 (60%), Gaps = 9/56 (16%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPG--GGGGPPAPRDSGG 55 PAPPPP A+ ++ P PPPPPP PPPPP PPPPG GG PP P GG Sbjct: 606 PAPPPPPGAKTNAPPPPPPPPPPPGAKTGAPPPPPPPPPPGAKAGGPPPPPPPPGG 661 Score = 65.1 bits (157), Expect = 3e-09 Identities = 28/53 (52%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 70 ++ AP P PPPP + AP PPPPPPPP PP PPPP GG PP P Sbjct: 615 KTNAPPPPPPPPPPPGAKTGAPPPPPPPPPPGAKAGGPPPPPPPPGGKAPPLP 667 Score = 60.5 bits (145), Expect = 7e-08 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = -1 Query: 192 APPPPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGGPPAP 70 APPPP S P+PPPPP PPPPPP PPPPG G P P Sbjct: 592 APPPPPPPSLQSQVPAPPPPPGAKTNAPPPPPPPPPPPGAKTGAPPP 638 [75][TOP] >UniRef100_B6HQ39 Pc22g23920 protein n=1 Tax=Penicillium chrysogenum Wisconsin 54-1255 RepID=B6HQ39_PENCW Length = 662 Score = 67.8 bits (164), Expect = 4e-10 Identities = 29/53 (54%), Positives = 32/53 (60%), Gaps = 3/53 (5%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPP---PPRPPPPGGGGGPPAPRDSGGVDE 46 P PPPPA A + P PPPPPP P P PPPP GG PP P+ SGG D+ Sbjct: 525 PPPPPPAPASRAPGGPPPPPPPPGAPGGGAPPPPPPAGGAAPPLPKPSGGRDD 577 Score = 62.0 bits (149), Expect = 2e-08 Identities = 53/170 (31%), Positives = 60/170 (35%), Gaps = 27/170 (15%) Frame = -1 Query: 483 SAATLPAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSICASV 304 S + P P P RT A P P + P + P+ PVS Sbjct: 402 SRSPAPGGPPPPPPRT--------ASPAAPPQLPPKVPPMSTTTGPPPPARGPVSPPLPP 453 Query: 303 SPRPTNTPAVMALVLM-------GATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPS 145 P P PA + G S S + P PPPP AA P Sbjct: 454 PPAPRPVPAAPSSPAAPPPPPPRGPVSPPPAPPSAPTYSPSVPPPPPPPGAAAPGGPPPP 513 Query: 144 PPP---------PPPPP---------PPPRPPPPG--GGGGPPAPRDSGG 55 PPP PPPPP PPP PPPPG GGG PP P +GG Sbjct: 514 PPPGRGGPSIPPPPPPPAPASRAPGGPPPPPPPPGAPGGGAPPPPPPAGG 563 Score = 53.9 bits (128), Expect = 6e-06 Identities = 48/157 (30%), Positives = 55/157 (35%), Gaps = 13/157 (8%) Frame = -1 Query: 501 GAKSSWSAATLPAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPV 322 G +S + P P SR+ P GP P A + +LP VP Sbjct: 383 GVPPPFSGDRKVSAPPAPPSRSPA--------PGGPPPPPPRTA--SPAAPPQLPPKVPP 432 Query: 321 SICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAP-- 148 + P P P L A V S +P PPPP AP Sbjct: 433 MSTTTGPPPPARGPVSPPLPPPPAPR-----PVPAAPSSPAAPPPPPPRGPVSPPPAPPS 487 Query: 147 ----SPPPPPPPPPP-------PRPPPPGGGGGPPAP 70 SP PPPPPPP P PPPP G GGP P Sbjct: 488 APTYSPSVPPPPPPPGAAAPGGPPPPPPPGRGGPSIP 524 [76][TOP] >UniRef100_A1DL75 Actin associated protein Wsp1, putative n=1 Tax=Neosartorya fischeri NRRL 181 RepID=A1DL75_NEOFI Length = 638 Score = 67.8 bits (164), Expect = 4e-10 Identities = 29/52 (55%), Positives = 32/52 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDE 46 P P PPPPA SAP PPPPPP P PPPP GG PP P+ +GG D+ Sbjct: 511 PPPPPPPPAPG---GSAPPPPPPPPGASAPPPPPPAGGAAPPLPKPTGGRDD 559 Score = 55.1 bits (131), Expect = 3e-06 Identities = 41/117 (35%), Positives = 45/117 (38%), Gaps = 23/117 (19%) Frame = -1 Query: 351 RSRLPSGVPVSICASVSPR-PTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPA 175 RS P G P PR P P + V TS A R+ P PAPPP Sbjct: 402 RSSAPPGPPPP-----PPRSPATPPQLPPKVPYAPTSAAGPPPPPPARNPVPPPAPPPVP 456 Query: 174 AAEKDSSAPS-----------------PPPPPPP-----PPPPRPPPPGGGGGPPAP 70 AA + + P PPPPPPP PP P PPPP GPP P Sbjct: 457 AASRPTPPPPATSAVPPPPPPPSASVPPPPPPPPPASAGPPAPPPPPPPSIAGPPPP 513 [77][TOP] >UniRef100_B7G896 Predicted protein (Fragment) n=1 Tax=Phaeodactylum tricornutum CCAP 1055/1 RepID=B7G896_PHATR Length = 174 Score = 67.4 bits (163), Expect = 5e-10 Identities = 42/105 (40%), Positives = 51/105 (48%), Gaps = 2/105 (1%) Frame = +2 Query: 209 LLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLV 388 L R++ Y LD P+ TK IT+G++ G GD L Q L D R RFA G V Sbjct: 1 LRRAFVWYANKLDTHPLLTKGITSGIIAGSGDFLCQTLISNRDDVWDHARTGRFALLGTV 60 Query: 389 LQGPVGHAWYNLLERVVRLPGVAG--IAGKVAADQLLFAPVFTSI 517 L P H WY L R PG IA +V DQ +F PVF + Sbjct: 61 LVAPAIHVWYGAL--AARWPGTKATVIATRVFWDQFIFTPVFLPV 103 [78][TOP] >UniRef100_B6TFH7 Peroxisomal membrane protein PMP22 n=1 Tax=Zea mays RepID=B6TFH7_MAIZE Length = 203 Score = 67.4 bits (163), Expect = 5e-10 Identities = 40/109 (36%), Positives = 58/109 (53%), Gaps = 1/109 (0%) Frame = +2 Query: 179 GGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPR 358 G GG G G+L R+W YL L P++TK ITAG L G+ D++AQ L+G ++ R Sbjct: 13 GDGGKGEGSLARRAWRQYLLQLQQHPLRTKMITAGCLAGVSDSVAQKLSG--FQKIEKRR 70 Query: 359 LFRFAAFGLVLQGPVGHAWYNLLERVVR-LPGVAGIAGKVAADQLLFAP 502 L FG GP GH + +L+ + + IA KV +Q+ +P Sbjct: 71 LLLKMLFGFAYGGPFGHFLHKILDYIFQGKKDTKTIAKKVLLEQVTSSP 119 [79][TOP] >UniRef100_A7PEP1 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PEP1_VITVI Length = 217 Score = 67.4 bits (163), Expect = 5e-10 Identities = 39/116 (33%), Positives = 58/116 (50%), Gaps = 18/116 (15%) Frame = +2 Query: 209 LLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLG------------NLDL 352 +L +W Y + + + P+KT+ I++G+L G+GD AQ +T + +D Sbjct: 1 MLNAWKWYQRCMSLHPVKTQVISSGILWGVGDITAQSITHSSARKRLQISDAGQDFKIDW 60 Query: 353 PRLFRFAAFGLVLQGPVGHAWYNLLERVVRL------PGVAGIAGKVAADQLLFAP 502 R + FG GPVGH WY L+R +RL V +A KVA D L+F P Sbjct: 61 KRTAITSMFGFGFVGPVGHFWYEGLDRFIRLRLLLQPASVRFVASKVAMDSLIFGP 116 [80][TOP] >UniRef100_B4NYG5 GE14785 n=1 Tax=Drosophila yakuba RepID=B4NYG5_DROYA Length = 1458 Score = 67.4 bits (163), Expect = 6e-10 Identities = 29/57 (50%), Positives = 33/57 (57%), Gaps = 6/57 (10%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 70 ++ + AP P PPPP + AP PPPPPPP PPPP PPPPG G PP P Sbjct: 880 EKPHASAPPPPPPPPPPPAFVAPAPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 936 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/52 (53%), Positives = 30/52 (57%), Gaps = 7/52 (13%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPP-------PPPPPPRPPPPGGGGGPPAP 70 AP+P PPPP + AP PPPPP PPPPPP P P GGG PP P Sbjct: 901 APAPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPAPEGGGAIPPPP 952 [81][TOP] >UniRef100_A9V1R7 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V1R7_MONBE Length = 1099 Score = 67.4 bits (163), Expect = 6e-10 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 70 A +P PPPP AP PPPPPPP PPPP PPPPGG GG P P Sbjct: 396 ASAPPPPPPPPPGVSGGAPPPPPPPPPGGSGGAPPPPPPPPPGGSGGAPPP 446 Score = 63.9 bits (154), Expect = 6e-09 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGGPPAPRDSGGV 52 AP P PPPP + P PPPPP PPPPPP PPP G GG PP P GV Sbjct: 398 APPPPPPPPPGVSGGAPPPPPPPPPGGSGGAPPPPPP-PPPGGSGGAPPPPPPPPGV 453 Score = 60.8 bits (146), Expect = 5e-08 Identities = 30/56 (53%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAPRDSGGV 52 AP P PPPP AP PPPPPPP PPP PPPPG G P AP GV Sbjct: 413 APPPPPPPPPGG--SGGAPPPPPPPPPGGSGGAPPPPPPPPGVPGAPGAPPPPPGV 466 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/75 (40%), Positives = 35/75 (46%), Gaps = 17/75 (22%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP-----------PPPPRPPPPGGGGG 82 DV +AP P PPA +++ + PPPP PPPP PPPPGG GG Sbjct: 368 DVFAEPPKAPMPPTAPPAPGGPEATGTTASAPPPPPPPPPGVSGGAPPPPPPPPPGGSGG 427 Query: 81 ------PPAPRDSGG 55 PP P SGG Sbjct: 428 APPPPPPPPPGGSGG 442 [82][TOP] >UniRef100_A3LVW7 Predicted protein n=1 Tax=Pichia stipitis RepID=A3LVW7_PICST Length = 795 Score = 67.4 bits (163), Expect = 6e-10 Identities = 47/154 (30%), Positives = 63/154 (40%), Gaps = 5/154 (3%) Frame = -1 Query: 471 LPAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSICASVSPRP 292 +P +P+ P SR + + P + P +A G LPSG P + P P Sbjct: 188 VPPIPSMPSSRPSHRKTSSSSIPPSGVPSIPPSAPPLPAGAPPLPSGAP-PVPTGAPPPP 246 Query: 291 TNTPAVMALVLMGATSRALR*D----VQERRSRAPSPAPPP-PAAAEKDSSAPSPPPPPP 127 + S+ L+ + + R SP PPP P+ A +PPPPP Sbjct: 247 VSGKMPKLPPSRPKKSQHLKSESISSIGSFEERRTSPIPPPLPSGAPPIPGHSAPPPPPG 306 Query: 126 PPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGV 25 PPPPP PPPP G PP P S SG+ Sbjct: 307 PPPPPGPPPPPGPPPPPGPAPSLSAGSTPKISGL 340 [83][TOP] >UniRef100_B7G8P1 Predicted protein n=1 Tax=Phaeodactylum tricornutum CCAP 1055/1 RepID=B7G8P1_PHATR Length = 185 Score = 67.0 bits (162), Expect = 7e-10 Identities = 39/98 (39%), Positives = 51/98 (52%), Gaps = 2/98 (2%) Frame = +2 Query: 221 WTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGP 400 W Y LD P+ TKA+T+ LGD LAQ D R FR +FG +L G Sbjct: 5 WARYNSMLDAQPLLTKALTSMTGFSLGDILAQCFIEEGDKGYDPMRTFRMGSFGFLLHGT 64 Query: 401 VGHAWYNLLERVVRLPGVA--GIAGKVAADQLLFAPVF 508 GH +Y L+ +LPG A +A KVA DQ ++ P+F Sbjct: 65 TGHYFYGFLDS--KLPGTAPMTVASKVAIDQTIWNPIF 100 [84][TOP] >UniRef100_A7NXF2 Chromosome chr5 scaffold_2, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7NXF2_VITVI Length = 185 Score = 67.0 bits (162), Expect = 7e-10 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 1/100 (1%) Frame = +2 Query: 206 LLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGL 385 L+ +W +YL L + P++TKAITAGVLVG D +AQ ++G + L L RL +G Sbjct: 4 LIKAAWRNYLLQLQLHPLRTKAITAGVLVGCSDVIAQKISG--IKRLQLRRLILMMLYGF 61 Query: 386 VLQGPVGHAWYNLLERVVR-LPGVAGIAGKVAADQLLFAP 502 GP GH + L++ + R +A KV +QL +P Sbjct: 62 AYSGPFGHFLHKLMDIIFRGKKDNTTVAKKVVLEQLTSSP 101 [85][TOP] >UniRef100_A5B7D3 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B7D3_VITVI Length = 185 Score = 67.0 bits (162), Expect = 7e-10 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 1/100 (1%) Frame = +2 Query: 206 LLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGL 385 L+ +W +YL L + P++TKAITAGVLVG D +AQ ++G + L L RL +G Sbjct: 4 LIKAAWRNYLLQLQLHPLRTKAITAGVLVGCSDVIAQKISG--IKRLQLRRLILMMLYGF 61 Query: 386 VLQGPVGHAWYNLLERVVR-LPGVAGIAGKVAADQLLFAP 502 GP GH + L++ + R +A KV +QL +P Sbjct: 62 AYSGPFGHFLHKLMDIIFRGKKDNTTVAKKVVLEQLTSSP 101 [86][TOP] >UniRef100_UPI00016E98C2 UPI00016E98C2 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E98C2 Length = 500 Score = 67.0 bits (162), Expect = 7e-10 Identities = 30/48 (62%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPP-PGGGGGPPAP 70 SRAP APPPP + SAP PPPPP PPPP PP P GGG PP P Sbjct: 324 SRAPISAPPPPPPSRPGISAPPPPPPPSRPPPPPPPSIPSGGGAPPPP 371 Score = 60.5 bits (145), Expect = 7e-08 Identities = 27/49 (55%), Positives = 29/49 (59%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVD 49 P PPPP + AP PPPPPPPPPPP PPPP PP D+ G D Sbjct: 353 PPPPPPPSIPSGGGAP-PPPPPPPPPPPGPPPP----APPPTSDANGGD 396 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/94 (36%), Positives = 40/94 (42%), Gaps = 6/94 (6%) Frame = -1 Query: 339 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 160 PS P+S + P P + P + A SR P P PPP + Sbjct: 323 PSRAPIS---APPPPPPSRPGISAPPPPPPPSR-------------PPPPPPPSIPSGGG 366 Query: 159 SSAPSPPPPPPPPPPPRPPPP------GGGGGPP 76 + P PPPPPPPP PP P PP GG GPP Sbjct: 367 APPPPPPPPPPPPGPPPPAPPPTSDANGGDAGPP 400 [87][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 67.0 bits (162), Expect = 7e-10 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP A AP PPPPP PPPPP PPPP PPAP Sbjct: 625 PPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAP 668 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P+PAPPP A + P+PPPPPPPPPPP PPPP PP P Sbjct: 605 PAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPP 648 Score = 64.3 bits (155), Expect = 5e-09 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSS-APSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PAPPPP A + AP P PPPPPPPPP PPPP PPAP Sbjct: 646 PPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAP 690 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP--PPPPPRPPPPGGGGGPPAP 70 AP PAP PPA A + P PPPPPP PPPPP PPPP PP P Sbjct: 608 APPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPP 654 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 AP PAPPPP AP PPP PPPPPPP PPPP PPAP Sbjct: 619 APPPAPPPPPPPPPPP-APPPPPAPPPPPPPAPPPPPAPPPPPAP 662 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP-PPPPPRPPPPGGGGGPPA 73 P PAPPPP A + P PPPPPP PPPPP PPPP PPA Sbjct: 652 PPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPPPPA 695 Score = 60.5 bits (145), Expect = 7e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PAP PP A + AP P PPPPPPPPP P PP PP P Sbjct: 603 PPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPP 646 Score = 60.1 bits (144), Expect = 9e-08 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 ++P P PPP A + P+P PPP PPPPP PPPP PPAP Sbjct: 597 QSPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAP 642 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PAPPPP A P+PPPPP PPPPP P PP PP P Sbjct: 632 PPPAPPPPPAPPPPPP-PAPPPPPAPPPPPAPAPPPAPPPPPPP 674 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP-PPPRPPPPGGGGGPPAP 70 P+P PPPP A + P PP P PPP PPP PPPP PPAP Sbjct: 640 PAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAP 684 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 6/58 (10%) Frame = -1 Query: 225 VQERRSRAP-SPAPPPPAAAEKDSS----APSPPPPPPPPPPPRPPP-PGGGGGPPAP 70 +Q S P SP PPPP A + AP+PPP PPPPPPP PPP P PP P Sbjct: 588 IQRAESMMPQSPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPP 645 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPP-PPRPPPPGGGGGPPAP 70 P P PPPPA + P PPP PPPPP PP PP P PP P Sbjct: 627 PPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPP 671 [88][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 67.0 bits (162), Expect = 7e-10 Identities = 27/51 (52%), Positives = 29/51 (56%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 Q R + +P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 38 QSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/52 (50%), Positives = 29/52 (55%) Frame = -1 Query: 225 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 +Q+ R+ P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 36 LQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 44 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 P P PPPP P PPPPPPPPPPP PPPP PP P+ Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP P P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPADP 105 Score = 58.5 bits (140), Expect = 3e-07 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPA 73 P P PPPP P PPPPPPPPPPP PPP PP+ Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPADPPS 107 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PP ++ +A SPPPPPPPPPPP PPPP PP P Sbjct: 28 PIFPPSLFLQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPP 69 [89][TOP] >UniRef100_Q1E467 Putative uncharacterized protein n=1 Tax=Coccidioides immitis RepID=Q1E467_COCIM Length = 1705 Score = 67.0 bits (162), Expect = 7e-10 Identities = 36/86 (41%), Positives = 43/86 (50%), Gaps = 10/86 (11%) Frame = -1 Query: 297 RPTNTPAVMALVLMGATSRALR*DVQERRSRAP----SPAPPPPAAAEKDSSAPSPPPPP 130 RP P +L S+A + D + P SPAP PAA ++ + P PPPPP Sbjct: 927 RPRMNPEQATGLLNELASKAEKVDQTDEEEETPKPDSSPAPEKPAAKQEGFNGPPPPPPP 986 Query: 129 P------PPPPPRPPPPGGGGGPPAP 70 P PPPPP PP PG GGPP P Sbjct: 987 PLPGFSGPPPPPPPPLPGFSGGPPPP 1012 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/51 (52%), Positives = 27/51 (52%), Gaps = 7/51 (13%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAP 70 P P PPPP S P PPPPPP PPPPP PP PG GG P P Sbjct: 980 PPPPPPPPLPG---FSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPP 1027 [90][TOP] >UniRef100_B7GCZ9 Predicted protein n=1 Tax=Phaeodactylum tricornutum CCAP 1055/1 RepID=B7GCZ9_PHATR Length = 187 Score = 66.6 bits (161), Expect = 9e-10 Identities = 37/99 (37%), Positives = 53/99 (53%), Gaps = 2/99 (2%) Frame = +2 Query: 227 SYLKALDVAPIKTKAITAGVLVGLGDTLAQML--TGTPLGNLDLPRLFRFAAFGLVLQGP 400 +Y +LD PI TK++TAG + + D LAQ L +G+ ++ RL AA GL GP Sbjct: 11 AYASSLDARPILTKSVTAGCIFAVSDYLAQRLESSGSRERKINPTRLLTSAAVGLFYFGP 70 Query: 401 VGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 HAWYN++ +++ + K QL F P FT I Sbjct: 71 AAHAWYNMIFQLLPGTSLVSTLQKAVMGQLFFGPSFTCI 109 [91][TOP] >UniRef100_B6UFM9 Peroxisomal membrane protein PMP22 n=1 Tax=Zea mays RepID=B6UFM9_MAIZE Length = 203 Score = 66.6 bits (161), Expect = 9e-10 Identities = 40/109 (36%), Positives = 58/109 (53%), Gaps = 1/109 (0%) Frame = +2 Query: 179 GGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPR 358 G GG G G+L R+W+ YL L P++TK ITAG L G+ D++AQ L+G ++ R Sbjct: 13 GDGGKGEGSLARRAWSQYLLQLQQHPLRTKMITAGCLAGVSDSVAQKLSG--FQKIEKRR 70 Query: 359 LFRFAAFGLVLQGPVGHAWYNLLERVVR-LPGVAGIAGKVAADQLLFAP 502 L FG GP GH + +L + + IA KV +Q+ +P Sbjct: 71 LLLKMLFGFAYGGPFGHFLHKILYYIFQGKKDTKTIAKKVLLEQVTSSP 119 [92][TOP] >UniRef100_C7BGM9 Formin 2B n=1 Tax=Physcomitrella patens RepID=C7BGM9_PHYPA Length = 1329 Score = 66.6 bits (161), Expect = 1e-09 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 14/59 (23%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPPAP 70 AP P PPPP +SSAP+PPPPPPPP PPP PPPP GG G PAP Sbjct: 523 APPPPPPPPFGGRPNSSAPAPPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAP 581 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/52 (57%), Positives = 32/52 (61%), Gaps = 5/52 (9%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 70 S AP+P PPPP +S AP PPPPPPPP PPP PPPPG PP P Sbjct: 746 SGAPAP-PPPPFGGRPNSGAPGPPPPPPPPGKSGAPPPPPPPPGRSDAPPPP 796 Score = 66.2 bits (160), Expect = 1e-09 Identities = 34/63 (53%), Positives = 34/63 (53%), Gaps = 10/63 (15%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGG---GGGPPAPRD 64 RS AP P PPPP D PPPPPPPP PPP PPPPGG GG PP P Sbjct: 789 RSDAPPPPPPPPG----DRGVGGPPPPPPPPGAPRPGGPPPPPPPPGGRGVGGPPPPPPP 844 Query: 63 SGG 55 GG Sbjct: 845 PGG 847 Score = 65.5 bits (158), Expect = 2e-09 Identities = 35/88 (39%), Positives = 44/88 (50%), Gaps = 14/88 (15%) Frame = -1 Query: 291 TNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP--- 121 TN +++ + + + AL + P P PPPP +SSAP+PPPPPPPP Sbjct: 475 TNPVPILSAIDRSSGATALSALAAPSPAPPPPPPPPPPFGGRPNSSAPAPPPPPPPPFGG 534 Query: 120 --------PPPRPPPPGGG---GGPPAP 70 PPP PPPP GG G PAP Sbjct: 535 RPNSSAPAPPPPPPPPFGGRPNSGAPAP 562 Score = 65.1 bits (157), Expect = 3e-09 Identities = 31/59 (52%), Positives = 33/59 (55%), Gaps = 14/59 (23%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPPAP 70 AP P PPPP +S AP+PPPPPPPP PPP PPPP GG G PAP Sbjct: 542 APPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAP 600 Score = 65.1 bits (157), Expect = 3e-09 Identities = 31/59 (52%), Positives = 33/59 (55%), Gaps = 14/59 (23%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPPAP 70 AP P PPPP +S AP+PPPPPPPP PPP PPPP GG G PAP Sbjct: 561 APPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAP 619 Score = 65.1 bits (157), Expect = 3e-09 Identities = 36/83 (43%), Positives = 39/83 (46%), Gaps = 18/83 (21%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPP-------GGGGGP 79 AP P PPPP +S AP+PPPPPPPP PPP PPPP G P Sbjct: 637 APPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAPPPPPPPPFGSRPNSGAPAPP 696 Query: 78 PAPRDSGGVDEERNSSGVDRRAP 10 P P SGG R +SG P Sbjct: 697 PPPPPSGG----RPNSGAPAPPP 715 Score = 64.7 bits (156), Expect = 4e-09 Identities = 30/72 (41%), Positives = 33/72 (45%), Gaps = 27/72 (37%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP---------------------------PPPRP 106 AP P PPPP+ +S AP+PPPPPPPP PPP P Sbjct: 712 APPPPPPPPSGGRPNSGAPAPPPPPPPPSGGRPNSGAPAPPPPPFGGRPNSGAPGPPPPP 771 Query: 105 PPPGGGGGPPAP 70 PPPG G PP P Sbjct: 772 PPPGKSGAPPPP 783 Score = 64.3 bits (155), Expect = 5e-09 Identities = 36/83 (43%), Positives = 39/83 (46%), Gaps = 18/83 (21%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGG-------GGGP 79 AP P PPPP +S AP+PPPPPPPP PPP PPP GG P Sbjct: 656 APPPPPPPPFGGRPNSGAPAPPPPPPPPFGSRPNSGAPAPPPPPPPSGGRPNSGAPAPPP 715 Query: 78 PAPRDSGGVDEERNSSGVDRRAP 10 P P SGG R +SG P Sbjct: 716 PPPPPSGG----RPNSGAPAPPP 734 Score = 64.3 bits (155), Expect = 5e-09 Identities = 32/62 (51%), Positives = 37/62 (59%), Gaps = 15/62 (24%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEK-DSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPP 76 S AP+P PPPP + + +S AP+PPPPPPPP PPP PPPP GG G P Sbjct: 690 SGAPAPPPPPPPSGGRPNSGAPAPPPPPPPPSGGRPNSGAPAPPPPPPPPSGGRPNSGAP 749 Query: 75 AP 70 AP Sbjct: 750 AP 751 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/52 (57%), Positives = 31/52 (59%), Gaps = 5/52 (9%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAP 70 S AP P PPPP + S AP PPPPPP PPPPP PP G GGPP P Sbjct: 762 SGAPGPPPPPPPPGK--SGAPPPPPPPPGRSDAPPPPPPPPGDRGVGGPPPP 811 Score = 62.0 bits (149), Expect = 2e-08 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 14/59 (23%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP-----------PPPPPRPPPPGGG---GGPPAP 70 AP P PPPP +S AP+PPPPPP P PPP PPPP GG G PAP Sbjct: 599 APPPPPPPPFGGRPNSGAPAPPPPPPLPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAP 657 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/63 (50%), Positives = 35/63 (55%), Gaps = 16/63 (25%) Frame = -1 Query: 210 SRAPSPAPPPPA--AAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGP 79 S AP+P PPPP +S AP+PPPPPPPP PPP PPPP GG G Sbjct: 614 SGAPAPPPPPPLPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGA 673 Query: 78 PAP 70 PAP Sbjct: 674 PAP 676 Score = 61.2 bits (147), Expect = 4e-08 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 14/59 (23%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGG---GGPPAP 70 AP P PPPP +S AP+PPPPPPPP PPP PP P GG G PAP Sbjct: 580 APPPPPPPPFGGRPNSGAPAPPPPPPPPFGGRPNSGAPAPPPPPPLPFGGRPNSGAPAP 638 Score = 57.0 bits (136), Expect = 8e-07 Identities = 35/85 (41%), Positives = 39/85 (45%), Gaps = 20/85 (23%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP-------------PPPPRPPPPGG-------GG 85 AP P PPPP + +S AP+PPPPPPP PPP PPP GG Sbjct: 675 APPPPPPPPFGSRPNSGAPAPPPPPPPSGGRPNSGAPAPPPPP--PPPSGGRPNSGAPAP 732 Query: 84 GPPAPRDSGGVDEERNSSGVDRRAP 10 PP P SGG R +SG P Sbjct: 733 PPPPPPPSGG----RPNSGAPAPPP 753 Score = 56.6 bits (135), Expect = 1e-06 Identities = 32/76 (42%), Positives = 33/76 (43%), Gaps = 21/76 (27%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAP-----------SPPPPPPPP-------PPPRPPPPG 94 +R P P PPPP A P PPPPPPPP P P PPPPG Sbjct: 802 DRGVGGPPPPPPPPGAPRPGGPPPPPPPPGGRGVGGPPPPPPPPGGARPGGPLPPPPPPG 861 Query: 93 G---GGGPPAPRDSGG 55 G GG PP P S G Sbjct: 862 GKGPGGPPPPPPPSAG 877 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/73 (39%), Positives = 31/73 (42%), Gaps = 7/73 (9%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGGGPPAPRDSGGVD 49 R P PPPP + P PPPPPP P PPP PP G GGPP P Sbjct: 819 RPGGPPPPPPPPGGRGVGGPPPPPPPPGGARPGGPLPPPPPPGGKGPGGPPPPPPPSAGR 878 Query: 48 EERNSSGVDRRAP 10 + G RAP Sbjct: 879 GRASLPGPPARAP 891 [93][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/46 (58%), Positives = 27/46 (58%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 64 P P PPPP P PPPPPPPPPPP PPPP PP PRD Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRD 49 Score = 64.7 bits (156), Expect = 4e-09 Identities = 30/61 (49%), Positives = 30/61 (49%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSG 28 R P P PPPP P PPPPPPPPPPP PPPP PP P R SG Sbjct: 1 RVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLSG 60 Query: 27 V 25 V Sbjct: 61 V 61 Score = 60.5 bits (145), Expect = 7e-08 Identities = 27/54 (50%), Positives = 29/54 (53%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEER 40 P P PPPP P PPPPPPPPPPP PPPP P R SG + +R Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLSGVLCRDR 66 [94][TOP] >UniRef100_Q5ASL5 Putative uncharacterized protein n=1 Tax=Emericella nidulans RepID=Q5ASL5_EMENI Length = 1186 Score = 66.6 bits (161), Expect = 1e-09 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 9/59 (15%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP----PPPPP-----RPPPPGGGGGPPAPRDSGG 55 AP P PPPP A AP PPPPPP PPPPP PPPP GG PP P+ SGG Sbjct: 522 APPPPPPPPGAG-----APPPPPPPPGAGAPPPPPPPGAGAPPPPPGGAAPPLPQPSGG 575 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/54 (59%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP---PPPPRPPPPGGGGGPPAPRDSG 58 S P P PPPP A SSAP PPPPPPP PPP PPPPG G PP P G Sbjct: 492 SGPPMPPPPPPPAP--GSSAPPPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPPG 543 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 6/54 (11%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAPRDSG 58 P P PPPPA+ S P PPPPPPP PPPP PPPPG G PP P G Sbjct: 482 PPPPPPPPAS----SGPPMPPPPPPPAPGSSAPPPPPPPPPGAGAPPPPPPPPG 531 Score = 63.5 bits (153), Expect = 8e-09 Identities = 30/56 (53%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAPRDSGG 55 S AP P PPPP A +PPPPPPPP PPP PPPPG G PP P G Sbjct: 507 SSAPPPPPPPPPGAG------APPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPGAG 556 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 7/49 (14%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGGGGPPAP 70 P PPPPA + P PPPPPPP PPPP PP PG PP P Sbjct: 466 PPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPPAPGSSAPPPPP 514 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/60 (46%), Positives = 28/60 (46%), Gaps = 12/60 (20%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAP---SPPPPPPPP---------PPPRPPPPGGGGGPPAP 70 RS A P PPPP P S PPPPPPP PPP PPPP GPP P Sbjct: 438 RSPASQPPPPPPVPGASRPVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGPPMP 497 [95][TOP] >UniRef100_C8VA31 Putative uncharacterized protein n=1 Tax=Aspergillus nidulans FGSC A4 RepID=C8VA31_EMENI Length = 657 Score = 66.6 bits (161), Expect = 1e-09 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 9/59 (15%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP----PPPPP-----RPPPPGGGGGPPAPRDSGG 55 AP P PPPP A AP PPPPPP PPPPP PPPP GG PP P+ SGG Sbjct: 522 APPPPPPPPGAG-----APPPPPPPPGAGAPPPPPPPGAGAPPPPPGGAAPPLPQPSGG 575 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/54 (59%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP---PPPPRPPPPGGGGGPPAPRDSG 58 S P P PPPP A SSAP PPPPPPP PPP PPPPG G PP P G Sbjct: 492 SGPPMPPPPPPPAP--GSSAPPPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPPG 543 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 6/54 (11%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAPRDSG 58 P P PPPPA+ S P PPPPPPP PPPP PPPPG G PP P G Sbjct: 482 PPPPPPPPAS----SGPPMPPPPPPPAPGSSAPPPPPPPPPGAGAPPPPPPPPG 531 Score = 63.5 bits (153), Expect = 8e-09 Identities = 30/56 (53%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAPRDSGG 55 S AP P PPPP A +PPPPPPPP PPP PPPPG G PP P G Sbjct: 507 SSAPPPPPPPPPGAG------APPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPGAG 556 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 7/49 (14%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGGGGPPAP 70 P PPPPA + P PPPPPPP PPPP PP PG PP P Sbjct: 466 PPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPPAPGSSAPPPPP 514 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/60 (46%), Positives = 28/60 (46%), Gaps = 12/60 (20%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAP---SPPPPPPPP---------PPPRPPPPGGGGGPPAP 70 RS A P PPPP P S PPPPPPP PPP PPPP GPP P Sbjct: 438 RSPASQPPPPPPVPGASRPVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGPPMP 497 [96][TOP] >UniRef100_C5JYR8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JYR8_AJEDS Length = 1704 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/54 (55%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAPRDSGGV 52 AP P PPPP P PPPPPP PPPP PPPPG GG PP P GV Sbjct: 943 APPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGV 996 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 4/52 (7%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAPRDSGGV 52 P PPPP AP PPPPPPP PPPP PPPPG GG PP P G+ Sbjct: 958 PPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPPPPPPGM 1009 Score = 64.7 bits (156), Expect = 4e-09 Identities = 28/48 (58%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPP PPPP PPPPG GG PP P Sbjct: 914 PLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGIGGPPPPP 961 Score = 63.9 bits (154), Expect = 6e-09 Identities = 28/56 (50%), Positives = 29/56 (51%), Gaps = 6/56 (10%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAPRDSGGV 52 P P PPPP P PPPPPPP PPPP PPPPG G PP P G+ Sbjct: 899 PKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGI 954 Score = 63.5 bits (153), Expect = 8e-09 Identities = 32/57 (56%), Positives = 32/57 (56%), Gaps = 7/57 (12%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGG---GPPAPRDSGG 55 AP P PPPP A P PPPPPPP PPPP PPPPG GG PP P GG Sbjct: 972 APPPPPPPPPGA----GGPPPPPPPPPGVGGPPPPPPPPPGMGGPPLPPPPPPGMGG 1024 Score = 61.2 bits (147), Expect = 4e-08 Identities = 28/50 (56%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 70 P P PPPP AP PPPPPPP PPPP PPPP G G PP P Sbjct: 932 PPPPPPPPGVG-----APPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPP 976 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP----PPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPP PPPPPPPP PPPPG G PP P Sbjct: 931 PPPPPPPPPGVGAPPPPPPPPPGIGGPPPPPPPP-PPPPGVGAPPPPP 977 Score = 57.0 bits (136), Expect = 8e-07 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 11/60 (18%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPP-------PPPPPP----PPPRPPPPGGGGGPPAPRDSGG 55 P P PPPP P PP PPPPPP PPP PPPPG G PP P S G Sbjct: 987 PPPPPPPPGVGGPPPPPPPPPGMGGPPLPPPPPPGMGGPPPPPPPPGMRGPPPPPGASIG 1046 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP--PPPPPRPPPPGGGGGPPAPRDSG 58 A P PPPP P PPPPP PP P PPPPG GG PP P G Sbjct: 983 AGGPPPPPPPPPGVGGPPPPPPPPPGMGGPPLPPPPPPGMGGPPPPPPPPG 1033 Score = 53.5 bits (127), Expect = 8e-06 Identities = 28/69 (40%), Positives = 33/69 (47%), Gaps = 10/69 (14%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPP----------PPPPPPRPPPPGGGGGP 79 D ++ S+ P P P ++ P PPPPP PPPPPP PPPPG G P Sbjct: 882 DDEKDESKKPKPEP---------TTTPKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPP 932 Query: 78 PAPRDSGGV 52 P P GV Sbjct: 933 PPPPPPPGV 941 [97][TOP] >UniRef100_C5GLX8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GLX8_AJEDR Length = 1750 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/54 (55%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAPRDSGGV 52 AP P PPPP P PPPPPP PPPP PPPPG GG PP P GV Sbjct: 1015 APPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGV 1068 Score = 65.1 bits (157), Expect = 3e-09 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 70 P PPPP AP PPPPPPP PPPP PPPPG GG PP P Sbjct: 1030 PPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPP 1075 Score = 64.7 bits (156), Expect = 4e-09 Identities = 28/48 (58%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPP PPPP PPPPG GG PP P Sbjct: 986 PLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGIGGPPPPP 1033 Score = 63.9 bits (154), Expect = 6e-09 Identities = 28/56 (50%), Positives = 29/56 (51%), Gaps = 6/56 (10%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAPRDSGGV 52 P P PPPP P PPPPPPP PPPP PPPPG G PP P G+ Sbjct: 971 PKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGI 1026 Score = 61.2 bits (147), Expect = 4e-08 Identities = 28/50 (56%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 70 P P PPPP AP PPPPPPP PPPP PPPP G G PP P Sbjct: 1004 PPPPPPPPGVG-----APPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPP 1048 Score = 53.9 bits (128), Expect(2) = 1e-07 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAPRDSG 58 AP P PPPP A P PPPPPPP PPPP PPPP P A G Sbjct: 1044 APPPPPPPPPGA----GGPPPPPPPPPGVGGPPPPPPPPPVNDPRPGAGSSIG 1092 Score = 25.8 bits (55), Expect(2) = 1e-07 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = -2 Query: 485 GRPPPCRQCLPHLAAAPPAPTGCTMRGQQALGGPAQTPQNETSVGGPGCPAAYP 324 G PPP P + A PP P +GGP P G G P P Sbjct: 1001 GLPPPPPPPPPGVGAPPPPPP-----PPPGIGGPPPPPPPPPPPPGVGAPPPPP 1049 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP----PPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPP PPPPPPPP PPPPG G PP P Sbjct: 1003 PPPPPPPPPGVGAPPPPPPPPPGIGGPPPPPPPP-PPPPGVGAPPPPP 1049 Score = 53.5 bits (127), Expect = 8e-06 Identities = 28/69 (40%), Positives = 33/69 (47%), Gaps = 10/69 (14%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPP----------PPPPPPRPPPPGGGGGP 79 D ++ S+ P P P ++ P PPPPP PPPPPP PPPPG G P Sbjct: 954 DDEKDESKKPKPEP---------TTTPKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPP 1004 Query: 78 PAPRDSGGV 52 P P GV Sbjct: 1005 PPPPPPPGV 1013 [98][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 66.6 bits (161), Expect = 1e-09 Identities = 32/70 (45%), Positives = 34/70 (48%), Gaps = 6/70 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGPPAPRDSGGVDEER 40 P P PPPP P PPPPPPPP PPP PPPPG G PP P GG R Sbjct: 1066 PPPPPPPPPPPGFGGGMPPPPPPPPPPGFGGGMPPPPPPPPGRFGAPPPPPPPGGAGGWR 1125 Query: 39 NSSGVDRRAP 10 + + AP Sbjct: 1126 ANYMASQSAP 1135 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 9/53 (16%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPP---------PPPPPPRPPPPGGGGGPPAP 70 P P PPPP A P PPPPP PPPPPP PPPPG GGG P P Sbjct: 1033 PPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPPPPPPPGFGGGMPPP 1085 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/69 (44%), Positives = 33/69 (47%), Gaps = 14/69 (20%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPPPRPPPPGGGG--------G 82 E + +PAPPPP P PPP PPPPPPPP PPPPGG G Sbjct: 1012 ESKKPVSAPAPPPPPPPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPP 1071 Query: 81 PPAPRDSGG 55 PP P GG Sbjct: 1072 PPPPPGFGG 1080 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/50 (54%), Positives = 28/50 (56%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 E S+ P AP PP PPPPPPPPPPP PPPPG G PP P Sbjct: 1010 ESESKKPVSAPAPPP----------PPPPPPPPPPPPPPPPGAIGVPPPP 1049 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 12/56 (21%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP------------PPPPPRPPPPGGGGGPPAP 70 P P PPPP PPPPP PPPPP PPPPG GGG P P Sbjct: 1046 PPPPPPPPPPPPPGGKGMGVPPPPPPPPPPPGFGGGMPPPPPPPPPPGFGGGMPPP 1101 [99][TOP] >UniRef100_A6R7X5 Actin cytoskeleton-regulatory complex protein PAN1 n=1 Tax=Ajellomyces capsulatus NAm1 RepID=PAN1_AJECN Length = 1481 Score = 66.6 bits (161), Expect = 1e-09 Identities = 33/66 (50%), Positives = 36/66 (54%), Gaps = 8/66 (12%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGG--GGPPA 73 D Q+ S P P PPP A D+ +PPPPPPP PPPP PPPP GG GGPP Sbjct: 1368 DFQDAPSMPPPPPPPPVPAPFADAPPTAPPPPPPPAFSAAAPPPPPPPPPVGGAPGGPPP 1427 Query: 72 PRDSGG 55 P G Sbjct: 1428 PPPPAG 1433 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/50 (50%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAPR 67 AP APPPP ++AP PPPPPPP P P PPPP G P P+ Sbjct: 1391 APPTAPPPPPPPAFSAAAPPPPPPPPPVGGAPGGPPPPPPPAGDAPAIPK 1440 [100][TOP] >UniRef100_Q7SCY7 Protein sym-1 n=1 Tax=Neurospora crassa RepID=SYM1_NEUCR Length = 172 Score = 66.2 bits (160), Expect = 1e-09 Identities = 41/103 (39%), Positives = 53/103 (51%), Gaps = 3/103 (2%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTP-LGNLDLPRLFRFAAFGLVLQ 394 SW Y L P+ T+A+T +L G+GD AQ L L N DL R R +G + Sbjct: 3 SW--YKAQLAARPLLTQAVTTSILFGVGDVAAQQLVDRRGLSNHDLTRTGRMVLYGGAVF 60 Query: 395 GPVGHAWYNLLERVVRLPGVAG--IAGKVAADQLLFAPVFTSI 517 GP W+ L++ V +PG I +VAADQ LFAP F I Sbjct: 61 GPAATTWFRFLQKRVVVPGSTNKTILARVAADQGLFAPTFIGI 103 [101][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP G PP P Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP G PP P Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPP 969 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP G PP P Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPP 970 Score = 63.5 bits (153), Expect = 8e-09 Identities = 27/52 (51%), Positives = 28/52 (53%) Frame = -1 Query: 225 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 V E + P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 847 VCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/51 (50%), Positives = 28/51 (54%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 +E + P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 849 EEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSG 58 P P PPPP P PPPPPPPPPPP PPPP PP P G Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 963 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP G P P Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 60.8 bits (146), Expect = 5e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP P AP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAP 965 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGG---GGPPAP 70 P P PPPP P PPPPPPPPPP PPPP G PP P Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPP 980 Score = 57.4 bits (137), Expect = 6e-07 Identities = 22/39 (56%), Positives = 25/39 (64%) Frame = -1 Query: 186 PPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P E+ ++ P PPPPPPPPPPP PPPP PP P Sbjct: 843 PAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPP 881 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/40 (55%), Positives = 23/40 (57%) Frame = -1 Query: 189 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P E + P PPPPPPPPPPP PPPP PP P Sbjct: 843 PAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 882 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPP--PPGGGGGPPA 73 P P PPPP P PPPPPP PPP PP PPG PPA Sbjct: 938 PPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPPA 982 [102][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 66.2 bits (160), Expect = 1e-09 Identities = 39/98 (39%), Positives = 44/98 (44%), Gaps = 3/98 (3%) Frame = -1 Query: 357 RGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPP 178 RGR L +PV+ V P P T + + L +TS P P PPPP Sbjct: 328 RGREFLAHTIPVNTSNCVPP-PVTTTSTLPTTLTTSTSPV---------PTTPLPPPPPP 377 Query: 177 AAAEKDSSAPSP---PPPPPPPPPPRPPPPGGGGGPPA 73 P P PPPPPPPPPPRPPPP PPA Sbjct: 378 LPPPPPRPVPPPAPPPPPPPPPPPPRPPPPPAIVRPPA 415 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 E++ + P P PPP +PPPPPPPPPPP PPPP PP Sbjct: 468 EKKEKPPPPVPPP-----------TPPPPPPPPPPPPPPPPPPVKAPP 504 [103][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/76 (43%), Positives = 37/76 (48%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVD 49 DV++ P P PPPP P PPPPPPPPPPP PPPP PP P V Sbjct: 317 DVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQP--DPPVT 374 Query: 48 EERNSSGVDRRAPKAG 1 S+ V+ P AG Sbjct: 375 TAPGSNSVEGGRPHAG 390 [104][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/52 (55%), Positives = 32/52 (61%), Gaps = 3/52 (5%) Frame = -1 Query: 216 RRSRAPSPAPPPPAAAEKDSSAP---SPPPPPPPPPPPRPPPPGGGGGPPAP 70 R S+ P P PPPP + S P SPPPPPPPPPPP PPPP PP+P Sbjct: 200 RASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 251 Score = 60.5 bits (145), Expect = 7e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+P PP + S P PPPPPPPP PP PPPP PP P Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 60.1 bits (144), Expect = 9e-08 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP PSPPPPPPPPPPP PPPP PP P Sbjct: 225 PSPPPPPPPPPP-----PSPPPPPPPPPPPSPPPP---PSPPPP 260 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/47 (55%), Positives = 28/47 (59%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S +P P+PPPP S P PPPPPPP PPP PPPP PP P Sbjct: 214 SPSPPPSPPPPP-----SPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/53 (52%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAPRDS 61 S P P+PPPP S P PPPPPP PPPPP PPPP PP P S Sbjct: 220 SPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP----SPPLPPPS 268 [105][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 S + P PPPP SS+PSPPPPPPPPPPP PPPP PP Sbjct: 1517 SNSSPPPPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPPPPPP 1561 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/63 (46%), Positives = 33/63 (52%) Frame = -1 Query: 255 GATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 G + R D S + S PPPP SS+ SP PPPPPPPPP PPPP PP Sbjct: 1500 GFSGSGPRSDSASAGSGSNSSPPPPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPPPP 1559 Query: 75 APR 67 P+ Sbjct: 1560 PPK 1562 [106][TOP] >UniRef100_C3ZSY2 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3ZSY2_BRAFL Length = 2637 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/71 (45%), Positives = 36/71 (50%), Gaps = 20/71 (28%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSA----------------PSPPPPPPPPP----PPRPPPPGG 91 + P+P+PPPP E+D S P PPPPPPPPP PP PPPP Sbjct: 665 THTPTPSPPPPPPGEEDVSPFSTPLSSEGEGEGAPPPGPPPPPPPPPGSGGPPPPPPPPP 724 Query: 90 GGGPPAPRDSG 58 GGGPP P G Sbjct: 725 GGGPPPPPPPG 735 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 AP P PPPP S P PPPPPPP P PPPP G PP Sbjct: 698 APPPGPPPPPPPPPGSGGPPPPPPPPPGGGPPPPPPPGAPPPP 740 [107][TOP] >UniRef100_Q86ZG7 Probable Cytokinesis protein sepA n=1 Tax=Neurospora crassa RepID=Q86ZG7_NEUCR Length = 1790 Score = 66.2 bits (160), Expect = 1e-09 Identities = 38/100 (38%), Positives = 45/100 (45%), Gaps = 6/100 (6%) Frame = -1 Query: 339 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 160 PS + ++P T TP + G ++ A P P PPPP Sbjct: 992 PSHPSMESQTPITPSDTETPKIQVTDATGPSAPAAASGPPP--PPPPPPPPPPPPGFLPG 1049 Query: 159 SSAPSP----PPPPPPPPPPRPPPPGG--GGGPPAPRDSG 58 + AP P PPPPPPPPPP PPPPGG G PP P G Sbjct: 1050 APAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGG 1089 [108][TOP] >UniRef100_Q7RWH7 Cytokinesis protein sepA n=1 Tax=Neurospora crassa RepID=Q7RWH7_NEUCR Length = 1817 Score = 66.2 bits (160), Expect = 1e-09 Identities = 38/100 (38%), Positives = 45/100 (45%), Gaps = 6/100 (6%) Frame = -1 Query: 339 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 160 PS + ++P T TP + G ++ A P P PPPP Sbjct: 992 PSHPSMESQTPITPSDTETPKIQVTDATGPSAPAAASGPPP--PPPPPPPPPPPPGFLPG 1049 Query: 159 SSAPSP----PPPPPPPPPPRPPPPGG--GGGPPAPRDSG 58 + AP P PPPPPPPPPP PPPPGG G PP P G Sbjct: 1050 APAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGG 1089 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -1 Query: 201 PSPAPPP---PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPP P AA A PPPPPPPPPP PP PG G PP P Sbjct: 1068 PPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPP--PPMPGMAGMPPPP 1112 [109][TOP] >UniRef100_Q4WCV2 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus fumigatus RepID=Q4WCV2_ASPFU Length = 643 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/52 (53%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPP----PPPPPPRPPPPGGGGGPPAPRDSG 58 PSP PPPP ++ + P PPPPP PPPPPP PP PGG PP P G Sbjct: 487 PSPPPPPPVSSGPPAPPPPPPPPPSIGGPPPPPPPPPAPGGSAPPPPPPPPG 538 Score = 64.7 bits (156), Expect = 4e-09 Identities = 33/76 (43%), Positives = 37/76 (48%), Gaps = 8/76 (10%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGG----PPAPRDSGG 55 S + P+PPPP AP PPPPPPP PPPP PPPP GG PP P +G Sbjct: 482 STSVPPSPPPPPPVSSGPPAPPPPPPPPPSIGGPPPPPPPPPAPGGSAPPPPPPPPGAGA 541 Query: 54 VDEERNSSGVDRRAPK 7 +SG PK Sbjct: 542 PPPPPPASGAAPPLPK 557 Score = 63.5 bits (153), Expect = 8e-09 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDE 46 P P PPPPA SAP PPPPPP P PPPP G PP P+ +GG ++ Sbjct: 516 PPPPPPPPAPG---GSAPPPPPPPPGAGAPPPPPPASGAAPPLPKPTGGRED 564 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/51 (52%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAP 70 S P P PPPP + +P PPPP PP PPPP PPPP GG PP P Sbjct: 469 SAVPPPPPPPPPPSTSVPPSPPPPPPVSSGPPAPPPPPPPPPSIGGPPPPP 519 Score = 60.5 bits (145), Expect = 7e-08 Identities = 41/105 (39%), Positives = 46/105 (43%), Gaps = 11/105 (10%) Frame = -1 Query: 351 RSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAA 172 RS P G P S + P P V + TS A R+ P P PPP A Sbjct: 402 RSSAPPGPPPPPPRSPATPPQLPPKVPHV----PTSAAGPPPPPPARNPVPPPPPPPVPA 457 Query: 171 AEKD-------SSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 70 A + S+ P PPPPPPPP PP PPPP GPPAP Sbjct: 458 ASRPTPPPPVTSAVPPPPPPPPPPSTSVPPSPPPPPPVSSGPPAP 502 [110][TOP] >UniRef100_Q2KFY0 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea 70-15 RepID=Q2KFY0_MAGGR Length = 669 Score = 66.2 bits (160), Expect = 1e-09 Identities = 45/120 (37%), Positives = 52/120 (43%), Gaps = 25/120 (20%) Frame = -1 Query: 342 LPSGVPVSICASVSPRPTNTPAVMALVLMGATSRA---------LR*DVQERRSRAPSPA 190 LPS VP + A P P+ P + V A + L S P+P Sbjct: 437 LPSKVPAAPTAPPLPPPSTRPPPVLPVRAPAAPQPPPLPSSQAPLAPPPLPASSAPPAPP 496 Query: 189 PPPPAAAEKDSSAPSPPPPPPPPP---------PPRPPPPGG-GGGPPAP------RDSG 58 P PP ++AP P PPPPPPP PP PPPPGG G PPAP RDSG Sbjct: 497 PAPPLPPPSSAAAPPPAPPPPPPPGGLAGAPPAPPPPPPPGGMAGAPPAPPPPPPNRDSG 556 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/69 (43%), Positives = 37/69 (53%), Gaps = 13/69 (18%) Frame = -1 Query: 237 LR*DVQERRSRAPS--------PAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPP 97 LR + Q R +P P PPPP + ++ +S +PPPPPP PP PP PPPP Sbjct: 251 LRQEQQSARKESPPARQQAHAHPPPPPPPSNDRSNSLRAPPPPPPAPPVSSNTPPAPPPP 310 Query: 96 GGGGGPPAP 70 G PPAP Sbjct: 311 RRGAAPPAP 319 [111][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/70 (47%), Positives = 37/70 (52%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEER 40 E RS PSP PPA + +P PPPPPPPPPPP PPPP PP P G Sbjct: 962 EDRSPLPSPGLLPPAEEVPNGLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGFKGIIP 1021 Query: 39 NSSGVDRRAP 10 +SSG+ P Sbjct: 1022 SSSGIPLPPP 1031 [112][TOP] >UniRef100_A4RBS7 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4RBS7_MAGGR Length = 654 Score = 66.2 bits (160), Expect = 1e-09 Identities = 45/120 (37%), Positives = 52/120 (43%), Gaps = 25/120 (20%) Frame = -1 Query: 342 LPSGVPVSICASVSPRPTNTPAVMALVLMGATSRA---------LR*DVQERRSRAPSPA 190 LPS VP + A P P+ P + V A + L S P+P Sbjct: 437 LPSKVPAAPTAPPLPPPSTRPPPVLPVRAPAAPQPPPLPSSQAPLAPPPLPASSAPPAPP 496 Query: 189 PPPPAAAEKDSSAPSPPPPPPPPP---------PPRPPPPGG-GGGPPAP------RDSG 58 P PP ++AP P PPPPPPP PP PPPPGG G PPAP RDSG Sbjct: 497 PAPPLPPPSSAAAPPPAPPPPPPPGGLAGAPPAPPPPPPPGGMAGAPPAPPPPPPNRDSG 556 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/69 (43%), Positives = 37/69 (53%), Gaps = 13/69 (18%) Frame = -1 Query: 237 LR*DVQERRSRAPS--------PAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPP 97 LR + Q R +P P PPPP + ++ +S +PPPPPP PP PP PPPP Sbjct: 251 LRQEQQSARKESPPARQQAHAHPPPPPPPSNDRSNSLRAPPPPPPAPPVSSNTPPAPPPP 310 Query: 96 GGGGGPPAP 70 G PPAP Sbjct: 311 RRGAAPPAP 319 [113][TOP] >UniRef100_Q54ER5 Formin-J n=1 Tax=Dictyostelium discoideum RepID=FORJ_DICDI Length = 2546 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/76 (43%), Positives = 36/76 (47%), Gaps = 17/76 (22%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSS--------APSPPPPPP---------PPPPPRPPP 100 D Q + P P PPPP + S P PPPPPP PPPPP PPP Sbjct: 1025 DAQIVSASVPPPPPPPPGGNNNNESDVPSSSGGPPPPPPPPPPPGKSSGGGPPPPPPPPP 1084 Query: 99 PGGGGGPPAPRDSGGV 52 GG GGPP P GG+ Sbjct: 1085 KGGKGGPPPPPPIGGI 1100 Score = 53.5 bits (127), Expect = 8e-06 Identities = 39/107 (36%), Positives = 47/107 (43%), Gaps = 6/107 (5%) Frame = -1 Query: 384 SPNAAKRN-KRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRS 208 SPN + + K+ + P+ + ASV P P P G + DV Sbjct: 1006 SPNTEEDSTKKTINNSPAEDAQIVSASVPPPPPPPPG-------GNNNNES--DVPSSSG 1056 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPP-----PRPPPPGGGGG 82 P P PPPP + SS PPPPPPPPP P PPPP GG G Sbjct: 1057 GPPPPPPPPPPPGK--SSGGGPPPPPPPPPKGGKGGPPPPPPIGGIG 1101 [114][TOP] >UniRef100_UPI00019856F3 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019856F3 Length = 371 Score = 65.9 bits (159), Expect = 2e-09 Identities = 35/100 (35%), Positives = 51/100 (51%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 +W++Y +AL P+ K + +GV+ LGD +AQ G PL D R+ R G L G Sbjct: 175 NWSAYEEALKTNPVFAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMLRSGLVGFTLHG 234 Query: 398 PVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 + H +Y E + + KVA DQ L+A V+ SI Sbjct: 235 SLSHYYYQFCEALFPFQDWWVVPAKVAFDQTLWAAVWNSI 274 [115][TOP] >UniRef100_Q0IHG9 MGC154358 protein n=1 Tax=Xenopus laevis RepID=Q0IHG9_XENLA Length = 200 Score = 65.9 bits (159), Expect = 2e-09 Identities = 38/99 (38%), Positives = 54/99 (54%), Gaps = 1/99 (1%) Frame = +2 Query: 215 RSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQ-MLTGTPLGNLDLPRLFRFAAFGLVL 391 R WT Y AL+ P+ KA+T+ LGD LAQ + DL R R +FG ++ Sbjct: 4 RLWTKYNAALETNPLLIKAVTSLTGFTLGDILAQKFVMPDKEKGYDLMRTVRLGSFGFLV 63 Query: 392 QGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVF 508 GP GH +Y+ L++ + + +A KVA DQLL+ P F Sbjct: 64 HGPTGHYFYSWLDKQIPGTAMKTVATKVAIDQLLWNPCF 102 [116][TOP] >UniRef100_Q6H6J7 Os02g0226000 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6H6J7_ORYSJ Length = 205 Score = 65.9 bits (159), Expect = 2e-09 Identities = 43/129 (33%), Positives = 64/129 (49%), Gaps = 1/129 (0%) Frame = +2 Query: 119 GGGGGGGGGEGADESFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGL 298 G GG G GEG + G+L R+W YL+ L + P++TK ITAG L G+ Sbjct: 9 GRGGVRGRGEGEE--------------GSLARRAWRQYLRQLQLHPLRTKMITAGCLAGV 54 Query: 299 GDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNLLERVVR-LPGVAGIAGKV 475 D++AQ L+G ++ RL FG GP GH + +L+ + + IA KV Sbjct: 55 SDSVAQKLSG--YQRIEKRRLLLKMLFGFAYGGPFGHFLHKVLDYIFKGKKDTKTIAKKV 112 Query: 476 AADQLLFAP 502 +Q+ +P Sbjct: 113 LLEQITSSP 121 [117][TOP] >UniRef100_B9N1L3 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9N1L3_POPTR Length = 238 Score = 65.9 bits (159), Expect = 2e-09 Identities = 34/100 (34%), Positives = 51/100 (51%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 +W++Y +AL P+ K + +G++ LGD +AQ G PL D R+FR G L G Sbjct: 50 NWSAYEEALKTNPVLAKMMISGIVYSLGDWIAQCYEGKPLFEYDRTRMFRSGLVGFTLHG 109 Query: 398 PVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 + H +Y E + + KVA DQ L+A + SI Sbjct: 110 SLSHYYYQFCEELFPFQDWWVVPAKVAFDQTLWAAAWNSI 149 [118][TOP] >UniRef100_B9HSH1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HSH1_POPTR Length = 185 Score = 65.9 bits (159), Expect = 2e-09 Identities = 37/97 (38%), Positives = 56/97 (57%), Gaps = 1/97 (1%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 +W YL L V P++TKA+T+GV+ GLGD LAQ ++G + L L RL F+ FG G Sbjct: 8 AWRKYLIQLQVNPLRTKALTSGVIAGLGDALAQKISG--IKKLQLRRLLLFSLFGFAYGG 65 Query: 398 PVGHAWYNLLERVVRLPGVA-GIAGKVAADQLLFAPV 505 P GH + L+ + + + +A V +QL +P+ Sbjct: 66 PFGHYLHKLMSVIFKGKNDSKTVAKMVLFEQLTSSPL 102 [119][TOP] >UniRef100_B8LNA6 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=B8LNA6_PICSI Length = 294 Score = 65.9 bits (159), Expect = 2e-09 Identities = 35/102 (34%), Positives = 53/102 (51%) Frame = +2 Query: 212 LRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVL 391 + +WT+Y +AL P+ K + +G + LGD +AQ G L + R+FR G L Sbjct: 93 VHNWTAYEEALKTNPVLAKMVISGAVYSLGDWIAQCYEGKQLFEFNRIRMFRSGLVGFSL 152 Query: 392 QGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 G + H +Y L E + G + KVA DQ ++A V+ SI Sbjct: 153 HGSLSHYYYQLCEALFPFQGWWVVPAKVAFDQTIWAAVWNSI 194 [120][TOP] >UniRef100_B7FYY0 Predicted protein (Fragment) n=1 Tax=Phaeodactylum tricornutum CCAP 1055/1 RepID=B7FYY0_PHATR Length = 179 Score = 65.9 bits (159), Expect = 2e-09 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 8/107 (7%) Frame = +2 Query: 221 WTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDL--------PRLFRFAA 376 W +Y ALD P+ TKA+T+ V GLGD LAQ+ + ++D R + Sbjct: 1 WAAYNDALDSKPLFTKAMTSLVGWGLGDVLAQVRFDSRAQSMDQFTGKLSFRTRFVTLSV 60 Query: 377 FGLVLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 FG + GP GH +YN L+ ++ +A KV DQ+L+ P+F ++ Sbjct: 61 FGFIYHGPSGHYFYNWLDGKIKGTRAQDVALKVGIDQILWCPIFMTV 107 [121][TOP] >UniRef100_A9PIQ8 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PIQ8_9ROSI Length = 369 Score = 65.9 bits (159), Expect = 2e-09 Identities = 34/100 (34%), Positives = 51/100 (51%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 +W++Y +AL P+ K + +G++ LGD +AQ G PL D R+FR G L G Sbjct: 174 NWSAYEEALKTNPVLAKMMISGIVYSLGDWIAQCYEGKPLFEYDRTRMFRSGLVGFTLHG 233 Query: 398 PVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 + H +Y E + + KVA DQ L+A + SI Sbjct: 234 SLSHYYYQFCEELFPFQDWWVVPAKVAFDQTLWAAAWNSI 273 [122][TOP] >UniRef100_A7P1H6 Chromosome chr19 scaffold_4, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7P1H6_VITVI Length = 291 Score = 65.9 bits (159), Expect = 2e-09 Identities = 35/100 (35%), Positives = 51/100 (51%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 +W++Y +AL P+ K + +GV+ LGD +AQ G PL D R+ R G L G Sbjct: 88 NWSAYEEALKTNPVFAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMLRSGLVGFTLHG 147 Query: 398 PVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 + H +Y E + + KVA DQ L+A V+ SI Sbjct: 148 SLSHYYYQFCEALFPFQDWWVVPAKVAFDQTLWAAVWNSI 187 [123][TOP] >UniRef100_UPI000023F096 hypothetical protein FG08656.1 n=1 Tax=Gibberella zeae PH-1 RepID=UPI000023F096 Length = 611 Score = 65.9 bits (159), Expect = 2e-09 Identities = 43/118 (36%), Positives = 53/118 (44%), Gaps = 6/118 (5%) Frame = -1 Query: 405 PTGPWRTSPNAAKRNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSR--ALR 232 P P R+ P AA LP +P + S +P P P+ + A S Sbjct: 400 PPPPPRSEPPAA---------LPPPLPPKVPTSSAP-PLPPPSTRPIPPPPAASSHPPAP 449 Query: 231 *DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 70 + + AP P PPPP ++ P PPPP PP PPPP PPPPGG G PP P Sbjct: 450 PPLPPTTNGAPPPPPPPPPPPGGPAAPPPPPPPMPPTSGAPPPPPPPPPGGPGAPPPP 507 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/65 (41%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAPRDSGGVDEERNS 34 P+ PPPP S AP PPPPPP PPP PPP G G PAP +G Sbjct: 473 PAAPPPPPPPMPPTSGAPPPPPPPPPGGPGAPPPPPPPMPPGSGAPAPPVTGDPSRSAVL 532 Query: 33 SGVDR 19 +G+ + Sbjct: 533 AGIQQ 537 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/70 (42%), Positives = 31/70 (44%), Gaps = 16/70 (22%) Frame = -1 Query: 216 RRSRAPSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPR------------PPPPGGGG 85 R SRAP P PPPPAA P+PP P PPPPP PR P PP Sbjct: 268 RSSRAPPPPPPPPAAGRSQDGPPAPPAPRKGGPPPPPAPRRSGKAETAPERAPSPPRPKF 327 Query: 84 GPPAPRDSGG 55 G P P G Sbjct: 328 GVPPPLAEAG 337 [124][TOP] >UniRef100_A9UVG5 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9UVG5_MONBE Length = 1181 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/56 (55%), Positives = 33/56 (58%), Gaps = 5/56 (8%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAPRDSGGV 52 AP AP PP S AP+PPPPPPPP PPP PPPPG GG PP P G+ Sbjct: 539 APGSAPAPP------SGAPAPPPPPPPPGGAAAPPPPPPPPGPGGAPPPPPPPPGI 588 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/46 (58%), Positives = 30/46 (65%), Gaps = 3/46 (6%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGGGGGPPAP 70 +PAPPPP ++AP PPPPPP P PPP PPPPG G PP P Sbjct: 550 APAPPPPPPPPGGAAAPPPPPPPPGPGGAPPPPPPPPGIPGAPPPP 595 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 10/55 (18%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPP-----PPPPP-----RPPPPGGGGGPPAP 70 AP P PPPP AP PPPPPP PPPPP PPPPG G PP P Sbjct: 565 APPPPPPPPGPG----GAPPPPPPPPGIPGAPPPPPGIPGAPPPPPGAPGAPPPP 615 [125][TOP] >UniRef100_A2F983 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2F983_TRIVA Length = 2086 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/49 (57%), Positives = 31/49 (63%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSG 58 AP+ + P P AE +SAP PPPPPPPP P PPPP GG P P SG Sbjct: 1944 APTSSEPAPPPAEVSASAPPPPPPPPPPGTPLPPPPPAAGGAPPPPPSG 1992 Score = 53.9 bits (128), Expect = 6e-06 Identities = 37/109 (33%), Positives = 45/109 (41%), Gaps = 6/109 (5%) Frame = -1 Query: 378 NAAKRNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAP 199 +A + K+ + P + I A ++ T PA A TS E + AP Sbjct: 1908 SAKQEEKKNKPPAPPPKKLVIPAGLADALTAGPAPSA-----PTSSEPAPPPAEVSASAP 1962 Query: 198 SPAPPPPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGGPPAP 70 P PPPP P PPPPP PPPP PPPP GG P P Sbjct: 1963 PPPPPPPPPG-----TPLPPPPPAAGGAPPPPPSGLPPPPAGGSAPKPP 2006 [126][TOP] >UniRef100_A3AB67 Formin-like protein 16 n=1 Tax=Oryza sativa Japonica Group RepID=FH16_ORYSJ Length = 906 Score = 65.9 bits (159), Expect = 2e-09 Identities = 58/179 (32%), Positives = 67/179 (37%), Gaps = 20/179 (11%) Frame = -1 Query: 501 GAKSSWSAATLPAM---PATPG----SRTTRSNRLYHAWPTG-PWRTSPNAAKRNKRGRS 346 G+ SS+S A A P+TP S RS+ P P SP+ R Sbjct: 238 GSTSSFSVAAAEAYARPPSTPAITAVSSVPRSSPSPAPAPAARPASPSPSLPLPPGRESP 297 Query: 345 RLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAE 166 P + + AS +P P P A A P PPPP AA Sbjct: 298 SRPQSIAAAAVASPAPPPPPPPKPAA---------------------AAPPPPPPPKAAP 336 Query: 165 KDSSAPSPPPPPP---PPP--------PPRPPPPGG-GGGPPAPRDSGGVDEERNSSGV 25 PPPPPP PPP PP PPPPGG GGPP P GG + GV Sbjct: 337 PPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPPAAPGV 395 [127][TOP] >UniRef100_A8J165 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J165_CHLRE Length = 288 Score = 65.5 bits (158), Expect = 2e-09 Identities = 41/115 (35%), Positives = 63/115 (54%), Gaps = 7/115 (6%) Frame = +2 Query: 185 GGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTG--TPLGNLDLPR 358 GGAG L R+W +Y ++L P+ T+A ++ +L GLGD +AQ + + + D R Sbjct: 8 GGAGGFNPLSRAWNAYERSLRRHPVLTQAASSALLWGLGDAMAQRIEARCSGVAQPDGRR 67 Query: 359 LFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAG-----KVAADQLLFAPVF 508 AAFG + GP GHAWY L+ +V G+ G + KV D L+++P + Sbjct: 68 TALTAAFGGGIIGPSGHAWYQALDSLVLRCGLVGSSRRAMLLKVVLDNLVYSPAY 122 [128][TOP] >UniRef100_UPI0000DC1294 UPI0000DC1294 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DC1294 Length = 90 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/45 (66%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPP-PPRPPPPGGGGGPPAP 70 P PAPPPPAAA S AP PPP PPPPP PP PP P PPAP Sbjct: 39 PPPAPPPPAAAPAASPAPPPPPDPPPPPAPPPPPAPPAPPPPPAP 83 [129][TOP] >UniRef100_B9LBU3 Putative uncharacterized protein n=1 Tax=Chloroflexus sp. Y-400-fl RepID=B9LBU3_CHLSY Length = 340 Score = 65.5 bits (158), Expect = 2e-09 Identities = 38/112 (33%), Positives = 47/112 (41%), Gaps = 8/112 (7%) Frame = -1 Query: 348 SRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRA--------PSP 193 +R P P +V+P PT +P A+ A + A P P Sbjct: 231 TRQPVSTPSPTVVTVTPSPTTSPTASPTASPTASPTASPTASPTASATASPTEPPPPPPP 290 Query: 192 APPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERN 37 PPPP A +PPPPPPPPPPP PPPP G D G D++ N Sbjct: 291 PPPPPTVAPPPPPTVAPPPPPPPPPPPPPPPPPGDDD-----DDDGDDDDDN 337 [130][TOP] >UniRef100_A9TWA3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWA3_PHYPA Length = 2209 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPP------PPRPPPPGGGGGPPAPRDSGG 55 RA P PPPP +AP PPPPPP PP PP PPPPGG PP P GG Sbjct: 1635 RAAPPPPPPPPLPPGGRAAPPPPPPPPLPPGGRAAPPPPPPPPGGRAAPPPPPPPGG 1691 Score = 65.1 bits (157), Expect = 3e-09 Identities = 31/61 (50%), Positives = 31/61 (50%), Gaps = 11/61 (18%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSP-----PPPPPPPP------PPRPPPPGGGGGPPAPRDSG 58 AP P PPPP P P PPPPPPPP PP PPPPGG G PP P G Sbjct: 1669 APPPPPPPPGGRAAPPPPPPPGGRGAPPPPPPPPGGRGVAPPPPPPPGGRGAPPPPPPPG 1728 Query: 57 G 55 G Sbjct: 1729 G 1729 Score = 60.8 bits (146), Expect = 5e-08 Identities = 30/61 (49%), Positives = 30/61 (49%), Gaps = 11/61 (18%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPP------PPPPPPP-----PPRPPPPGGGGGPPAPRDS 61 RA P PPPP P PP PPPPPPP PP PPPPGG G PP P Sbjct: 1680 RAAPPPPPPPGGRGAPPPPPPPPGGRGVAPPPPPPPGGRGAPPPPPPPGGRGAPPPPPPL 1739 Query: 60 G 58 G Sbjct: 1740 G 1740 Score = 60.5 bits (145), Expect = 7e-08 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPP--PPPPRPPPPGGGGGPPAP 70 RA P PPPP +AP PPPPPP PP PPPPGG G PP P Sbjct: 1651 RAAPPPPPPPPLPPGGRAAPPPPPPPPGGRAAPPPPPPPGGRGAPPPP 1698 Score = 59.7 bits (143), Expect = 1e-07 Identities = 36/80 (45%), Positives = 42/80 (52%) Frame = -1 Query: 309 SVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPP 130 SVSP P PA + V+ A + +L + R P P P PP+ K S PPPP Sbjct: 1533 SVSPAPP--PASSSPVVEEAEASSLPPPGKSAPPRRPPP-PLPPSLPGK-----SAPPPP 1584 Query: 129 PPPPPPRPPPPGGGGGPPAP 70 PPPPPP PPPPG PP P Sbjct: 1585 PPPPPPPPPPPGRSAPPPPP 1604 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/52 (50%), Positives = 27/52 (51%), Gaps = 7/52 (13%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPP-------PRPPPPGGGGGPPAP 70 AP P PPPP +PPPPPPPPPP PPPPGG PP P Sbjct: 1580 APPPPPPPPPPPPPPPGRSAPPPPPPPPPPLPLGGRAAPPPPPGGRAAPPPP 1631 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/57 (47%), Positives = 29/57 (50%), Gaps = 13/57 (22%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP--------PPPPP-----RPPPPGGGGGPPAP 70 P P PPPP + + P PPPPPP PPPPP PPPPGG PP P Sbjct: 1585 PPPPPPPPPPPGRSAPPPPPPPPPPLPLGGRAAPPPPPGGRAAPPPPPGGRAAPPPP 1641 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/61 (47%), Positives = 31/61 (50%), Gaps = 13/61 (21%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAP--------SPPPPP-----PPPPPPRPPPPGGGGGPPA 73 RS P P PPPP +AP +PPPPP PPPPPP P PPGG PP Sbjct: 1597 RSAPPPPPPPPPPLPLGGRAAPPPPPGGRAAPPPPPGGRAAPPPPPPPPLPPGGRAAPPP 1656 Query: 72 P 70 P Sbjct: 1657 P 1657 [131][TOP] >UniRef100_Q2U6Q3 Actin regulatory protein n=1 Tax=Aspergillus oryzae RepID=Q2U6Q3_ASPOR Length = 665 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/54 (55%), Positives = 31/54 (57%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDE 46 R PS PPPP A AP PPPPPP P PPPP GG PP P SGG D+ Sbjct: 532 RGPSAPPPPPPPAPA-GGAPPPPPPPPGAGAPPPPPPPGGAAPPLPTPSGGRDD 584 Score = 60.8 bits (146), Expect = 5e-08 Identities = 31/77 (40%), Positives = 33/77 (42%), Gaps = 25/77 (32%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPP-----------------PPPPPPPR--------P 106 S P P PPPP + + AP PPPP PPPPPPP P Sbjct: 494 SSVPPPPPPPPLPSSRGPPAPPPPPPSSSIPPPPPPPGRGPSAPPPPPPPAPAGGAPPPP 553 Query: 105 PPPGGGGGPPAPRDSGG 55 PPP G G PP P GG Sbjct: 554 PPPPGAGAPPPPPPPGG 570 Score = 56.2 bits (134), Expect = 1e-06 Identities = 49/157 (31%), Positives = 59/157 (37%), Gaps = 23/157 (14%) Frame = -1 Query: 456 ATPGSRTTRSNRLYHAWPTGPWRTS-----PNAAKRNKRGRSRLPSGVPVSICASVS-PR 295 + P + +R+N P P RTS P + G + P+ P + S P Sbjct: 393 SAPPAPPSRNNAPPGPPPRPPPRTSSPAVPPQLPPKVPHGAASTPAPPPPPPRSPASQPP 452 Query: 294 PTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPP------- 136 P PA S A+ S P P PPPP P PPP Sbjct: 453 PPPVPAASRPTPPPPASSAVP-PPPPPSSSVPPPPPPPPPPTSSVPPPPPPPPLPSSRGP 511 Query: 135 --PPPPPP----PPRPPPPGGGGG----PPAPRDSGG 55 PPPPPP PP PPPPG G PP P +GG Sbjct: 512 PAPPPPPPSSSIPPPPPPPGRGPSAPPPPPPPAPAGG 548 [132][TOP] >UniRef100_Q1DV84 Putative uncharacterized protein n=1 Tax=Coccidioides immitis RepID=Q1DV84_COCIM Length = 641 Score = 65.5 bits (158), Expect = 2e-09 Identities = 55/162 (33%), Positives = 62/162 (38%), Gaps = 19/162 (11%) Frame = -1 Query: 498 AKSSWSAATLPAMPATPGSRTTRSNRLYHAWPTGPWR---TSPNAAKRNKRGRSRLPSGV 328 A S +A P P P +T P P+R SP + RG LP Sbjct: 365 ASGSHTAGAAPMPPPRP-PKTPEDGPSRLQPPAPPFRGEIKSPTPPAPSSRGPVPLPPRH 423 Query: 327 PVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSA- 151 VS P P TP ATS +L R+ A P PPPP A+ SS Sbjct: 424 DVSPLQP-PPLPPKTPH--------ATSPSLVPPPPPPRAAATPPPPPPPRQAQPPSSTA 474 Query: 150 --PSPPPPPPPPP-------------PPRPPPPGGGGGPPAP 70 P PPPPPPPPP PP PPPP PP P Sbjct: 475 TTPQPPPPPPPPPSSSGPPAPGPPAPPPPPPPPSAAPAPPPP 516 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/52 (55%), Positives = 31/52 (59%), Gaps = 7/52 (13%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGGGGPPAP 70 AP P PPPP S+AP+PPPPPPP PPPP P P GG PPAP Sbjct: 499 APPPPPPPP------SAAPAPPPPPPPPMPSSSGPPPPPPLPSSGGAAPPAP 544 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/58 (46%), Positives = 31/58 (53%), Gaps = 9/58 (15%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPP----GGGGGPPAPRDSGG 55 P P PPPP+++ + P PPPPPPPP PP PPPP G PP P S G Sbjct: 480 PPPPPPPPSSSGPPAPGPPAPPPPPPPPSAAPAPPPPPPPPMPSSSGPPPPPPLPSSG 537 [133][TOP] >UniRef100_C4JPD7 Putative uncharacterized protein n=1 Tax=Uncinocarpus reesii 1704 RepID=C4JPD7_UNCRE Length = 624 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/55 (54%), Positives = 32/55 (58%), Gaps = 6/55 (10%) Frame = -1 Query: 216 RRSRAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPPPRPPPPGGGGGPPAP 70 + S P P PPPPA+A AP PPP PP PPPP PPP G GG PPAP Sbjct: 475 QNSGPPPPPPPPPASAAPIPVAPPPPPLPPSYGAPPAPPPPPPPPSGAGGAPPAP 529 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/86 (39%), Positives = 39/86 (45%), Gaps = 20/86 (23%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP------PPRPPPPGGGGGP-----PAPRD 64 S AP P PPP AP PPPPPPPP PP PPPP GG P P +D Sbjct: 489 SAAPIPVAPPPPPLPPSYGAPPAPPPPPPPPSGAGGAPPAPPPPPPGGAPTPKAVPGKQD 548 Query: 63 ---------SGGVDEERNSSGVDRRA 13 GG+ + ++S DR A Sbjct: 549 LMASIRATGGGGLRKVKDSEKRDRSA 574 [134][TOP] >UniRef100_B8NKG8 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus flavus NRRL3357 RepID=B8NKG8_ASPFN Length = 692 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/54 (55%), Positives = 31/54 (57%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDE 46 R PS PPPP A AP PPPPPP P PPPP GG PP P SGG D+ Sbjct: 559 RGPSAPPPPPPPAPA-GGAPPPPPPPPGAGAPPPPPPPGGAAPPLPTPSGGRDD 611 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/64 (50%), Positives = 33/64 (51%), Gaps = 12/64 (18%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPP------PPPPPPP------PPRPPPPGGGGGPPAPR 67 SR P PAPPPP + P PP PPPPPPP PP PPPP G G PP P Sbjct: 535 SRGP-PAPPPPPPSSSIPRPPPPPGRGPSAPPPPPPPAPAGGAPPPPPPPPGAGAPPPPP 593 Query: 66 DSGG 55 GG Sbjct: 594 PPGG 597 Score = 58.5 bits (140), Expect = 3e-07 Identities = 43/115 (37%), Positives = 45/115 (39%), Gaps = 20/115 (17%) Frame = -1 Query: 339 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 160 P P AS P P PA S A+ S P P PPPP Sbjct: 465 PPPPPPRSPASQPPPPPPVPAASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPT---- 520 Query: 159 SSAPSPPPPPP---------PPPP------PRPPPPGGGG-----GPPAPRDSGG 55 SS P PPPPPP PPPP PRPPPP G G PP P +GG Sbjct: 521 SSVPPPPPPPPLPSSRGPPAPPPPPPSSSIPRPPPPPGRGPSAPPPPPPPAPAGG 575 [135][TOP] >UniRef100_B6Q8P3 Actin cortical patch assembly protein Pan1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q8P3_PENMQ Length = 1446 Score = 65.5 bits (158), Expect = 2e-09 Identities = 36/76 (47%), Positives = 36/76 (47%), Gaps = 17/76 (22%) Frame = -1 Query: 225 VQERRSRAPSPAPPPPAAAEKDSS-------------APSPPPPPPPP----PPPRPPPP 97 VQE A P PPPP A E S AP PPPPPPPP PPP PPPP Sbjct: 1339 VQESSPTALPPPPPPPPAEEAPISPESETPVTVAAPAAPPPPPPPPPPGAAAPPPPPPPP 1398 Query: 96 GGGGGPPAPRDSGGVD 49 GGPP GG D Sbjct: 1399 PPTGGPPPALGGGGTD 1414 [136][TOP] >UniRef100_A6R0R5 Predicted protein n=1 Tax=Ajellomyces capsulatus NAm1 RepID=A6R0R5_AJECN Length = 765 Score = 65.5 bits (158), Expect = 2e-09 Identities = 56/173 (32%), Positives = 70/173 (40%), Gaps = 24/173 (13%) Frame = -1 Query: 513 LVKTGAKSSWSAATLPAMPATP-GSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLP 337 L ++ SS S A P +PA P +T + P P R A+R LP Sbjct: 355 LPRSHRASSGSNAARPGVPAPPLPPKTPLEGERKVSAPQLPSRNPVLPARREVS--PGLP 412 Query: 336 SGVPVSICASVSP--------RPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPP 181 +P I + P PT+TP L+ L + AP+P PPP Sbjct: 413 PALPPKIPHATPPPPPPRPQASPTSTPQSQHLLPPQTAPGPLPVRPAPPPTSAPAPPPPP 472 Query: 180 PAAAEKD---SSAPSPPPPPPP------------PPPPRPPPPGGGGGPPAPR 67 P A SS+P+PPPPPPP PPPP PPPP G P PR Sbjct: 473 PPAPAPGPVPSSSPTPPPPPPPPPAPAPASTGPAPPPPPPPPPTAGLPRPPPR 525 Score = 63.2 bits (152), Expect = 1e-08 Identities = 54/187 (28%), Positives = 67/187 (35%), Gaps = 32/187 (17%) Frame = -1 Query: 468 PAMPA----TPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRL--PSGVPVSICAS 307 P +PA +PG ++ HA P P P A+ + L P P + Sbjct: 399 PVLPARREVSPGLPPALPPKIPHATPPPP-PPRPQASPTSTPQSQHLLPPQTAPGPLPVR 457 Query: 306 VSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPP 127 +P PT+ PA + S P P PPPP A S+ P+PPPPPP Sbjct: 458 PAPPPTSAPAPPPPPPPAPAPGPV-----PSSSPTPPPPPPPPPAPAPASTGPAPPPPPP 512 Query: 126 PPP-------PPRP-------------------PPPGGGGGPPAPRDSGGVDEERNSSGV 25 PPP PPRP PPP G PP P NS+G Sbjct: 513 PPPTAGLPRPPPRPAPSNSVPPPPPPSAGAPPPPPPPSAGAPPPPPPPPPPGSAANSAGP 572 Query: 24 DRRAPKA 4 P A Sbjct: 573 PPPPPPA 579 Score = 53.5 bits (127), Expect = 8e-06 Identities = 50/174 (28%), Positives = 61/174 (35%), Gaps = 31/174 (17%) Frame = -1 Query: 477 ATLPAMPATPGSRTTRSNRLYHAWPT----GPWRTSP----NAAKRNKRGRSRLPSGVPV 322 AT P P P + T + + H P GP P +A P+ PV Sbjct: 422 ATPPPPPPRPQASPTSTPQSQHLLPPQTAPGPLPVRPAPPPTSAPAPPPPPPPAPAPGPV 481 Query: 321 SICASVSPRPTNTPAVMALVLMGA----------TSRALR*DVQERRSRAPSPAPPPPAA 172 + P P P A G T+ R + S + P PPP A Sbjct: 482 PSSSPTPPPPPPPPPAPAPASTGPAPPPPPPPPPTAGLPRPPPRPAPSNSVPPPPPPSAG 541 Query: 171 AEKDSSAPS---PPPPPPPPP---------PPRPPPPGGGGGPPA-PRDSGGVD 49 A PS PPPPPPPPP PP PPPP P + P+ G D Sbjct: 542 APPPPPPPSAGAPPPPPPPPPPGSAANSAGPPPPPPPASSARPSSLPKSPGNAD 595 [137][TOP] >UniRef100_A5DKC7 Putative uncharacterized protein n=1 Tax=Pichia guilliermondii RepID=A5DKC7_PICGU Length = 270 Score = 65.5 bits (158), Expect = 2e-09 Identities = 50/145 (34%), Positives = 60/145 (41%), Gaps = 5/145 (3%) Frame = -1 Query: 489 SWSAATLPAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSICA 310 S S+ +L P P SR +S+ L ++ G + N R PS VP S Sbjct: 61 SSSSNSLKPPPKMPPSRPKKSSHLKNS-SIGSMSSFEN----------RAPSPVPTSPAP 109 Query: 309 SVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPS-----PAPPPPAAAEKDSSAPS 145 V P P VL G + + S APS APPP A AP+ Sbjct: 110 PVPSAPPPLPGAPPPVLGGGS----------KSSAAPSVPSFPSAPPPAPKATPALKAPA 159 Query: 144 PPPPPPPPPPPRPPPPGGGGGPPAP 70 P PP PPPPP PP PG PPAP Sbjct: 160 PAAPPAPPPPPAPPAPGMSSAPPAP 184 [138][TOP] >UniRef100_Q4RSW9 Chromosome 12 SCAF14999, whole genome shotgun sequence. (Fragment) n=2 Tax=Tetraodon nigroviridis RepID=Q4RSW9_TETNG Length = 175 Score = 65.1 bits (157), Expect = 3e-09 Identities = 37/99 (37%), Positives = 55/99 (55%), Gaps = 3/99 (3%) Frame = +2 Query: 230 YLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDL---PRLFRFAAFGLVLQGP 400 YL L PI TK++T+G+L LG+ L+Q L + D P + R+AA+GL + GP Sbjct: 6 YLFLLRKYPILTKSVTSGILTALGNLLSQSLEARKKASNDAICGPAVARYAAYGLFITGP 65 Query: 401 VGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 V H +Y L+E ++ I ++ D+L FAP F I Sbjct: 66 VSHCFYQLMEALIPATDPHCIIKRLLLDRLFFAPGFLLI 104 [139][TOP] >UniRef100_Q54XX9 PXMP2/4 family protein 2 n=1 Tax=Dictyostelium discoideum RepID=PX24B_DICDI Length = 193 Score = 65.1 bits (157), Expect = 3e-09 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 5/100 (5%) Frame = +2 Query: 221 WTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGT-----PLGNLDLPRLFRFAAFGL 385 W YL LD P+ TK+++ G L+G GD LAQ L LD R+ + G+ Sbjct: 5 WGLYLGLLDNHPLVTKSLSTGFLMGTGDILAQRLEHKFKDEKSQFKLDYKRVATMSTVGI 64 Query: 386 VLQGPVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPV 505 GP+ H WY L+ +V+ G + I K+ DQLLFAPV Sbjct: 65 FYSGPMLHYWYRSLDIMVKGEGRSVIIKKMLIDQLLFAPV 104 [140][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 65.1 bits (157), Expect = 3e-09 Identities = 48/157 (30%), Positives = 59/157 (37%), Gaps = 10/157 (6%) Frame = -1 Query: 498 AKSSWSAATLPAMPATP----------GSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGR 349 + SS + TLP P P S T+RS+ + P P P+ A + Sbjct: 649 SSSSSNKPTLPPPPPPPPAPPLPMFSSSSSTSRSSSSHGVPPPHPPPPPPSLAPKPPSAP 708 Query: 348 SRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAA 169 P P P P P T++ L + P P PPPP A Sbjct: 709 PPPPPPPPAPKPPGAPPPPPPPPP---------TTKPLG-------AHPPPPPPPPPPPA 752 Query: 168 EKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSG 58 K AP PPP PP PPP PP P G PP P+ G Sbjct: 753 PKPPGAPPPPPKPPSAPPPPPPKPPGAPPPPPPKLPG 789 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/114 (32%), Positives = 51/114 (44%), Gaps = 28/114 (24%) Frame = -1 Query: 327 PVSICASVSPR----PTNTPAVMALVLMGAT-----SRALR*DVQERRSRAPSPAPPPPA 175 P +I +++P+ P++ P + L G+ S A ++ + P P PPPP Sbjct: 512 PFAISGTIAPQAASLPSSAPPPLPPPLPGSALSMSQSYASNRNLLPPSTSTPPPPPPPPI 571 Query: 174 AAEKDSSAPSPPPPPP-------------------PPPPPRPPPPGGGGGPPAP 70 ++ K S P PPPPPP PPPPP PPPP G PP P Sbjct: 572 SSNKAPSPPPPPPPPPLPNVSNGNPLMPPTPASRGPPPPPPPPPPLPGPSPPPP 625 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/69 (43%), Positives = 32/69 (46%), Gaps = 12/69 (17%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP------------PPPRPPPPGGGGGPPAPRDSG 58 PSP PPPP S+ PPPPPPPP PPP PPPP PP P S Sbjct: 620 PSPPPPPPPPPPTSISSKGPPPPPPPPDFSSSSSNKPTLPPPPPPPP----APPLPMFSS 675 Query: 57 GVDEERNSS 31 R+SS Sbjct: 676 SSSTSRSSS 684 [141][TOP] >UniRef100_UPI00016E9C02 UPI00016E9C02 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E9C02 Length = 1073 Score = 65.1 bits (157), Expect = 3e-09 Identities = 47/136 (34%), Positives = 58/136 (42%), Gaps = 3/136 (2%) Frame = -1 Query: 468 PAMPATPGSRT--TRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSICASVSPR 295 P P TP S T T S LYH + + P+ S + R K R P +C Sbjct: 489 PKTPHTPSSLTFYTVSVYLYHFYVSLPFIASFGSTHRPKYQR-------PAGVCG----- 536 Query: 294 PTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPP 115 P +T ++A T ++ + P P PPPP P PPPPPP P Sbjct: 537 PCDTAGLLAGCAKNETQESVASECNINPXPPPPPPPPPPGGG------PPPPPPPPGCGP 590 Query: 114 PRPPP-PGGGGGPPAP 70 P PPP GG GGPP P Sbjct: 591 PPPPPFFGGPGGPPPP 606 [142][TOP] >UniRef100_C7BGM8 Formin 2A n=1 Tax=Physcomitrella patens RepID=C7BGM8_PHYPA Length = 1238 Score = 65.1 bits (157), Expect = 3e-09 Identities = 29/59 (49%), Positives = 30/59 (50%), Gaps = 11/59 (18%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----------PPPRPPPPGGGGGPPAPRDSG 58 P P PPPP S AP+PPPPPPPP PPP PPPP G PP P G Sbjct: 594 PPPPPPPPFGGRPASGAPAPPPPPPPPPPFGGRSNSGAPPPPPPPPSRPGAPPPPSPPG 652 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/63 (52%), Positives = 33/63 (52%), Gaps = 10/63 (15%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGG---GGGPPAPRD 64 RS AP P PP PA A PPPPPPPP PPP P PPGG GG PP P Sbjct: 667 RSNAPPPPPPLPAPPGGARPAGPPPPPPPPPGGARPAGPPPPPSPPGGRGRGGPPPPPPP 726 Query: 63 SGG 55 GG Sbjct: 727 PGG 729 Score = 61.2 bits (147), Expect = 4e-08 Identities = 32/74 (43%), Positives = 34/74 (45%), Gaps = 21/74 (28%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPP-----------PPPPPPP-------PPRPPPPGG- 91 R P P PPPP + + P PP PPPPPPP PP PPPPGG Sbjct: 685 RPAGPPPPPPPPPGGARPAGPPPPPSPPGGRGRGGPPPPPPPPGGARPAVPPPPPPPGGR 744 Query: 90 --GGGPPAPRDSGG 55 GG PP P GG Sbjct: 745 GPGGPPPPPPPPGG 758 Score = 60.5 bits (145), Expect = 7e-08 Identities = 30/60 (50%), Positives = 31/60 (51%), Gaps = 15/60 (25%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP------------PPPPRPPPPGGG---GGPPAP 70 AP P PPPP S+A PPPPPPP PPPP PPPP GG G PAP Sbjct: 554 APPPPPPPPFGGRSHSAAVPPPPPPPPPPFGGRPSSGAVPPPPPPPPPFGGRPASGAPAP 613 Score = 60.5 bits (145), Expect = 7e-08 Identities = 35/83 (42%), Positives = 35/83 (42%), Gaps = 19/83 (22%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP-------PPPPPP----------PPRPPPPG--GGGGP 79 P P PPPP A P PPP PPPPPP PP PPPPG G GGP Sbjct: 720 PPPPPPPPGGARPAVPPPPPPPGGRGPGGPPPPPPPPGGARPAGAPPPPPPPGGKGPGGP 779 Query: 78 PAPRDSGGVDEERNSSGVDRRAP 10 P P G G RAP Sbjct: 780 PPPPPPGAGRGRGGPPGPPARAP 802 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/49 (53%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAP 70 AP P PPPP S++ +PPPPPPPP PP P PPG G PP P Sbjct: 612 APPPPPPPPPPFGGRSNSGAPPPPPPPPSRPGAPPPPSPPGRSGAPPPP 660 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/61 (49%), Positives = 30/61 (49%), Gaps = 17/61 (27%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSA--PSPPPPPP-----------PPPPPRPPPPGGG----GGPPA 73 P P PPPP S A P PPPPPP PPPPP PPPP GG G PP Sbjct: 575 PPPPPPPPFGGRPSSGAVPPPPPPPPPFGGRPASGAPAPPPPPPPPPPFGGRSNSGAPPP 634 Query: 72 P 70 P Sbjct: 635 P 635 Score = 57.4 bits (137), Expect = 6e-07 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 12/65 (18%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPP---------PPPPPPPRPPPPGG---GGGPPAP 70 RS AP P PP P S+AP PPPP P PPPP PPPPGG G PP P Sbjct: 653 RSGAPPPPPPLPPGR---SNAPPPPPPLPAPPGGARPAGPPPPPPPPPGGARPAGPPPPP 709 Query: 69 RDSGG 55 GG Sbjct: 710 SPPGG 714 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/58 (46%), Positives = 28/58 (48%), Gaps = 14/58 (24%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP----------PPPRPPPPGG----GGGPPAP 70 P P PP P S +PPPPPPPP PPP PPPP G GG PP P Sbjct: 501 PPPPPPTPFGGRPSSGIAAPPPPPPPPPFGGRPAGGAPPPPPPPPFGGRPAGGAPPPP 558 Score = 55.8 bits (133), Expect = 2e-06 Identities = 32/71 (45%), Positives = 34/71 (47%), Gaps = 19/71 (26%) Frame = -1 Query: 210 SRAPSPAPPPPA--------AAEKDSSAPSPPPP-------PPPPPPPRPPPPGG----G 88 S AP P PPPP+ + S AP PPPP PPPPPP P PPGG G Sbjct: 629 SGAPPPPPPPPSRPGAPPPPSPPGRSGAPPPPPPLPPGRSNAPPPPPPLPAPPGGARPAG 688 Query: 87 GGPPAPRDSGG 55 PP P GG Sbjct: 689 PPPPPPPPPGG 699 Score = 54.3 bits (129), Expect = 5e-06 Identities = 33/77 (42%), Positives = 36/77 (46%), Gaps = 18/77 (23%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP---------PPPRPPPPGGGGG---------P 79 AP P PPPP + + +PPPPPPPP PPP PPPP GG P Sbjct: 519 APPPPPPPPPFGGRPAGG-APPPPPPPPFGGRPAGGAPPPPPPPPFGGRSHSAAVPPPPP 577 Query: 78 PAPRDSGGVDEERNSSG 28 P P GG R SSG Sbjct: 578 PPPPPFGG----RPSSG 590 [143][TOP] >UniRef100_C5YV28 Putative uncharacterized protein Sb09g027730 n=1 Tax=Sorghum bicolor RepID=C5YV28_SORBI Length = 408 Score = 65.1 bits (157), Expect = 3e-09 Identities = 36/78 (46%), Positives = 41/78 (52%), Gaps = 8/78 (10%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPS-PPPPPPPPPPPRPPPP-------GGGGGPPAPRDSGG 55 S A PAPPPPAAA S AP P PPPP PPPRPPPP GG P P ++ Sbjct: 8 SPAAPPAPPPPAAAPPPSPAPPWPRPPPPLRPPPRPPPPPPPGTLAAGGAWPRPPPNAAT 67 Query: 54 VDEERNSSGVDRRAPKAG 1 DE+ ++ R AG Sbjct: 68 TDEDEVAADATPRPDSAG 85 [144][TOP] >UniRef100_C5XD76 Putative uncharacterized protein Sb02g038276 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XD76_SORBI Length = 869 Score = 65.1 bits (157), Expect = 3e-09 Identities = 33/64 (51%), Positives = 35/64 (54%), Gaps = 14/64 (21%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPP-------PPPPPP------PPRPPPPGGGG-GPPAPR 67 A +P PPPP A + P PPP PPPPPP PP PPPPGGGG GPP P Sbjct: 718 ASAPPPPPPPGARPGAPPPPPPPGSRPGAPPPPPPPGARPGAPPPPPPPGGGGRGPPPPP 777 Query: 66 DSGG 55 GG Sbjct: 778 APGG 781 Score = 55.8 bits (133), Expect = 2e-06 Identities = 31/67 (46%), Positives = 34/67 (50%), Gaps = 14/67 (20%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPP-------PRPPPPGG-GGGPPA 73 SR +P PPPP A + P PPP PPPPP P P PPPPGG G PA Sbjct: 742 SRPGAPPPPPPPGARPGAPPPPPPPGGGGRGPPPPPAPGGRLGGHPPPPPPGGRAPGAPA 801 Query: 72 PRDSGGV 52 P + GV Sbjct: 802 PPRAPGV 808 [145][TOP] >UniRef100_Q4QE97 Formin A n=1 Tax=Leishmania major RepID=Q4QE97_LEIMA Length = 1300 Score = 65.1 bits (157), Expect = 3e-09 Identities = 37/94 (39%), Positives = 39/94 (41%), Gaps = 24/94 (25%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPS----------------------PPPPPPPPPPPRPPPP 97 S AP P PPPP SS P+ PPPPPPPPPPP PPPP Sbjct: 622 SSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPP 681 Query: 96 GGGGGPPAPRDSG--GVDEERNSSGVDRRAPKAG 1 G GPP P G G +S R P G Sbjct: 682 RMGNGPPPPPGKGASGAAAPMLNSSTTRNVPING 715 [146][TOP] >UniRef100_B5DI49 GA25909 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DI49_DROPS Length = 1129 Score = 65.1 bits (157), Expect = 3e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 15/64 (23%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP--------PPPPPRP-------PPPGGGGGPPAPR 67 P P PPP A A +AP PPPPPP PPPPP P PPP G GGPP P Sbjct: 541 PPPPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPPPPPMPGSGAPPPPPPPGFGGPPPPP 600 Query: 66 DSGG 55 SGG Sbjct: 601 GSGG 604 Score = 59.3 bits (142), Expect = 2e-07 Identities = 32/57 (56%), Positives = 32/57 (56%), Gaps = 12/57 (21%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPP-------PPPPPPR----PPPPG-GGGGPPAP 70 AP P PPPP S AP PPPPP PPPPPP PPPPG GGG PP P Sbjct: 557 APPPPPPPPMPG---SGAPPPPPPPMPGSGAPPPPPPPGFGGPPPPPGSGGGPPPPP 610 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/61 (44%), Positives = 30/61 (49%), Gaps = 10/61 (16%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPP----------PPPPPRPPPPGGGGGPPA 73 ++ A +PAPPP A P PPPPPP PPPPP PP PG G PP Sbjct: 516 EQSAESAGTPAPPPAPALVIPPPPPPPPPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPP 575 Query: 72 P 70 P Sbjct: 576 P 576 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/46 (58%), Positives = 27/46 (58%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 S APPPP S AP PPPPP P PPPPG GGGPP P S Sbjct: 569 SGAPPPPPPPMPGSGAPPPPPPPGFGGP--PPPPGSGGGPPPPPPS 612 [147][TOP] >UniRef100_B4G8I0 GL19302 n=1 Tax=Drosophila persimilis RepID=B4G8I0_DROPE Length = 1104 Score = 65.1 bits (157), Expect = 3e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 15/64 (23%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP--------PPPPPRP-------PPPGGGGGPPAPR 67 P P PPP A A +AP PPPPPP PPPPP P PPP G GGPP P Sbjct: 516 PPPPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPPPPPMPGSGAPPPPPPPGFGGPPPPP 575 Query: 66 DSGG 55 SGG Sbjct: 576 GSGG 579 Score = 59.3 bits (142), Expect = 2e-07 Identities = 32/57 (56%), Positives = 32/57 (56%), Gaps = 12/57 (21%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPP-------PPPPPPR----PPPPG-GGGGPPAP 70 AP P PPPP S AP PPPPP PPPPPP PPPPG GGG PP P Sbjct: 532 APPPPPPPPMPG---SGAPPPPPPPMPGSGAPPPPPPPGFGGPPPPPGSGGGPPPPP 585 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/61 (44%), Positives = 30/61 (49%), Gaps = 10/61 (16%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPP----------PPPPPRPPPPGGGGGPPA 73 ++ A +PAPPP A P PPPPPP PPPPP PP PG G PP Sbjct: 491 EQSAESAGTPAPPPAPALVIPPPPPPPPPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPP 550 Query: 72 P 70 P Sbjct: 551 P 551 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/46 (58%), Positives = 27/46 (58%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 S APPPP S AP PPPPP P PPPPG GGGPP P S Sbjct: 544 SGAPPPPPPPMPGSGAPPPPPPPGFGGP--PPPPGSGGGPPPPPPS 587 [148][TOP] >UniRef100_A7SLQ1 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SLQ1_NEMVE Length = 1027 Score = 65.1 bits (157), Expect = 3e-09 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPP PPPP PPPPG GGGPP P Sbjct: 416 PPPPPPPPGGV------PPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPP 458 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 5/52 (9%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPAPRDSGG 55 P PPPP + P PPPPPP PPPPP PPP GGG PP P GG Sbjct: 427 PPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGG 478 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 5/52 (9%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPP-----PPPPPPRPPPPGGGGGPPAPRDSGG 55 P PPPP + P PPPPP PPPPPP PP PGGG PP P GG Sbjct: 428 PPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGG 479 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPP---PPRPPPPGGGG--GPPAP 70 AP P PPPP P PPPPPPP P PP PPPP GGG GPP P Sbjct: 440 APPPPPPPPPGM---GGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPPPP 486 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/56 (50%), Positives = 28/56 (50%), Gaps = 12/56 (21%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP-------PPPPPPP-----PRPPPPGGGGGPPAP 70 P P PPPP P PPP PPPPPPP P PPPP GGGPP P Sbjct: 428 PPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGP 483 [149][TOP] >UniRef100_UPI00006D721A PREDICTED: similar to Peroxisomal membrane protein 2 (22 kDa peroxisomal membrane protein) n=1 Tax=Macaca mulatta RepID=UPI00006D721A Length = 195 Score = 64.7 bits (156), Expect = 4e-09 Identities = 42/112 (37%), Positives = 62/112 (55%), Gaps = 6/112 (5%) Frame = +2 Query: 191 AGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQML----TGTPLGNLDLPR 358 AGLGAL R+ YL L + P+ TKA T+G+L LG+ LAQM+ +LD+ Sbjct: 12 AGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKEHSRSLDVGG 71 Query: 359 LFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAG--KVAADQLLFAPVF 508 R+A +G GP+ H +Y +E + P +AG ++ D+L+FAP F Sbjct: 72 PLRYAVYGFFFTGPLSHFFYLFMEHWI--PPEVPLAGLRRLLLDRLVFAPAF 121 [150][TOP] >UniRef100_B7G9T7 Predicted protein (Fragment) n=1 Tax=Phaeodactylum tricornutum CCAP 1055/1 RepID=B7G9T7_PHATR Length = 228 Score = 64.7 bits (156), Expect = 4e-09 Identities = 32/102 (31%), Positives = 52/102 (50%), Gaps = 4/102 (3%) Frame = +2 Query: 221 WTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGP 400 W Y + L+ +P+ TKA T+ + +GD +AQ G +G+LD R+ R GL+ GP Sbjct: 43 WAGYSQVLENSPVATKAATSATVYTIGDFIAQRTQGAAMGDLDRGRIVRSMLAGLIGHGP 102 Query: 401 VGHAWYNL----LERVVRLPGVAGIAGKVAADQLLFAPVFTS 514 + H WYN+ + V+ KV DQ + P++ + Sbjct: 103 LSHFWYNVCDHFFDNVLHWTAWWSFFPKVVVDQTTWGPIWNN 144 [151][TOP] >UniRef100_A8IS66 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8IS66_CHLRE Length = 246 Score = 64.7 bits (156), Expect = 4e-09 Identities = 50/147 (34%), Positives = 65/147 (44%), Gaps = 18/147 (12%) Frame = +2 Query: 119 GGGGGGGGGEGADE-----------SFSAAAGGGGAGLGALLLRSWTSYLKALDVAPIKT 265 GGG GG G + S S+A GG + W + LKA Sbjct: 9 GGGAYFGGRPGFNRIRKTRRNDIRRSASSATAPGGQPSYWQKVAGWEAPLKA-------- 60 Query: 266 KAITAGVLVGLGDTLAQMLT-------GTPLGNLDLPRLFRFAAFGLVLQGPVGHAWYNL 424 A+T+G L GLGD LAQ L G P D R R +G GP + WYNL Sbjct: 61 -AVTSGTLSGLGDLLAQGLLSQTAAREGKPAPAYDPLRTLRMFGYGFTWYGPCQYYWYNL 119 Query: 425 LERVVRLPGVAGIAGKVAADQLLFAPV 505 L+ ++ + A GKVAA+QL+ AP+ Sbjct: 120 LDFLMPVKTTATFLGKVAANQLILAPI 146 [152][TOP] >UniRef100_Q9NR77 Peroxisomal membrane protein 2 n=1 Tax=Homo sapiens RepID=PXMP2_HUMAN Length = 195 Score = 64.7 bits (156), Expect = 4e-09 Identities = 42/112 (37%), Positives = 62/112 (55%), Gaps = 6/112 (5%) Frame = +2 Query: 191 AGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQML----TGTPLGNLDLPR 358 AGLGAL R+ YL L + P+ TKA T+G+L LG+ LAQM+ +LD+ Sbjct: 12 AGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVGG 71 Query: 359 LFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAG--KVAADQLLFAPVF 508 R+A +G GP+ H +Y +E + P +AG ++ D+L+FAP F Sbjct: 72 PLRYAVYGFFFTGPLSHFFYFFMEHWI--PPEVPLAGLRRLLLDRLVFAPAF 121 [153][TOP] >UniRef100_UPI00019829F7 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019829F7 Length = 610 Score = 64.7 bits (156), Expect = 4e-09 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P+PPPP + +S P+PPPP P PPPP PPPP G GPP P Sbjct: 62 SNTSPPSPPPP---KSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKP 105 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/67 (43%), Positives = 35/67 (52%), Gaps = 5/67 (7%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPGGGGGPPAPRDSGGVD 49 +S +P P PPPP+ PSPPPPPPPPP PP+PPPP P P + Sbjct: 73 KSESPPPTPPPPS--------PSPPPPPPPPPSSGSGPPKPPPPSHSNSSPPPPPTSPPP 124 Query: 48 EERNSSG 28 + SSG Sbjct: 125 KSSQSSG 131 [154][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 64.7 bits (156), Expect = 4e-09 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAP-SPPPPPPPPPPPRPPPPGGGGGPPAP 70 ++R +PSP PPPP P SPPPPPPPPPPP PPPP PP+P Sbjct: 216 RDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P APPPP ++ ++PSPPPPPPPPPPP PPPP PP P Sbjct: 207 PVSAPPPPFR-DRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPP 249 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 P P PPPP P PPPPPPPPPPP PPPP PP Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPP 272 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 P P PPPP P PPPPPPPPPPP P PP PP P+ Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPK 273 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/48 (50%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPP------PRPPPPGGGGGPP 76 P P PPPP + P PPPPPPPPPP P PPPP G P Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTP 279 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP--PPPPRPPPPGGGGGPPAPRD 64 P P PPPP+ P PPPPPPP PPPP P PP G P P + Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTPNN 281 [155][TOP] >UniRef100_C7J8C9 Os11g0105750 protein (Fragment) n=2 Tax=Oryza sativa Japonica Group RepID=C7J8C9_ORYSJ Length = 918 Score = 64.7 bits (156), Expect = 4e-09 Identities = 35/76 (46%), Positives = 43/76 (56%), Gaps = 2/76 (2%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVD 49 ++++R R P P P P A A S+ PPP PP PPP PPPPG GGPP P G Sbjct: 588 NIEKRAPRVPRPPPAPSATANTASALSPPPPRPPGAPPP-PPPPGKPGGPPPPPPPPG-S 645 Query: 48 EERNSSGVDR--RAPK 7 RN +G D+ RAP+ Sbjct: 646 LPRNLAGGDKVHRAPE 661 [156][TOP] >UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9EXV1_ORYSJ Length = 532 Score = 64.7 bits (156), Expect = 4e-09 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP+PPPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 377 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 420 Score = 63.9 bits (154), Expect = 6e-09 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 360 PSPPPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 403 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/46 (54%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG--GGGPPAP 70 PSP+PPPP+ PSP PPPP PPPP PPPP PP P Sbjct: 394 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPP 439 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 365 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 408 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 382 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 425 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PP P+ PSPPPP P PPPP PPPP PP P S Sbjct: 372 PSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP----SPPPPSPS 414 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ + S P P PPPP P PP P PP PP+P Sbjct: 387 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 430 [157][TOP] >UniRef100_B8BNT3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BNT3_ORYSI Length = 930 Score = 64.7 bits (156), Expect = 4e-09 Identities = 35/76 (46%), Positives = 43/76 (56%), Gaps = 2/76 (2%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVD 49 ++++R R P P P P A A S+ PPP PP PPP PPPPG GGPP P G Sbjct: 588 NIEKRAPRVPRPPPAPSATANTASALSPPPPRPPGAPPP-PPPPGKPGGPPPPPPPPG-S 645 Query: 48 EERNSSGVDR--RAPK 7 RN +G D+ RAP+ Sbjct: 646 LPRNLAGGDKVHRAPE 661 [158][TOP] >UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa RepID=Q8L3T8_ORYSJ Length = 570 Score = 64.7 bits (156), Expect = 4e-09 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP+PPPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 415 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 458 Score = 63.9 bits (154), Expect = 6e-09 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 398 PSPPPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 441 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/46 (54%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG--GGGPPAP 70 PSP+PPPP+ PSP PPPP PPPP PPPP PP P Sbjct: 432 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPP 477 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 403 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 446 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 420 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 463 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PP P+ PSPPPP P PPPP PPPP PP P S Sbjct: 410 PSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP----SPPPPSPS 452 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ + S P P PPPP P PP P PP PP+P Sbjct: 425 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 468 [159][TOP] >UniRef100_A7QNX2 Chromosome chr1 scaffold_135, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QNX2_VITVI Length = 673 Score = 64.7 bits (156), Expect = 4e-09 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P+PPPP + +S P+PPPP P PPPP PPPP G GPP P Sbjct: 62 SNTSPPSPPPP---KSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKP 105 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 6/57 (10%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPG-GGGGPPAPRDS 61 +S +P P PPPP+ PSPPPPPPPPP PP+PPPP PP P S Sbjct: 73 KSESPPPTPPPPS--------PSPPPPPPPPPSSGSGPPKPPPPSHSNSSPPPPPTS 121 [160][TOP] >UniRef100_A4S9A6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S9A6_OSTLU Length = 4076 Score = 64.7 bits (156), Expect = 4e-09 Identities = 30/64 (46%), Positives = 35/64 (54%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGV 25 +P P+PPPP + S P PP PPPP PPP PPPP PP P +G E R S Sbjct: 83 SPPPSPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPP----SPPPPPGAGAAIEVRFGSTT 138 Query: 24 DRRA 13 +R A Sbjct: 139 ERVA 142 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/62 (41%), Positives = 31/62 (50%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGV 25 +P P PPP + S P P PPPP PPPP PPPP PP P + S G+ Sbjct: 2088 SPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPMHDFDETDTDGSGGI 2143 Query: 24 DR 19 D+ Sbjct: 2144 DK 2145 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGG 88 S P P+PPPP + S P P PPP PPPP PPPPG G Sbjct: 87 SPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPPPGAG 127 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/50 (50%), Positives = 28/50 (56%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 ER + P P+PPPP+ PSPPPP PPPPP PPP PP P Sbjct: 2065 ERIASPPPPSPPPPSPPPSPPP-PSPPPPSPPPPPSPPPPSPPPPSPPPP 2113 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/66 (42%), Positives = 36/66 (54%), Gaps = 3/66 (4%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSS 31 PSP PPPP+ PSPPPP PP PPPP PPPP SGG+D+ ++ Sbjct: 2092 PSP-PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPMHDFDETDTDGSGGIDKSELTA 2150 Query: 30 GVDRRA 13 +++ A Sbjct: 2151 IIEKGA 2156 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/40 (57%), Positives = 26/40 (65%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPG 94 R +P P+PPPP + PSPPPP PPPP P PPPPG Sbjct: 1865 RIASPPPSPPPPPSPPP----PSPPPPSPPPPSPPPPPPG 1900 [161][TOP] >UniRef100_Q1HMI6 Formin A n=2 Tax=Trypanosoma cruzi RepID=Q1HMI6_TRYCR Length = 1178 Score = 64.7 bits (156), Expect = 4e-09 Identities = 31/61 (50%), Positives = 32/61 (52%), Gaps = 13/61 (21%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPP----------PPPPPPPRPPPPGGG---GGPPA 73 +S P P PPPP A K P PPPP PPPPPPP PPPPG G G PP Sbjct: 630 KSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPPPPPPPPPGAGAKSGLPPP 689 Query: 72 P 70 P Sbjct: 690 P 690 Score = 60.8 bits (146), Expect = 5e-08 Identities = 33/76 (43%), Positives = 37/76 (48%), Gaps = 13/76 (17%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP----------PPPRPPPPGGGGGPPA--- 73 +S P P PPPP A K +P PPPPPPPP PPP PPPP PA Sbjct: 646 KSGLPPPPPPPPGAGAKSGLSPPPPPPPPPPPPGAGAKSGLPPPPPPPPPKAKSRPAQTG 705 Query: 72 PRDSGGVDEERNSSGV 25 P S +D +N S V Sbjct: 706 PTRSIPIDVVKNISKV 721 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 11/59 (18%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP--------PPPRPPPPGGG---GGPPAP 70 +S P P PPPP A K PPPPPPPP PPP PPPPG G G PP P Sbjct: 534 KSGLPPPPPPPPGAGAKSG---LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 589 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 11/59 (18%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP--------PPPRPPPPGGG---GGPPAP 70 +S P P PPPP A K PPPPPPPP PPP PPPPG G G PP P Sbjct: 566 KSGLPPPPPPPPGAGAKSG---LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 621 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 11/59 (18%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP--------PPPRPPPPGGG---GGPPAP 70 +S P P PPPP A K PPPPPPPP PPP PPPPG G G PP P Sbjct: 598 KSGLPPPPPPPPGAGAKSG---LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 653 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/56 (51%), Positives = 29/56 (51%), Gaps = 9/56 (16%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGG---GGPPAP 70 S P P PPPP A S P PPPPPP PPP PPPPG G G PP P Sbjct: 518 SGLPPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 573 Score = 57.4 bits (137), Expect = 6e-07 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 9/57 (15%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGG---GGPPAP 70 +S P P PPPP A K S P PPPPPP PPP PPPPG G G PP P Sbjct: 550 KSGLPPPPPPPPGAGAK-SGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 605 Score = 57.4 bits (137), Expect = 6e-07 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 9/57 (15%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGG---GGPPAP 70 +S P P PPPP A K S P PPPPPP PPP PPPPG G G PP P Sbjct: 582 KSGLPPPPPPPPGAGAK-SGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 637 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/58 (50%), Positives = 30/58 (51%), Gaps = 10/58 (17%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGG----GPPAP 70 +S P P PPPP A K S P PPPPPP PPP PPPPG G PP P Sbjct: 614 KSGLPPPPPPPPGAGAK-SGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPP 670 [162][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/68 (42%), Positives = 31/68 (45%) Frame = -1 Query: 225 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDE 46 V R P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 VASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQA 69 Query: 45 ERNSSGVD 22 +R V+ Sbjct: 70 QRRVDAVE 77 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/53 (49%), Positives = 27/53 (50%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 D +R P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 DTPVASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/57 (47%), Positives = 28/57 (49%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSS 31 P P PPPP P PPPPPPPPPPP PPPP A R V+ SS Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVDAVEVAPRSS 83 [163][TOP] >UniRef100_C1GXM9 Cytokinesis protein sepA n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1GXM9_PARBA Length = 1734 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/48 (60%), Positives = 30/48 (62%), Gaps = 4/48 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 70 PSP PPPP A + P PPPPPPP PPPP PPPPG G PP P Sbjct: 977 PSPPPPPPPPA---AGGPPPPPPPPPGIGAPPPPPPPPPGAGPPPPPP 1021 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/53 (56%), Positives = 30/53 (56%), Gaps = 4/53 (7%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP----PPPRPPPPGGGGGPPAPRDSG 58 AP P PPPP A PPPPPPPP PPP PPPPG GG PP P G Sbjct: 1003 APPPPPPPPPGA-------GPPPPPPPPGVGSPPPPPPPPGMGGPPPPPPPPG 1048 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 10/59 (16%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAP------SPPPPPPPPP----PPRPPPPGGGGGPPAPRDSG 58 +P P PPPPAA P +PPPPPPPPP PP PPPPG G PP P G Sbjct: 978 SPPPPPPPPAAGGPPPPPPPPPGIGAPPPPPPPPPGAGPPPPPPPPGVGSPPPPPPPPG 1036 Score = 60.5 bits (145), Expect = 7e-08 Identities = 28/52 (53%), Positives = 28/52 (53%), Gaps = 8/52 (15%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPP----PPPPPPP----PPRPPPPGGGGGPPAP 70 P P PPPP P PP PPPPPPP PP PPPP G GGPP P Sbjct: 992 PPPPPPPPGIGAPPPPPPPPPGAGPPPPPPPPGVGSPPPPPPPPGMGGPPPP 1043 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/52 (50%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAPRDSG 58 P P PPPP +P PPPPPP PPPPP PP GG PP P G Sbjct: 1016 PPPPPPPPGVG-----SPPPPPPPPGMGGPPPPPPPPGAAPGGSPPPPPPPG 1062 [164][TOP] >UniRef100_C0NIM8 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NIM8_AJECG Length = 281 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/60 (48%), Positives = 31/60 (51%), Gaps = 16/60 (26%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPP----------------PPGGGGGP 79 S +P P PPPP+ S P PPPPPPPPPPP PP PP GGGGP Sbjct: 117 SYSPPPPPPPPSPPSPSPSPPPPPPPPPPPPPPPPPSPPAPAPSNPSTPPTSPPSGGGGP 176 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/46 (58%), Positives = 28/46 (60%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 SP PPPP + S PPPPPPPPPPP PPPP PPAP S Sbjct: 119 SPPPPPPPPSPPSPSPSPPPPPPPPPPPPPPPPP----SPPAPAPS 160 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/53 (50%), Positives = 29/53 (54%), Gaps = 6/53 (11%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPP------PGGGGGPPAPRDSGG 55 P PPPP + S +P PPPPPPPPPPP PPP P PP SGG Sbjct: 121 PPPPPPPSPPSPSPSPPPPPPPPPPPPPPPPPSPPAPAPSNPSTPPTSPPSGG 173 [165][TOP] >UniRef100_B8LZG7 Formin 1,2/cappuccino, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8LZG7_TALSN Length = 675 Score = 64.7 bits (156), Expect = 4e-09 Identities = 28/50 (56%), Positives = 30/50 (60%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGG 55 APS PPPP ++AP PPPPPP PP PPPP GGPPA GG Sbjct: 589 APSAPPPPPPPPPPGTAAPPPPPPPPGGAPPPPPPPPPAGGPPASALGGG 638 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/67 (46%), Positives = 35/67 (52%), Gaps = 18/67 (26%) Frame = -1 Query: 201 PSPAPPP-------PAAAEKDS-------SAPSPPPPPPPP----PPPRPPPPGGGGGPP 76 P P+ PP P++ E D+ SAP PPPPPPPP PPP PPPPGG PP Sbjct: 562 PPPSAPPTLPVAEAPSSPESDTPAAVAAPSAPPPPPPPPPPGTAAPPPPPPPPGGAPPPP 621 Query: 75 APRDSGG 55 P G Sbjct: 622 PPPPPAG 628 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSP---PPPPPPPPPPRPPPP---GGGGGPP 76 P P PPPP A P P PPPPPPPPP PP GGGGG P Sbjct: 595 PPPPPPPPGTAAPPPPPPPPGGAPPPPPPPPPAGGPPASALGGGGGAP 642 [166][TOP] >UniRef100_Q9FPQ6 Vegetative cell wall protein gp1 n=1 Tax=Chlamydomonas reinhardtii RepID=GP1_CHLRE Length = 555 Score = 64.7 bits (156), Expect = 4e-09 Identities = 27/44 (61%), Positives = 28/44 (63%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSPAPP PA AP PPP PPPPPPPRPP P PP+P Sbjct: 247 PSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSP 290 Score = 53.5 bits (127), Expect = 8e-06 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSPAPP PA S AP PP P PP PP P PP PPAP Sbjct: 200 PSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPP--SPSPPAP 241 [167][TOP] >UniRef100_Q54WH2 Formin-A n=1 Tax=Dictyostelium discoideum RepID=FORA_DICDI Length = 1218 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 6/49 (12%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 70 S APPPP AP PPPPPPP PPPP PPPP GGGPP P Sbjct: 647 SVAPPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPP 695 Score = 63.9 bits (154), Expect = 6e-09 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 5/48 (10%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 70 +P PPPP P PPPPPPP PPPP PPPP GGGPP P Sbjct: 662 APPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPP 709 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/53 (52%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPP-----PPRPPPPGGGGGPPAPRDSG 58 P P PPPP + PPPPPPPPP PP PPPP GGG PP P G Sbjct: 679 PPPPPPPPM------TGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPPG 725 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGGGGGPPAP 70 P PPPP P PPPPPP PPP PPPPGGG PP P Sbjct: 678 PPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPPP 722 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 6/44 (13%) Frame = -1 Query: 183 PPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGGPPAP 70 P +AA S AP PPPPP PPPPPP PP GGGG PP P Sbjct: 639 PDSAAASTSVAPPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPP 682 Score = 57.0 bits (136), Expect = 8e-07 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGG-GGGPPAP 70 P P PPPP + PPPPPPPP PPP PPPPG GGPP P Sbjct: 693 PPPPPPPPM------TGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPPP 734 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/60 (46%), Positives = 29/60 (48%), Gaps = 10/60 (16%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP---PPPPPPP-------PRPPPPGGGGGPPAPRDSGGV 52 P P PPPP P PPP PPPPPPP P PPPP G GPP P G+ Sbjct: 692 PPPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPPPGGFGM 751 Score = 53.5 bits (127), Expect = 8e-06 Identities = 25/45 (55%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Frame = -1 Query: 192 APPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAP 70 A P AAA + P PPPP PPPPP PPP GGGGPP P Sbjct: 637 AKPDSAAASTSVAPPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPP 681 [168][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 64.3 bits (155), Expect = 5e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP PSPPPPPPPPPPP PPPP PP P Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 64.3 bits (155), Expect = 5e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP S P PPPPPPPPPPP PPPP PP P Sbjct: 364 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 64.3 bits (155), Expect = 5e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP S P PPPPPPPPPPP PPPP PP P Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP +P PPPPPPPPPPP PPPP PP P Sbjct: 363 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/50 (50%), Positives = 30/50 (60%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 E ++ +P+ PPP +A P PPPPPPPPPPP PPPP PP P Sbjct: 335 EMQTGSPNACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPP 384 Score = 60.5 bits (145), Expect = 7e-08 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -1 Query: 189 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PPPP+A P PPPPPPPPPPP PPPP PP P Sbjct: 346 PPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPP 385 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPP PPPPPP PPPP PP P Sbjct: 356 PCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PP PPPPPPPP PPPP PP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 401 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P P PPPPPPPPP PPPP PP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPP PPPP PP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 403 [169][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 64.3 bits (155), Expect = 5e-09 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 P P PPPP P PPPPPPPPPPP PPPP PP PR Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [170][TOP] >UniRef100_UPI00016E10B6 UPI00016E10B6 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B6 Length = 1270 Score = 64.3 bits (155), Expect = 5e-09 Identities = 27/49 (55%), Positives = 29/49 (59%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSG 58 AP P PPPP + + PPPPPPPPPP PPPPG G PP P G Sbjct: 682 APPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPG 730 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPR 67 P P PPPPA P PPPPPPPPP PP PPPP G P + Sbjct: 690 PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQK 738 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGP 79 P P PPPP A P PPPPPPPP PPP PPPPG P Sbjct: 689 PPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAP 735 [171][TOP] >UniRef100_UPI00016E10B5 UPI00016E10B5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B5 Length = 1246 Score = 64.3 bits (155), Expect = 5e-09 Identities = 27/49 (55%), Positives = 29/49 (59%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSG 58 AP P PPPP + + PPPPPPPPPP PPPPG G PP P G Sbjct: 658 APPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPG 706 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPR 67 P P PPPPA P PPPPPPPPP PP PPPP G P + Sbjct: 666 PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQK 714 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGP 79 P P PPPP A P PPPPPPPP PPP PPPPG P Sbjct: 665 PPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAP 711 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P+P P PP A AP PPPPPPPPPP PPPP PP P Sbjct: 642 PAPPPLPPGAG---LGAPPAPPPPPPPPPPPPPPPALLASPPPP 682 [172][TOP] >UniRef100_UPI00016E10B4 UPI00016E10B4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B4 Length = 1323 Score = 64.3 bits (155), Expect = 5e-09 Identities = 27/49 (55%), Positives = 29/49 (59%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSG 58 AP P PPPP + + PPPPPPPPPP PPPPG G PP P G Sbjct: 735 APPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPG 783 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPR 67 P P PPPPA P PPPPPPPPP PP PPPP G P + Sbjct: 743 PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQK 791 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGP 79 P P PPPP A P PPPPPPPP PPP PPPPG P Sbjct: 742 PPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAP 788 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P+P P PP A AP PPPPPPPPPP PPPP PP P Sbjct: 719 PAPPPLPPGAG---LGAPPAPPPPPPPPPPPPPPPALLASPPPP 759 [173][TOP] >UniRef100_UPI00016E10A1 UPI00016E10A1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10A1 Length = 1396 Score = 64.3 bits (155), Expect = 5e-09 Identities = 27/49 (55%), Positives = 29/49 (59%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSG 58 AP P PPPP + + PPPPPPPPPP PPPPG G PP P G Sbjct: 808 APPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPG 856 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPR 67 P P PPPPA P PPPPPPPPP PP PPPP G P + Sbjct: 816 PPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQK 864 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGGGGP 79 P P PPPP A P PPPPPPPP PPP PPPPG P Sbjct: 815 PPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAP 861 [174][TOP] >UniRef100_Q4S986 Chromosome 3 SCAF14700, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4S986_TETNG Length = 1204 Score = 64.3 bits (155), Expect = 5e-09 Identities = 40/107 (37%), Positives = 44/107 (41%), Gaps = 11/107 (10%) Frame = -1 Query: 327 PVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAP 148 P V P P P AL MGA P P PPPP+AA P Sbjct: 600 PPPALGGVPPPPPPPPPPPALGAMGAP---------------PPPPPPPPSAAGLPPPPP 644 Query: 147 ------SPPPPPPPP-----PPPRPPPPGGGGGPPAPRDSGGVDEER 40 PPPPPPPP PPP PPPP G GPP P G+ ++ Sbjct: 645 PPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPPPPMPGLKTKK 691 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/63 (46%), Positives = 31/63 (49%), Gaps = 16/63 (25%) Frame = -1 Query: 210 SRAPSPAPPPP-----------AAAEKDSSAPSPPP-----PPPPPPPPRPPPPGGGGGP 79 S P P PPPP A++ SAP PPP PPPPPPPP PP G G P Sbjct: 567 SSPPPPPPPPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPPPPPALGAMGAP 626 Query: 78 PAP 70 P P Sbjct: 627 PPP 629 Score = 54.7 bits (130), Expect = 4e-06 Identities = 38/97 (39%), Positives = 42/97 (43%), Gaps = 7/97 (7%) Frame = -1 Query: 339 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 160 P+ VS+ S P P P + G S A DV + S PPPPA Sbjct: 557 PNSPQVSLPTSSPPPPPPPPP--PCIPGGNLSPAPASDVCD------SAPPPPPALG--G 606 Query: 159 SSAPSPPPPPPP-------PPPPRPPPPGGGGGPPAP 70 P PPPPPPP PPPP PPPP G PP P Sbjct: 607 VPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPP 643 [175][TOP] >UniRef100_B6INW7 R body protein, putative n=1 Tax=Rhodospirillum centenum SW RepID=B6INW7_RHOCS Length = 157 Score = 64.3 bits (155), Expect = 5e-09 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGG 88 AP PAPP P + P+PP PPPPPPPP PPPPGGG Sbjct: 119 APPPAPPAPPPPPPPAPPPAPPAPPPPPPPPPPPPPGGG 157 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PAPPPP A + P PP PPPPPPP PPP PP P Sbjct: 104 PPPAPPPPPAPPPPPAPPPAPPAPPPPPPPAPPPAPPAPPPPPP 147 Score = 57.4 bits (137), Expect = 6e-07 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 +P PPPPA + P P PPP PP PP PPPP PPAP Sbjct: 100 TPQPPPPAPPPPPAPPPPPAPPPAPPAPPPPPPPAPPPAPPAP 142 [176][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 64.3 bits (155), Expect = 5e-09 Identities = 46/149 (30%), Positives = 60/149 (40%), Gaps = 16/149 (10%) Frame = -1 Query: 468 PAMPATPGSRTTRSNRLYHAWPTGPWRTS----PNAAKRNKRGRSRLPSGVPVSICASVS 301 P P PG+ S + P P R P+A R G+P A + Sbjct: 1093 PGPPPPPGTSAPNSITISPPPPLSPPRAPRSPPPDAPAMPPPAPDR--PGLPPRPGAPAA 1150 Query: 300 PRPTNTPAVMALVLMGATSRALR*DVQERRSRAPS---------PAPPPPAAAEKDSS-- 154 P TP +V + + + RAPS P+PPPP + + Sbjct: 1151 PATPGTPPSPVVVEEKSPPPRAPSEPERSPPRAPSEPGRPPPTAPSPPPPGQPPRPAPPP 1210 Query: 153 -APSPPPPPPPPPPPRPPPPGGGGGPPAP 70 +P PPPPPPPPPPP PPPP PP+P Sbjct: 1211 PSPPPPPPPPPPPPPLPPPPSPPPPPPSP 1239 Score = 61.2 bits (147), Expect = 4e-08 Identities = 42/128 (32%), Positives = 47/128 (36%), Gaps = 4/128 (3%) Frame = -1 Query: 468 PAMPATPGSRTT----RSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSICASVS 301 PA PATPG+ + P+ P R+ P A R PS P Sbjct: 1148 PAAPATPGTPPSPVVVEEKSPPPRAPSEPERSPPRAPSEPGRPPPTAPSPPP----PGQP 1203 Query: 300 PRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP 121 PRP P +P P PPPP PSPPPPPP P Sbjct: 1204 PRPAPPPP------------------------SPPPPPPPPPPPPPLPPPPSPPPPPPSP 1239 Query: 120 PPPRPPPP 97 PPP PPPP Sbjct: 1240 PPPSPPPP 1247 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Frame = -1 Query: 204 APSPAPP--PPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 70 APSP PP PP A S P PPPPPPP PPPP PPPP PP+P Sbjct: 1194 APSPPPPGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPPPPSP 1244 Score = 58.9 bits (141), Expect = 2e-07 Identities = 49/151 (32%), Positives = 62/151 (41%), Gaps = 5/151 (3%) Frame = -1 Query: 507 KTGAKSSWSAATLPAMPATPGSRTTRSNRLYHAWPTGP-WRTSPNAAKRNKRGRSRLPSG 331 +T S + LP P PG+ P P W ++P+ R Sbjct: 376 ETPPAGSPATPPLPRPPRPPGA------------PASPVWASTPDVPPR----------- 412 Query: 330 VPVSICASVSPRPTNTPA----VMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEK 163 PV+ +P P NTP V A+ A RA +V E ++P+P PPPPA Sbjct: 413 -PVA-----TPPPLNTPPAVPPVPAVPSSPAQPRAPIVEVPEAVLKSPTPPPPPPA---- 462 Query: 162 DSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PPP PP P RPPPPG G PP P Sbjct: 463 -------PPPAPPRSPWRPPPPGTPGVPPPP 486 Score = 53.9 bits (128), Expect = 6e-06 Identities = 45/140 (32%), Positives = 55/140 (39%), Gaps = 1/140 (0%) Frame = -1 Query: 468 PAMPATPGSRTTRSNRLYHAWPTGPWRT-SPNAAKRNKRGRSRLPSGVPVSICASVSPRP 292 PA P PG+R P GP AA+ RG + P + SP Sbjct: 735 PAAPPPPGARP----------PLGPPGVPDAPAAQPPPRGFAAPDGPSPRPVAMITSPSA 784 Query: 291 TNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPP 112 TPAV + R V+ R + A +PP PA P P PPPPPPP Sbjct: 785 PPTPAVPPTPAV--PPRPAPRPVEPRDTAADDRSPPFPAL--------QPEPRPPPPPPP 834 Query: 111 RPPPPGGGGGPPAPRDSGGV 52 PPP G G P A + G+ Sbjct: 835 PPPPHGLDGSPAAANATEGI 854 [177][TOP] >UniRef100_C1EC31 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EC31_9CHLO Length = 939 Score = 64.3 bits (155), Expect = 5e-09 Identities = 26/47 (55%), Positives = 31/47 (65%), Gaps = 3/47 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG---GGGPPAP 70 P P+PPPP++ S+PSPPPPPPPP PP PPPP PP+P Sbjct: 468 PLPSPPPPSSPSPPPSSPSPPPPPPPPSPPSPPPPPSPPPSSPPPSP 514 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/46 (52%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP----PPPPPPPPRPPPPGGGGGPP 76 P P PPP + S+PSPPP PPPPPPPP PP P PP Sbjct: 461 PPPPQPPPLPSPPPPSSPSPPPSSPSPPPPPPPPSPPSPPPPPSPP 506 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/49 (53%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEK-DSSAPSPPPPPP-PPPPPRPPPPGGGGGPPAP 70 S+ P P PPPPAA P+PP PPP PPPPP PPP PP+P Sbjct: 685 SQVPFPPPPPPAAPFPFPPPVPAPPSPPPSPPPPPSPPPSPPPSPPPSP 733 [178][TOP] >UniRef100_B8B832 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B832_ORYSI Length = 1521 Score = 64.3 bits (155), Expect = 5e-09 Identities = 43/119 (36%), Positives = 49/119 (41%), Gaps = 7/119 (5%) Frame = -1 Query: 405 PTGPWRTSPNAAKRNKRGRSRLPSGVPVSICASVSPRP-------TNTPAVMALVLMGAT 247 P P P +A ++ S P P + SV P P +N P L Sbjct: 860 PPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFN 919 Query: 246 SRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 + AP P PPPP S AP PPPPPP PPPP PPPPG GPP P Sbjct: 920 APPPPPPPPTTHFNAPPPPPPPPITR---SGAPPPPPPPPGPPPP-PPPPGARPGPPPP 974 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/63 (49%), Positives = 33/63 (52%), Gaps = 14/63 (22%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP-------PPPPPP------PPRPPPPGGGG-GPPAPRD 64 P P PPPP + S+ P PPP PPPPPP PP PPPPG GG PP P Sbjct: 982 PGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPA 1041 Query: 63 SGG 55 GG Sbjct: 1042 PGG 1044 Score = 61.2 bits (147), Expect = 4e-08 Identities = 31/61 (50%), Positives = 32/61 (52%), Gaps = 9/61 (14%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKD---SSAPSPPPPPPPP-----PPPRPPPPGG-GGGPPAPRDS 61 RS AP P PPPP + P PPPPPPPP PPP PPPPGG PP P Sbjct: 945 RSGAPPPPPPPPGPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPG 1004 Query: 60 G 58 G Sbjct: 1005 G 1005 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 12/62 (19%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPP------PRPPPPGGGGGPPAPRD 64 RA +P PPPP + + P PPP PPPPP P P PPPP GG PP PR Sbjct: 1006 RASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRG 1065 Query: 63 SG 58 G Sbjct: 1066 PG 1067 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 6/54 (11%) Frame = -1 Query: 213 RSRAPS---PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG---GGGPPAP 70 RS P+ P PPPP + S AP PPPPPPPPPPP P P PP P Sbjct: 831 RSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPP 884 Score = 56.6 bits (135), Expect = 1e-06 Identities = 39/121 (32%), Positives = 52/121 (42%), Gaps = 13/121 (10%) Frame = -1 Query: 393 WRTSPNAAKRNKRGRSRL--PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQ 220 W ++ +R ++ + L P P S S P P P +M+ GA +R Sbjct: 751 WDQLQSSRQRRRQHTTTLSPPPPPPASSGLSSIPPPPPPPPLMSF---GAQTRTF----- 802 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPP---------PPPPPPRPP--PPGGGGGPPA 73 P P PPPP + ++ P+PPPPP PPPPPP PP P G PP Sbjct: 803 ---VPPPPPPPPPPRSGVGGNTPPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPP 859 Query: 72 P 70 P Sbjct: 860 P 860 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 13/60 (21%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPS-------PPPPPPP------PPPPRPPPPGGGGGPPAP 70 S AP P PPPP SAPS PPPPPPP PPPP PPP PP P Sbjct: 852 SGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPP 911 Score = 55.1 bits (131), Expect = 3e-06 Identities = 33/81 (40%), Positives = 34/81 (41%), Gaps = 17/81 (20%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP------PPPPPPP--RP-----PPPGGGGG----PPA 73 P P PPPP + P PPPP PPPPPPP RP PPPGG PP Sbjct: 956 PGPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPP 1015 Query: 72 PRDSGGVDEERNSSGVDRRAP 10 P G G RAP Sbjct: 1016 PSTRLGAPPPPPPPGAGGRAP 1036 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSP------PPPPPPPPPPRPPPPGGGGGPPAP 70 R AP P PPP A P+P PPPPPPP PPPP G G PP P Sbjct: 1019 RLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAPPPP 1072 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/53 (49%), Positives = 27/53 (50%), Gaps = 6/53 (11%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPP------PPPPPRPPPPGGGGGPPAPRDSG 58 S APPPP +AP PPPPPP PPPPP PP G PP P G Sbjct: 905 SNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPPPPPPPG 957 [179][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 64.3 bits (155), Expect = 5e-09 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 P P PPPP P PPPPPPPPPPP PPPP PP PR Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 99 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [180][TOP] >UniRef100_B4MWB5 GK14913 n=1 Tax=Drosophila willistoni RepID=B4MWB5_DROWI Length = 1089 Score = 64.3 bits (155), Expect = 5e-09 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 5/48 (10%) Frame = -1 Query: 198 SPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAP 70 +P PPPP + P PPPPPP P PPP PPPPG GGGPP P Sbjct: 521 APPPPPPPMPGRGPGGPPPPPPPPMPGKAGGPPPPPPPPGMGGGPPPP 568 Score = 53.9 bits (128), Expect = 6e-06 Identities = 29/62 (46%), Positives = 30/62 (48%), Gaps = 11/62 (17%) Frame = -1 Query: 204 APSPAPPP----PAAAEKDSSAPSPPPPPPP-------PPPPRPPPPGGGGGPPAPRDSG 58 APSP P P K AP PPPPP P PPPP PP PG GGPP P Sbjct: 500 APSPNKLPKVDIPMPKGKGGGAPPPPPPPMPGRGPGGPPPPPPPPMPGKAGGPPPPPPPP 559 Query: 57 GV 52 G+ Sbjct: 560 GM 561 [181][TOP] >UniRef100_C5PBJ8 WH2 motif family protein n=1 Tax=Coccidioides posadasii C735 delta SOWgp RepID=C5PBJ8_COCP7 Length = 1486 Score = 64.3 bits (155), Expect = 5e-09 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 4/52 (7%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGG----GGPPAPRDSG 58 P P PPP E + AP PPPPPPPPP PPPPGG GPP P G Sbjct: 1392 PPPPPPPMPGMEASTGAPPPPPPPPPPPGDAPPPPGGAPPPPPGPPPPAPPG 1443 Score = 55.1 bits (131), Expect = 3e-06 Identities = 30/65 (46%), Positives = 30/65 (46%), Gaps = 15/65 (23%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPP----------PPPPPPRPPPPGG-----GG 85 ER SPA P A S P PPPPP PPPPPP PPPPG GG Sbjct: 1369 EREIADMSPAAPDDAGFYTPPSIPPPPPPPMPGMEASTGAPPPPPPPPPPPGDAPPPPGG 1428 Query: 84 GPPAP 70 PP P Sbjct: 1429 APPPP 1433 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/47 (51%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRP---PPPGGGGGPPAP 70 P PPPP A + PPPPPPPPP P PPP GG PP P Sbjct: 1388 PPSIPPPPPPPMPGMEASTGAPPPPPPPPPPPGDAPPPPGGAPPPPP 1434 Score = 53.9 bits (128), Expect = 6e-06 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPP--PPPPPPPPPRPPPPGGGGGPPAPRDSG 58 E + AP P PPPP AP PP PPPPP PP P PPG GPP R++G Sbjct: 1403 EASTGAPPPPPPPPPPP---GDAPPPPGGAPPPPPGPPPPAPPGPAPGPPG-REAG 1454 [182][TOP] >UniRef100_C5FD36 Proline-rich protein LAS17 n=1 Tax=Microsporum canis CBS 113480 RepID=C5FD36_NANOT Length = 633 Score = 64.3 bits (155), Expect = 5e-09 Identities = 39/99 (39%), Positives = 44/99 (44%), Gaps = 9/99 (9%) Frame = -1 Query: 339 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 160 P P A SP P P+V A S + + P P PPPP Sbjct: 443 PPPPPQRSPAPPSPPPRQAPSV------SAPSHPAPPPLPTINAPVPPPPPPPPLPPTNT 496 Query: 159 SSAPSPPPPPPPPP-----PPRPPPPGG----GGGPPAP 70 +SAP+ PPPPPPPP PP PPPP GGPPAP Sbjct: 497 ASAPAAPPPPPPPPPMSGGPPAPPPPPPPLPVSGGPPAP 535 Score = 61.6 bits (148), Expect = 3e-08 Identities = 50/156 (32%), Positives = 59/156 (37%), Gaps = 14/156 (8%) Frame = -1 Query: 489 SWSAATLPAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSICA 310 S S + P P TP + H P P P +R+ S P P S+ A Sbjct: 418 SSSVSPPPLPPKTPQNA--------HMLPPPP--PPPPPPQRSPAPPSPPPRQAP-SVSA 466 Query: 309 SVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPP 130 P P P + A V L + AP+ PPPP P+PPPPP Sbjct: 467 PSHPAPPPLPTINAPVPPPPPPPPLP---PTNTASAPAAPPPPPPPPPMSGGPPAPPPPP 523 Query: 129 PP---------PPPPRPPPPGGG-----GGPPAPRD 64 PP PPPP PPPPGG G PP D Sbjct: 524 PPLPVSGGPPAPPPPPPPPPGGSMPSLPGAPPGKDD 559 [183][TOP] >UniRef100_C0NWN6 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NWN6_AJECG Length = 1535 Score = 64.3 bits (155), Expect = 5e-09 Identities = 32/66 (48%), Positives = 36/66 (54%), Gaps = 8/66 (12%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGG--GGPPA 73 D Q+ S P P PPP A+ D+ +PPPPPPP PPPP PPP GG GGPP Sbjct: 1422 DFQDAPSMPPPPPPPPVPASFADAPPTAPPPPPPPAFSAAAPPPPPPPPSVGGAPGGPPP 1481 Query: 72 PRDSGG 55 P G Sbjct: 1482 PPPPAG 1487 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/73 (45%), Positives = 38/73 (52%), Gaps = 10/73 (13%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPP--GG--GGGPPAPRDSGGV 52 P P PPPP A + P+ PPPPPPP PPP PPPP GG GG PP P +G Sbjct: 1430 PPPPPPPPVPASFADAPPTAPPPPPPPAFSAAAPPPPPPPPSVGGAPGGPPPPPPPAGDA 1489 Query: 51 DEERNSSGVDRRA 13 ++G D A Sbjct: 1490 PAIPKAAGPDAGA 1502 [184][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 64.3 bits (155), Expect = 5e-09 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 P P PPPP P PPPPPPPPPPP PPPP PP PR Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 5e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 P P PPPP P PPPPPPPPPPP PPPP PP R Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 [185][TOP] >UniRef100_Q7SAT8 Actin cytoskeleton-regulatory complex protein pan-1 n=1 Tax=Neurospora crassa RepID=PAN1_NEUCR Length = 1533 Score = 64.3 bits (155), Expect = 5e-09 Identities = 36/79 (45%), Positives = 44/79 (55%), Gaps = 6/79 (7%) Frame = -1 Query: 288 NTPAVMALVLMG--ATSRALR*DVQERRSRAP----SPAPPPPAAAEKDSSAPSPPPPPP 127 N+ A +A +L G A R L ++ + P SP+ PPP A + SA SPPPPPP Sbjct: 1374 NSAAALASILFGTMAPPRPLSATGEKPTASTPPVVSSPSSPPPPPAPVEPSAGSPPPPPP 1433 Query: 126 PPPPPRPPPPGGGGGPPAP 70 PPP P PP P GG PP P Sbjct: 1434 PPPGP-PPAPSGGAPPPPP 1451 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/62 (50%), Positives = 34/62 (54%), Gaps = 9/62 (14%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGGGGP--PAPRDSGGV 52 AP P PPPP E + A PPPPPP P PPP PPPPGG P PA R +G + Sbjct: 1446 APPPPPPPPPMPESGAPAAPPPPPPPGPPPAPGAVPPPPPPPPGGAPAPSLPAGRPAGLL 1505 Query: 51 DE 46 E Sbjct: 1506 GE 1507 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/63 (46%), Positives = 32/63 (50%), Gaps = 14/63 (22%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP----------PPPPRPPPP----GGGGGPPAPR 67 +PS PPPPA E + +P PPPPPPP PPPP PPPP G PP P Sbjct: 1410 SPSSPPPPPAPVEPSAGSPPPPPPPPPGPPPAPSGGAPPPPPPPPPMPESGAPAAPPPPP 1469 Query: 66 DSG 58 G Sbjct: 1470 PPG 1472 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/56 (48%), Positives = 30/56 (53%), Gaps = 6/56 (10%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP------PPRPPPPGGGGGPPAP 70 E + +P P PPPP S +PPPPPPPPP P PPPP G PPAP Sbjct: 1422 EPSAGSPPPPPPPPPGPPPAPSGGAPPPPPPPPPMPESGAPAAPPPPPPPGPPPAP 1477 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/60 (45%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP-----------PPPPPRPPPPGGGGGPPAPRDSGG 55 P P PP P A + P PPPPPP PPPPP PPP G PP P GG Sbjct: 1431 PPPPPPGPPPAPSGGAPPPPPPPPPMPESGAPAAPPPPPPPGPPPAPGAVPPPPPPPPGG 1490 [186][TOP] >UniRef100_A1DC51 Actin cytoskeleton-regulatory complex protein pan1 n=1 Tax=Neosartorya fischeri NRRL 181 RepID=PAN1_NEOFI Length = 1470 Score = 64.3 bits (155), Expect = 5e-09 Identities = 30/58 (51%), Positives = 33/58 (56%), Gaps = 9/58 (15%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP---------PPPRPPPPGGGGGPPAPRDSGG 55 P P PPPPAA S+ +PPPPP PP PPP PPPP G PPAP +GG Sbjct: 1371 PPPPPPPPAAVPSYDSSVAPPPPPAPPMAPPMAPPAPPPGPPPPPGPPPPPAPPAAGG 1428 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 27/47 (57%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S AP P P PP A AP P PPPPP PPP PP P GGPP P Sbjct: 1387 SVAPPPPPAPPMAPPMAPPAPPPGPPPPPGPPP-PPAPPAAGGPPTP 1432 [187][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 64.3 bits (155), Expect = 5e-09 Identities = 29/54 (53%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = -1 Query: 219 ERRSRAPSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAPRDS 61 + + + PSP PPPP + S PSPPPP PPPPPPP PPPP PP P S Sbjct: 144 QSQCKLPSPPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPP----SPPPPSPS 193 Score = 58.9 bits (141), Expect = 2e-07 Identities = 39/112 (34%), Positives = 45/112 (40%), Gaps = 2/112 (1%) Frame = -1 Query: 399 GPW--RTSPNAAKRNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*D 226 G W TS A +N + + +LPS P SP P + P+ Sbjct: 128 GGWCGTTSDYCASKNCQSQCKLPSPPPPP--PPPSPPPPSPPS----------------- 168 Query: 225 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP PSPPPP PPPP P PPPP PP P Sbjct: 169 -----PPPPSPPPPPP---------PSPPPPSPPPPSPSPPPPPASPPPPPP 206 [188][TOP] >UniRef100_B9SS50 Peroxisomal membrane protein 2, pxmp2, putative n=1 Tax=Ricinus communis RepID=B9SS50_RICCO Length = 176 Score = 63.9 bits (154), Expect = 6e-09 Identities = 36/96 (37%), Positives = 53/96 (55%), Gaps = 1/96 (1%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 +W YL L P++TKAITAGVL G DT+AQ ++G + L L RL +G G Sbjct: 8 AWRKYLIQLQAHPLRTKAITAGVLAGCSDTIAQKISG--VKRLQLRRLLLITLYGFAYGG 65 Query: 398 PVGHAWYNLLERVVR-LPGVAGIAGKVAADQLLFAP 502 P GH + L++ + + +A KV +QL+ +P Sbjct: 66 PFGHFLHKLMDGIFKGKKDSKTVAKKVLLEQLVSSP 101 [189][TOP] >UniRef100_B9RW43 Peroxisomal membrane protein, putative n=1 Tax=Ricinus communis RepID=B9RW43_RICCO Length = 344 Score = 63.9 bits (154), Expect = 6e-09 Identities = 32/100 (32%), Positives = 51/100 (51%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 +W +Y +AL P+ TK +G++ +GD +AQ G P+ D R+FR G L G Sbjct: 146 NWIAYEQALKSNPVLTKMAISGIVYSIGDWIAQCYEGKPIFEFDRTRMFRSGLVGFTLHG 205 Query: 398 PVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 + H +Y E + + KVA DQ ++A ++ SI Sbjct: 206 SLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAAIWNSI 245 [190][TOP] >UniRef100_B9HZY8 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9HZY8_POPTR Length = 240 Score = 63.9 bits (154), Expect = 6e-09 Identities = 33/100 (33%), Positives = 51/100 (51%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 +W++Y +AL P+ K + +GV+ +GD +AQ G P+ D R+FR G L G Sbjct: 50 NWSAYEEALKTNPVLAKMMISGVVYSVGDWIAQCYEGKPIFEFDRTRMFRSGVVGFTLHG 109 Query: 398 PVGHAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 + H +Y E + + KVA DQ L+A + SI Sbjct: 110 SLSHYYYQFCEELFPFQDWWVVPVKVAFDQTLWAAAWNSI 149 [191][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 63.9 bits (154), Expect = 6e-09 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP + S P PPPP PPPPPP PPPP PP P Sbjct: 150 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 193 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPP S P PPPPPPPPPPP PPPP PP P Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/49 (55%), Positives = 28/49 (57%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 64 S P P+PPPP P PPPPPPPPPPP PPPP PP P D Sbjct: 159 SPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP---PPPPPPVD 204 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP + S P PPPP PPPPP PPPP PP P Sbjct: 136 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPP 179 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP + PPPPPPPPPPP PPPP PP P Sbjct: 156 PPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 199 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/47 (55%), Positives = 29/47 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP + P PPPPPPPPPPP PPPP PP R++ Sbjct: 164 PSPPPPPPPSPPPP---PPPPPPPPPPPPPPPPPPPPPPPPPVDRNA 207 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PPPP+ +P PPP PPPPPPP PPPP PP P Sbjct: 131 PPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPP 172 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/47 (51%), Positives = 25/47 (53%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P+PPPP PPPPPP PPPP PPPP PP P Sbjct: 145 SPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 191 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP-PPPPPRPPPPGGGGGPPAP 70 P P+PPPP PPPPPP PPPPP PPPP PP P Sbjct: 134 PPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPP 178 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPP S P PP PPPPPPP PPPP PP P Sbjct: 144 PSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPP 187 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PP P +P PPPPP PPPPP PPPP PP P Sbjct: 123 PPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPP 164 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -1 Query: 189 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PPPP E P PPP PPPPPPP PPPP PP P Sbjct: 122 PPPPPEPE---CPPPPPPSPPPPPPPSPPPPPSPPPPPPP 158 [192][TOP] >UniRef100_UPI000151B778 hypothetical protein PGUG_03728 n=1 Tax=Pichia guilliermondii ATCC 6260 RepID=UPI000151B778 Length = 270 Score = 63.9 bits (154), Expect = 6e-09 Identities = 50/145 (34%), Positives = 60/145 (41%), Gaps = 5/145 (3%) Frame = -1 Query: 489 SWSAATLPAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSICA 310 S S+ +L P P SR +S+ L ++ G + N R PS VP S Sbjct: 61 SSSSNSLKPPPKMPPSRPKKSSHLKNS-SIGSMSSFEN----------RAPSPVPTSPAP 109 Query: 309 SVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPS-----PAPPPPAAAEKDSSAPS 145 V P P VL G + + S APS APPP A AP+ Sbjct: 110 PVPSAPPPLPGAPPPVLGGGS----------KSSAAPSVPSFPSAPPPAPKATPALKAPA 159 Query: 144 PPPPPPPPPPPRPPPPGGGGGPPAP 70 P PP PPPPP PP PG PPAP Sbjct: 160 PAAPPAPPPPPAPPAPGMSLAPPAP 184 [193][TOP] >UniRef100_UPI0000E47171 PREDICTED: similar to conserved hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E47171 Length = 2383 Score = 63.9 bits (154), Expect = 6e-09 Identities = 28/51 (54%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGGGGGPPAPRDSG 58 P P PPPP P PPPPPP P PPP PPPPG GG PP P G Sbjct: 521 PPPPPPPPPPPGMGGGPPPPPPPPPGPGGIPPPPPPPPGPGGPPPPPGPPG 571 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/53 (52%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPP---PPRPPPPGGGGGPPAPRDSGGV 52 P P PPPP P PPPPPPP P PP PPPP G GGPP P G+ Sbjct: 520 PPPPPPPPPPPPGMGGGPPPPPPPPPGPGGIPPPPPPPPGPGGPPPPPGPPGM 572 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/49 (57%), Positives = 28/49 (57%), Gaps = 5/49 (10%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPGGGGGPPAP 70 PSP PPP P PPPPPPP PPPP PPPPG GG PP P Sbjct: 515 PSPIVPPP---------PPPPPPPPPGMGGGPPPPPPPPPGPGGIPPPP 554 [194][TOP] >UniRef100_UPI00016E8720 UPI00016E8720 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E8720 Length = 882 Score = 63.9 bits (154), Expect = 6e-09 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 8/53 (15%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP--------PPPPRPPPPGGGGGPPAP 70 AP+P PPPP S P PPPPPPP PPPP PPPP GGGPP P Sbjct: 339 APAPPPPPPPPP-LPSGLPGPPPPPPPPLPGNMGAPPPPPPPPPLPGGGPPPP 390 Score = 62.8 bits (151), Expect = 1e-08 Identities = 32/69 (46%), Positives = 33/69 (47%), Gaps = 17/69 (24%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPG------------GGGG 82 S P P PPPP + AP PPPPPPP PPPP PPPPG G G Sbjct: 353 SGLPGPPPPPPPPLPGNMGAPPPPPPPPPLPGGGPPPPPPPPPGLPGAVPPPPPPPPGCG 412 Query: 81 PPAPRDSGG 55 PP P GG Sbjct: 413 PPPPPPMGG 421 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/60 (48%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAPRDSGGVDEER 40 AP P PPPP P PPPPPPP PPP PPPPG G PP P G +E+ Sbjct: 372 APPPPPPPPPLP---GGGPPPPPPPPPGLPGAVPPPPPPPPGCGPPPPPPMGGFGQMQEK 428 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/55 (50%), Positives = 29/55 (52%), Gaps = 7/55 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-------PPPPPPPRPPPPGGGGGPPAPRDSG 58 P P PPPP + P PPPP PPPPPPP PP PGGG PP P G Sbjct: 343 PPPPPPPPLPSGLPGPPPPPPPPLPGNMGAPPPPPPP-PPLPGGGPPPPPPPPPG 396 [195][TOP] >UniRef100_UPI00016E871F UPI00016E871F related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E871F Length = 877 Score = 63.9 bits (154), Expect = 6e-09 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 8/53 (15%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPP--------PPPPRPPPPGGGGGPPAP 70 AP+P PPPP S P PPPPPPP PPPP PPPP GGGPP P Sbjct: 343 APAPPPPPPPPP-LPSGLPGPPPPPPPPLPGNMGAPPPPPPPPPLPGGGPPPP 394 Score = 62.8 bits (151), Expect = 1e-08 Identities = 32/69 (46%), Positives = 33/69 (47%), Gaps = 17/69 (24%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP-----PPPPRPPPPG------------GGGG 82 S P P PPPP + AP PPPPPPP PPPP PPPPG G G Sbjct: 357 SGLPGPPPPPPPPLPGNMGAPPPPPPPPPLPGGGPPPPPPPPPGLPGAVPPPPPPPPGCG 416 Query: 81 PPAPRDSGG 55 PP P GG Sbjct: 417 PPPPPPMGG 425 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/60 (48%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGGGPPAPRDSGGVDEER 40 AP P PPPP P PPPPPPP PPP PPPPG G PP P G +E+ Sbjct: 376 APPPPPPPPPLP---GGGPPPPPPPPPGLPGAVPPPPPPPPGCGPPPPPPMGGFGQMQEK 432 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/55 (50%), Positives = 29/55 (52%), Gaps = 7/55 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-------PPPPPPPRPPPPGGGGGPPAPRDSG 58 P P PPPP + P PPPP PPPPPPP PP PGGG PP P G Sbjct: 347 PPPPPPPPLPSGLPGPPPPPPPPLPGNMGAPPPPPPP-PPLPGGGPPPPPPPPPG 400 [196][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 63.9 bits (154), Expect = 6e-09 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP+ PSPPPPPPPPPPP PPPP PP P Sbjct: 95 PPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPP----SPPPP 134 Score = 60.8 bits (146), Expect = 5e-08 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 ++ P P PPPP PSPPPP PPPPPP PPPP PP P Sbjct: 87 NKVPPPPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPP----SPPPP 129 Score = 57.4 bits (137), Expect = 6e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PPPP S P P PPPP PPPP PPPP PP+P Sbjct: 90 PPPPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPPSP 131 Score = 57.4 bits (137), Expect = 6e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 P P PPPP + S P P PPPPPPPPP P PP PP Sbjct: 93 PPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPPSPPPP 134 [197][TOP] >UniRef100_B4YB55 BimA n=1 Tax=Burkholderia pseudomallei RepID=B4YB55_BURPS Length = 369 Score = 63.9 bits (154), Expect = 6e-09 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P+ PPPP ++ P PPPPPPPPPPP PPPP PP P Sbjct: 80 PNKVPPPPPPPPSTTTPPPPPPPPPPPPPPPPPPPSTTPSPPPP 123 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/43 (51%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPP-----PRPPPP 97 ++ P P PPPP+ P PPPPPPPPPP P PPPP Sbjct: 81 NKVPPPPPPPPSTTTPPPPPPPPPPPPPPPPPPPSTTPSPPPP 123 [198][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 63.9 bits (154), Expect = 6e-09 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP+ P PPPPPPPPPPP PPPP PP P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 63.5 bits (153), Expect = 8e-09 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP + P PPPPPPPPPPP PPPP PP P Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 63.5 bits (153), Expect = 8e-09 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP S P PPPPPPPPPPP PPPP PP P Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 63.5 bits (153), Expect = 8e-09 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP+P Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP PSPPPPPP PPPP PPPP PP P Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPP 253 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP+P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 P P PPPP PSPPPPPPPPPPP PPPP PP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP S P PPPPPPPPPPP PPPP PP P Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP-----PPPP 701 Score = 61.2 bits (147), Expect = 4e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PP P P PPPPPPPPPPP PPPP PP P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 60.5 bits (145), Expect = 7e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PP P P PPPPPPPPPPP PPPP PP P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P PPP P PPPPPPPPPPP PPPP PP P Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP +P PPPPPPPPPPP PPPP PP P Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP-----PPPP 700 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPP PP P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PP P PP P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP P PP PP P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PP P PP P Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPP PPPP PP P Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/50 (52%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP------PPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP +P PPPP PPPPPPP PPPP PP P Sbjct: 212 PSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/47 (53%), Positives = 25/47 (53%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPP PP PPPP PP P Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPP PPPP PPPP PP P Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPP PPPPP PPPP PP P Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPP----PPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPP PPPPPP PPPP PP P Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP----PPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPP PPPPPPP PPPP PP P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 [199][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 63.9 bits (154), Expect = 6e-09 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 R P P+PPPP+ +P PPP PPPPPPPRPPPP PP P Sbjct: 319 RPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPP----SPPPP 360 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPPPPP PPPP PP P Sbjct: 236 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 280 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/50 (56%), Positives = 30/50 (60%), Gaps = 4/50 (8%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAP 70 R P P+PPPP+ PSPPPPPP PPPPPRPPPP PP P Sbjct: 351 RPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP----SPPPP 396 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPPPPPRPPPP PP P Sbjct: 288 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPP----SPPPP 328 Score = 61.2 bits (147), Expect = 4e-08 Identities = 27/51 (52%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP+ PSPPPPPP PPPPP PPPP PP P S Sbjct: 241 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPS 291 Score = 61.2 bits (147), Expect = 4e-08 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 PSP PP P S P PPP PPPPPPPRPPPP PP Sbjct: 253 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPP 294 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPP P PPPP PP P Sbjct: 231 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 274 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPPPPP PPPP PPPP PP P Sbjct: 293 PPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 60.8 bits (146), Expect = 5e-08 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 R P P+PPPP+ S P PPP PPPPPPPRPPPP PP P Sbjct: 387 RPPPPSPPPPSPPPP-SPPPPPPPSPPPPPPPRPPPP----SPPPP 427 Score = 60.5 bits (145), Expect = 7e-08 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAPR 67 PSP PPPP PSPPPP PPPPPPP PPPP PP PR Sbjct: 310 PSPPPPPPPRPPP----PSPPPPSPPPPPPPSPPPPPSPPPPPPPR 351 Score = 60.1 bits (144), Expect = 9e-08 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAP-SPPPPPPPPPPPRPPPPGGGGGPPAPR 67 PSP PPPP S P SPPPP PPPP P PPPP PP PR Sbjct: 342 PSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPR 387 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP+ PSPPPP PP PPPP PPPP PP P S Sbjct: 226 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 275 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP+ PSPPPP PPPPPP PPP PP P Sbjct: 348 PPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 391 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 PSP PPPP PSPPPP PPPP P PPPP PP PR Sbjct: 378 PSPPPPPPPRPPP----PSPPPPSPPPPSPPPPPPPSPPPPPPPR 418 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/47 (51%), Positives = 26/47 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP+ PSPPPP PPPP P PP P PP P S Sbjct: 221 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 267 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAP 70 S P P+PPPP +P PP PPPP PPPP PPPP PP P Sbjct: 337 SPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 384 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP + S P PPPP PPPP PP P PP PP+P Sbjct: 328 PSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSP 372 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 191 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 235 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 196 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 240 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 201 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 245 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 206 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 250 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 211 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 255 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 216 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 260 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP S P PPP PPPPPPP PPPP PP P Sbjct: 266 PSPPPPPPP-----SPPPPPPPRPPPPPPPSPPPP----SPPPP 300 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 S+A P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 183 SQANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 230 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/42 (52%), Positives = 25/42 (59%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 261 PPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSP 302 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP + S P PPPP PPPP PPPP PP+P Sbjct: 282 PRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSP 325 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ +P PPPPP PPPP PPP PP P Sbjct: 363 PPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP 406 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ +P PPPPP PPPP PPP PP P Sbjct: 394 PPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP 437 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP P PPPPPPP PP P PP PP+P Sbjct: 264 PPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSP 307 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP PPPPPP PPPP PPPP PP P Sbjct: 326 PPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPP----SPPPP 365 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP P PPPPPPP PP PPPP PP P Sbjct: 256 PPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPP----SPPPP 295 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP +P PP PPPP PPP PPP PP P Sbjct: 376 PPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRP 419 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PP P S P PPP PPPP PP P PP PP+P Sbjct: 396 PSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSP 439 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/46 (52%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP--PPPPRPPPPGGGGGPPAP 70 PSP PPPP + PPP PPP PPPP PPPP PP P Sbjct: 370 PSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPP 415 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 P PPPP +P PP PPPP PPP PPP PP PR Sbjct: 277 PPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPR 319 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/44 (50%), Positives = 23/44 (52%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP +P PP PPPP PPP PPP PP P Sbjct: 280 PPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPP 323 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/48 (47%), Positives = 25/48 (52%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 R P P PPP + S P PPPP PPPPP P PP PP+P Sbjct: 283 RPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSP 330 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PP P S P PPP PPPP PP P PP PP P Sbjct: 365 PSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPP 408 [200][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 63.9 bits (154), Expect = 6e-09 Identities = 28/63 (44%), Positives = 32/63 (50%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGVD 22 P P PPPP P PPPPPPPPPPP PPPP PP R+ V ++ + Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPSSATATALG 123 Query: 21 RRA 13 RA Sbjct: 124 ARA 126 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 P P PPPP P PPPPPPPPPPP PPPP PP P+ Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 107 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 60.5 bits (145), Expect = 7e-08 Identities = 27/62 (43%), Positives = 30/62 (48%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGVD 22 P P PPPP P PPPPPPPPPPP PPPP P P + ++ VD Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPSSATATALGARANVVD 130 Query: 21 RR 16 R Sbjct: 131 ER 132 [201][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 63.9 bits (154), Expect = 6e-09 Identities = 26/46 (56%), Positives = 26/46 (56%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 R P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 63.9 bits (154), Expect = 6e-09 Identities = 26/46 (56%), Positives = 27/46 (58%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRD 64 P P PPPP P PPPPPPPPPPP PPPP PP PR+ Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRN 104 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 R P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 99 [202][TOP] >UniRef100_A7S4U2 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S4U2_NEMVE Length = 448 Score = 63.9 bits (154), Expect = 6e-09 Identities = 30/50 (60%), Positives = 32/50 (64%), Gaps = 6/50 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP------PPPPRPPPPGGGGGPPAP 70 PS AP P +D SAP+PPPPPPP PPPP PPPPG GG PP P Sbjct: 257 PSIAPSVP----QDGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 302 [203][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 63.9 bits (154), Expect = 6e-09 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 Q+++ + P P PPPP A S P PPPPPPPPPPP PPPP PAP Sbjct: 35 QKQQQQQPPPPPPPPPA----SPPPPPPPPPPPPPPPPPPPPPEPEPQPAP 81 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/51 (47%), Positives = 29/51 (56%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 ++++ + P PPPP A P PPPPPPPPPPP PP P PP P Sbjct: 34 EQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 [204][TOP] >UniRef100_Q6CDQ5 YALI0B22110p n=1 Tax=Yarrowia lipolytica RepID=Q6CDQ5_YARLI Length = 629 Score = 63.9 bits (154), Expect = 6e-09 Identities = 40/132 (30%), Positives = 49/132 (37%) Frame = -1 Query: 465 AMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSICASVSPRPTN 286 A+PA P S R P P A ++ S +P A + P Sbjct: 374 AVPAPPPSLPARGGTPAAGGPPPPPPPRDGATPLSRPPPPPSRSAIPPPAAAPTAYTPPP 433 Query: 285 TPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRP 106 PA + + S P P PPPPA++ P PPPPPPPPP P Sbjct: 434 PPAAAS-------------PAAAQSSYTPPPPPPPPASSRPVPGVPGGVPPPPPPPPPGP 480 Query: 105 PPPGGGGGPPAP 70 P GG PP P Sbjct: 481 GPAAAGGPPPPP 492 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/52 (57%), Positives = 30/52 (57%), Gaps = 8/52 (15%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGGGG---GPPAP 70 P P PPPP AA SA PPPP PPP PPP PPPPG G GPP P Sbjct: 489 PPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPPPPPGDFGVTPGPPPP 540 Score = 61.2 bits (147), Expect = 4e-08 Identities = 61/173 (35%), Positives = 71/173 (41%), Gaps = 32/173 (18%) Frame = -1 Query: 492 SSWSAATLPAMP--ATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPV- 322 S +AA PA+P + P S +R + A P P R+ P + R P +P Sbjct: 329 SPTAAAAPPALPGRSLPPSLPSRGSP---APPALPGRSVPPPPELPGRAVPAPPPSLPAR 385 Query: 321 -SICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPA--------PPPPAAA 169 A+ P P P GAT + R RS P PA PPPPAAA Sbjct: 386 GGTPAAGGPPPPPPPRD------GATPLS-RPPPPPSRSAIPPPAAAPTAYTPPPPPAAA 438 Query: 168 E---KDSSAPSPPPPPPP-------------PPPPRPPPPGGG----GGPPAP 70 SS PPPPPPP PPPP PPPPG G GGPP P Sbjct: 439 SPAAAQSSYTPPPPPPPPASSRPVPGVPGGVPPPPPPPPPGPGPAAAGGPPPP 491 Score = 60.1 bits (144), Expect = 9e-08 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 10/54 (18%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP----------PPPPRPPPPGGGGGPPAP 70 P P PPPP + P PPPPPPP PPPP PPP GGPP P Sbjct: 471 PPPPPPPPGPGPAAAGGPPPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPP 524 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 9/57 (15%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPP---------PPPPPPRPPPPGGGGGPPAPRDSG 58 P P PP P A P PPPPP PPPPP PPP GG PP P G Sbjct: 473 PPPPPPGPGPAAAGGPPPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPPPPPG 529 [205][TOP] >UniRef100_Q4P876 Putative uncharacterized protein n=1 Tax=Ustilago maydis RepID=Q4P876_USTMA Length = 460 Score = 63.9 bits (154), Expect = 6e-09 Identities = 51/161 (31%), Positives = 62/161 (38%), Gaps = 12/161 (7%) Frame = -1 Query: 501 GAKSSWSAATLPAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRL------ 340 GA + + A P P T + A P P S +AA + S Sbjct: 219 GASARPTPAAAPKAKKVPPPAPTSKRK---APPPPPAPRSRHAATASTASASSSAPAPAP 275 Query: 339 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKD 160 P P S A+ +P P P + A + A R + S PPPP Sbjct: 276 PPPPPRSGTAAATPPPPPPPPLRAPAVSSAPPPP---PPPMRPAAGSSAPPPPPMRPAAG 332 Query: 159 SSAPSPPPPPPP------PPPPRPPPPGGGGGPPAPRDSGG 55 SSAP PPPPPPP PPPP PPP G P P+D G Sbjct: 333 SSAPPPPPPPPPMSGSSAPPPPPPPPTSGSAPLPPPQDGRG 373 [206][TOP] >UniRef100_Q0CGJ5 Putative uncharacterized protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CGJ5_ASPTN Length = 600 Score = 63.9 bits (154), Expect = 6e-09 Identities = 32/66 (48%), Positives = 36/66 (54%), Gaps = 11/66 (16%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPP----PPPP-------PRPPPPGGGGGPPAPRD 64 S P+ PPPP A AP PPPPPP PPPP P PPPP GG PP P+ Sbjct: 455 STGPTAPPPPPPAP--GGGAPPPPPPPPGAGAPPPPPPPGAGAPPPPPPPGGAAPPLPKP 512 Query: 63 SGGVDE 46 +GG D+ Sbjct: 513 AGGRDD 518 Score = 60.5 bits (145), Expect = 7e-08 Identities = 48/147 (32%), Positives = 54/147 (36%), Gaps = 11/147 (7%) Frame = -1 Query: 477 ATLPAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVPVSICASVSP 298 A + A+P G R H W T T RG R P + A +P Sbjct: 356 APIQALPRLHGRRR-------HLWMTAHPATE---FLHLSRGSERCPLHRRHRVVARAAP 405 Query: 297 RPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPP----PP 130 P P ATS ++ P P PPPP A P PPP PP Sbjct: 406 PPPPPPP--------ATST---------KTGPPPPGPPPPPAPASSVPPPPPPPSSHIPP 448 Query: 129 PPPPP-------PRPPPPGGGGGPPAP 70 PPPPP P PPPP GGG P P Sbjct: 449 PPPPPSSTGPTAPPPPPPAPGGGAPPP 475 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/60 (46%), Positives = 30/60 (50%), Gaps = 9/60 (15%) Frame = -1 Query: 210 SRAPSPAPPP-----PAAAEKDSSAPSPPPPPPPPP----PPRPPPPGGGGGPPAPRDSG 58 S P P PPP P S+ P+ PPPPPP P PP PPPP G G PP P G Sbjct: 433 SSVPPPPPPPSSHIPPPPPPPSSTGPTAPPPPPPAPGGGAPPPPPPPPGAGAPPPPPPPG 492 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/51 (50%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPP---PPRPPPPGGGGGPPAPRDS 61 AP P PPPPA + K P PPPPP P PP PPPP PP P S Sbjct: 404 APPPPPPPPATSTKTGPPPPGPPPPPAPASSVPPPPPPPSSHIPPPPPPPS 454 [207][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 63.9 bits (154), Expect = 6e-09 Identities = 39/106 (36%), Positives = 49/106 (46%), Gaps = 14/106 (13%) Frame = -1 Query: 330 VPVSICASVSPRPTNTPAVMA--------LVLMGATSRALR*DVQERRSRAPSPAPPPPA 175 V +IC++V P+ P + L G TS ++ SP PPPP+ Sbjct: 88 VSTTICSTVETPPSANPTIPIDLPTAPTDLGANGITSTQTVIVTRQPPHTPSSPPPPPPS 147 Query: 174 AAEKDSSAPSPPPPPP-----PPPPPRPPPPGGGGGPPA-PRDSGG 55 +A P PPPPPP PPPPP PPPP PP+ P D GG Sbjct: 148 SAPLPQPPPPPPPPPPASAPPPPPPPPPPPPISPSLPPSNPPDRGG 193 [208][TOP] >UniRef100_B8M4W4 Actin associated protein Wsp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M4W4_TALSN Length = 648 Score = 63.9 bits (154), Expect = 6e-09 Identities = 35/85 (41%), Positives = 38/85 (44%), Gaps = 4/85 (4%) Frame = -1 Query: 300 PRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP- 124 P P+NT V +S A S P P PPPP P PPPPPPP Sbjct: 457 PSPSNTRPVPPPPPPAPSSGAPPPPPPPPPSGIPQPPPPPPPPPPSGIPQPPPPPPPPPS 516 Query: 123 ---PPPPRPPPPGGGGGPPAPRDSG 58 PPPP PPP G G PP P +G Sbjct: 517 FGAPPPPPPPPATGSGAPPPPPPTG 541 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/61 (47%), Positives = 31/61 (50%), Gaps = 11/61 (18%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP----PPPPPPPPR-------PPPPGGGGGPPAPRDSGG 55 P P PPPP+ + P PPP PPPPPPPP PPPP G G PP P G Sbjct: 494 PPPPPPPPSGIPQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGAPPPPPPGGA 553 Query: 54 V 52 V Sbjct: 554 V 554 Score = 58.5 bits (140), Expect = 3e-07 Identities = 45/144 (31%), Positives = 54/144 (37%), Gaps = 6/144 (4%) Frame = -1 Query: 468 PAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVP-VSICASVSPRP 292 PA PA P S HA P P R +LP +P AS+ P P Sbjct: 403 PAPPAPP------SRSPVHAPPPPP----------PPRETPQLPPKIPHTGAAASIPPPP 446 Query: 291 TNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPP----- 127 + + +R + S P PPPP + P PPPPPP Sbjct: 447 PARAPIPPPQPSPSNTRPVPPPPPPAPSSGAPPPPPPPPPSGIPQPPPPPPPPPPSGIPQ 506 Query: 126 PPPPPRPPPPGGGGGPPAPRDSGG 55 PPPPP PPP G PP P + G Sbjct: 507 PPPPPPPPPSFGAPPPPPPPPATG 530 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/63 (46%), Positives = 30/63 (47%), Gaps = 11/63 (17%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPP------PPPPPP-----PRPPPPGGGGGPPAPRD 64 S P P PPPP + P PPPP PPPPPP P PPPPGG PP Sbjct: 502 SGIPQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGAPPPPPPGGAVPPPLLSV 561 Query: 63 SGG 55 GG Sbjct: 562 GGG 564 [209][TOP] >UniRef100_B8M4W3 Actin associated protein Wsp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M4W3_TALSN Length = 822 Score = 63.9 bits (154), Expect = 6e-09 Identities = 35/85 (41%), Positives = 38/85 (44%), Gaps = 4/85 (4%) Frame = -1 Query: 300 PRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP- 124 P P+NT V +S A S P P PPPP P PPPPPPP Sbjct: 457 PSPSNTRPVPPPPPPAPSSGAPPPPPPPPPSGIPQPPPPPPPPPPSGIPQPPPPPPPPPS 516 Query: 123 ---PPPPRPPPPGGGGGPPAPRDSG 58 PPPP PPP G G PP P +G Sbjct: 517 FGAPPPPPPPPATGSGAPPPPPPTG 541 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/61 (47%), Positives = 31/61 (50%), Gaps = 11/61 (18%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP----PPPPPPPPR-------PPPPGGGGGPPAPRDSGG 55 P P PPPP+ + P PPP PPPPPPPP PPPP G G PP P G Sbjct: 494 PPPPPPPPSGIPQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGAPPPPPPGGA 553 Query: 54 V 52 V Sbjct: 554 V 554 Score = 58.5 bits (140), Expect = 3e-07 Identities = 45/144 (31%), Positives = 54/144 (37%), Gaps = 6/144 (4%) Frame = -1 Query: 468 PAMPATPGSRTTRSNRLYHAWPTGPWRTSPNAAKRNKRGRSRLPSGVP-VSICASVSPRP 292 PA PA P S HA P P R +LP +P AS+ P P Sbjct: 403 PAPPAPP------SRSPVHAPPPPP----------PPRETPQLPPKIPHTGAAASIPPPP 446 Query: 291 TNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPP----- 127 + + +R + S P PPPP + P PPPPPP Sbjct: 447 PARAPIPPPQPSPSNTRPVPPPPPPAPSSGAPPPPPPPPPSGIPQPPPPPPPPPPSGIPQ 506 Query: 126 PPPPPRPPPPGGGGGPPAPRDSGG 55 PPPPP PPP G PP P + G Sbjct: 507 PPPPPPPPPSFGAPPPPPPPPATG 530 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/63 (46%), Positives = 30/63 (47%), Gaps = 11/63 (17%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPP------PPPPPP-----PRPPPPGGGGGPPAPRD 64 S P P PPPP + P PPPP PPPPPP P PPPPGG PP Sbjct: 502 SGIPQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGAPPPPPPGGAVPPPLLSV 561 Query: 63 SGG 55 GG Sbjct: 562 GGG 564 [210][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 63.9 bits (154), Expect = 6e-09 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 Q+++ + P P PPPP A S P PPPPPPPPPPP PPPP PAP Sbjct: 35 QKQQQQQPPPPPPPPPA----SPPPPPPPPPPPPPPPPPPPPPEPEPQPAP 81 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/51 (47%), Positives = 29/51 (56%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 ++++ + P PPPP A P PPPPPPPPPPP PP P PP P Sbjct: 34 EQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 [211][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 63.9 bits (154), Expect = 6e-09 Identities = 28/47 (59%), Positives = 29/47 (61%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 SR PSP PP P +PSPPPPPPPPPPP PPPP PP P Sbjct: 239 SRPPSP-PPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP S P PPPPPPPPPPP PP P PP+P Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/93 (37%), Positives = 42/93 (45%), Gaps = 5/93 (5%) Frame = -1 Query: 339 PSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAP-----PPPA 175 P+G+ + P P N+P + A+SR R P P+P PPP Sbjct: 209 PTGLSGPNVNPIGPAPNNSPLPPS-PQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPP 267 Query: 174 AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 PSPPPPPPPPPPP PPPP PP Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 60.8 bits (146), Expect = 5e-08 Identities = 25/48 (52%), Positives = 28/48 (58%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 R +P P+P PP+ S P PPPPPPPPPPP PP P PP P Sbjct: 240 RPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 60.1 bits (144), Expect = 9e-08 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPP-PPPPPPPPPRPPPPGGGGGPPAPR 67 PSP+PPPP P PP PPPPPPPPP PPPP P PR Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPR 301 Score = 58.9 bits (141), Expect = 2e-07 Identities = 39/113 (34%), Positives = 41/113 (36%), Gaps = 1/113 (0%) Frame = -1 Query: 405 PTGPW-RTSPNAAKRNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR* 229 P GP SP SR PS P SPRP + P Sbjct: 219 PIGPAPNNSPLPPSPQPTASSRPPSPPP-------SPRPPSPPPP--------------- 256 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S +P P PPPP PPPPPPPPPPP PPPP P P Sbjct: 257 ------SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKP 303 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 23/44 (52%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP + P PPPPPPPPP P PP PP P Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVP 311 [212][TOP] >UniRef100_Q2H922 Actin cytoskeleton-regulatory complex protein PAN1 n=1 Tax=Chaetomium globosum RepID=PAN1_CHAGB Length = 1450 Score = 63.9 bits (154), Expect = 6e-09 Identities = 26/49 (53%), Positives = 30/49 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGG 55 P P PP P+A + P+PPPPPP PP PPPP GGPPA +GG Sbjct: 1368 PPPPPPMPSAGGPPGAPPAPPPPPPGMAPPAPPPPPPAGGPPAAAPAGG 1416 Score = 60.5 bits (145), Expect = 7e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 AP P PP P + S P PPPPPPPPPP P G G PPAP Sbjct: 1343 APPPPPPMPGSFPSASPGPGAPPPPPPPPPPMPSAGGPPGAPPAP 1387 Score = 56.6 bits (135), Expect = 1e-06 Identities = 53/170 (31%), Positives = 63/170 (37%), Gaps = 29/170 (17%) Frame = -1 Query: 492 SSWSAATLPAMPATPG------SRTTRSNRLYHAWPTGPW-RTSPNAAKRNKRGRSRLPS 334 S S AT PA P P + S +H P TSP R + S Sbjct: 1215 SDASPATAPAPPVAPPVAPPAPPQPEASTNPFHRIAQAPAPETSPVPVTRRRPDDDGWGS 1274 Query: 333 GVPVSICASVSPRPTN-TPAVMALVLMG--ATSRALR*--DVQERRSRAPSPAPPPPAAA 169 S RP + A +A +L G A R L D SP PPP +A Sbjct: 1275 DKDEEDEESDDDRPGGKSAAALASILFGTMAPPRPLSATGDKSATSPTVSSPVAPPPESA 1334 Query: 168 EKDSSAPSPPPPPPP-----------------PPPPRPPPPGGGGGPPAP 70 +++PS PPPPPP PPPP PP P GG P AP Sbjct: 1335 SPPAASPSAPPPPPPMPGSFPSASPGPGAPPPPPPPPPPMPSAGGPPGAP 1384 [213][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 63.9 bits (154), Expect = 6e-09 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P P PPPP P PPPPPPPPPPP PPPP PP RD+ Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDA 105 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 225 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 V E P PPPP P PPPPPPPPPP PPPP PP P Sbjct: 52 VGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP-----PPPP 98 [214][TOP] >UniRef100_B8A1W0 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B8A1W0_MAIZE Length = 187 Score = 63.5 bits (153), Expect = 8e-09 Identities = 36/93 (38%), Positives = 52/93 (55%), Gaps = 1/93 (1%) Frame = +2 Query: 227 SYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVG 406 +Y+K L P++TKAIT+GVL G D +AQ ++G + L L RL A +G GP G Sbjct: 11 AYMKQLQAHPLRTKAITSGVLAGCSDAVAQKISG--VSKLQLRRLLLIALYGFAYAGPFG 68 Query: 407 HAWYNLLERVVR-LPGVAGIAGKVAADQLLFAP 502 H + L++R + G A KV +QL +P Sbjct: 69 HFLHKLMDRFFKGKKGKETTAKKVLVEQLTASP 101 [215][TOP] >UniRef100_B6SRR1 Peroxisomal membrane protein PMP22 n=1 Tax=Zea mays RepID=B6SRR1_MAIZE Length = 187 Score = 63.5 bits (153), Expect = 8e-09 Identities = 36/93 (38%), Positives = 52/93 (55%), Gaps = 1/93 (1%) Frame = +2 Query: 227 SYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVG 406 +Y+K L P++TKAIT+GVL G D +AQ ++G + L L RL A +G GP G Sbjct: 11 AYMKQLQAHPLRTKAITSGVLAGCSDAVAQKISG--VSKLQLRRLLLIALYGFAYAGPFG 68 Query: 407 HAWYNLLERVVR-LPGVAGIAGKVAADQLLFAP 502 H + L++R + G A KV +QL +P Sbjct: 69 HFLHKLMDRFFKGKKGKETTAKKVLVEQLTASP 101 [216][TOP] >UniRef100_UPI0000E2C133 conserved hypothetical protein n=1 Tax=Aspergillus terreus NIH2624 RepID=UPI0000E2C133 Length = 1608 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = -1 Query: 204 APSPAPPPPA-AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 AP P PPPP AA + SA +PPPPPPPP PP PPP G PP P Sbjct: 1519 APPPPPPPPVPAAAPNGSAGAPPPPPPPPAPPMAPPPPPAGVPPPP 1564 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSA--PSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PP PAAA S+ P PPPPP PP P PPPP G PPAP Sbjct: 1522 PPPPPPVPAAAPNGSAGAPPPPPPPPAPPMAP-PPPPAGVPPPPAP 1566 [217][TOP] >UniRef100_Q2W222 RTX toxins and related Ca2+-binding protein n=1 Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W222_MAGSA Length = 1274 Score = 63.5 bits (153), Expect = 8e-09 Identities = 31/67 (46%), Positives = 33/67 (49%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGVD 22 P P PPPP PSPP P PPPPPP PPPP PPAP V+ + SS V Sbjct: 274 PPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPP-----PPAPPPPAPVNNDPTSSAVT 328 Query: 21 RRAPKAG 1 AG Sbjct: 329 LPGSTAG 335 [218][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 63.5 bits (153), Expect = 8e-09 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP + P PPPPPPPPPPP PPPP PP P Sbjct: 53 PPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 51 PPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 57 PPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 71 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPP 72 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPP 73 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 52 PPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 54 PPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 66 PCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 109 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 P P PPPP P PPPPPPPPPPP PPPP PP PR Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP----PPPPPR 65 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 55 PPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 61.2 bits (147), Expect = 4e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPPRP PP PP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPP 78 Score = 61.2 bits (147), Expect = 4e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 56 PPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 61.2 bits (147), Expect = 4e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 P P PP P P PPPPPPPPPPP PPPP PP PR Sbjct: 59 PPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 61.2 bits (147), Expect = 4e-08 Identities = 27/65 (41%), Positives = 31/65 (47%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGVD 22 P P PPPP P PPPPPPPPPPP PPPP PP R ++ G+ Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLP 127 Query: 21 RRAPK 7 P+ Sbjct: 128 EPCPQ 132 Score = 60.1 bits (144), Expect = 9e-08 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPP P PPPPPPPPPPP PPPP PP P Sbjct: 58 PPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPP PP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PP P PP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPP 75 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPP P PPPP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPP 80 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P P PPPPPPPPP PPPP PP P Sbjct: 47 PPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 64 PRPCPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPPPPRP 104 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRP---PPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP P PPP PP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPP 79 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP---PPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPP PPP PPPP PP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPP---PPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPP PPPPPP PPPP PP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPP 87 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPP PPPPPPP PPPP PP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPP 88 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP---PPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPP PPPPPPPP PPPP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -1 Query: 189 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P A E+ P PPPPPPPPPPP PPPP PP P Sbjct: 13 PYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 [219][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAP---SPPPPPPPPPPPRPPPPGGGGGPPAPR 67 S P P+PPPP + S P SPPPPP PPPPP PPPP PP+PR Sbjct: 536 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPR 586 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/46 (54%), Positives = 27/46 (58%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 R P P+PP P PSPPPPP PPPPP PPPP PP+P Sbjct: 516 RPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 561 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/49 (55%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -1 Query: 213 RSRAPSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 R PSP PPP P PSPPPPP PPPPP PPPP PP+P Sbjct: 519 RPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 567 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAP---SPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P+PPPP + S P SPPPPP PPPPP PPPP PP+P Sbjct: 524 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 573 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAP---SPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P+PPPP + S P SPPPPP PPPPP PPPP PP+P Sbjct: 542 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSP 591 Score = 60.8 bits (146), Expect = 5e-08 Identities = 27/46 (58%), Positives = 28/46 (60%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 R PSP PP P S PSPPPPP PPPPP PPPP PP+P Sbjct: 511 RPPSPRPPRP-------SPPSPPPPPSPPPPPSPPPPPSPPPPPSP 549 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAP 70 S P P+PPPP + S P PP PPP PPPPP PPPP PP+P Sbjct: 530 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 579 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/45 (51%), Positives = 25/45 (55%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 S P P+PPPP + S P PP PPPPP PP PP P PP Sbjct: 548 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPP 592 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/48 (47%), Positives = 26/48 (54%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 S P P+PPPP + S P PP PPPPP P PP P PP P+ Sbjct: 554 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQ 601 [220][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 63.5 bits (153), Expect = 8e-09 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP S P PPPPPPPP PP PPPP PP P Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPP 268 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/44 (61%), Positives = 28/44 (63%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP PSPPPPPPPPPPP PPPP PP+P Sbjct: 215 PSPPPPPPPPPP-----PSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP S P PPPPPPPP PP PPPP PP P Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 +P P PPPP P PPPP PPPPPP PPPP PP P S Sbjct: 216 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPS 263 Score = 61.2 bits (147), Expect = 4e-08 Identities = 27/47 (57%), Positives = 27/47 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP S P PPPPPPP PPP PPPP PP P S Sbjct: 227 PSPPPPPPPPPPP-SPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPS 272 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPP PPPP PPPP PP P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 60.5 bits (145), Expect = 7e-08 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPP PPPPPP PPPP PP P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P PPPP + PSP PPPPPP P PPPP PPAP Sbjct: 240 SPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAP 286 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/47 (51%), Positives = 26/47 (55%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P PPPP + P PP PPPPPPPP PP P PP+P Sbjct: 216 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/52 (48%), Positives = 27/52 (51%) Frame = -1 Query: 225 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 V E + P P PPPP+ P P PPPPPPPPP P PP PP P Sbjct: 200 VVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/47 (51%), Positives = 25/47 (53%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P P PPPP + P PPP PPPPPPP PPP PP P S Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 252 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPP--PRPPPPGGGGGPPAP 70 S P P PPPP + P PP PPPPPPP P PPPP PP P Sbjct: 228 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP PSPPPPPPPP P PPPP PP P Sbjct: 239 PSPPPPPPPPPP-----PSPPPPPPPPSPSPPPPPPSPSPPPPP 277 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP S P PPPPP P PPP PP P PP P Sbjct: 237 PPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPP 280 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/51 (50%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSP-PPPPPPPPP---PRPPPPGGGGGPPAPRDS 61 P P PPPP+ P P PPPPPPPPP P PPPP PP P S Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPS 270 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPP 97 PSP+PPPP + PSPPPPPPPP PP PPP Sbjct: 260 PSPSPPPPPPS------PSPPPPPPPPSPPPAPPP 288 [221][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 63.5 bits (153), Expect = 8e-09 Identities = 27/51 (52%), Positives = 30/51 (58%) Frame = -1 Query: 222 QERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 Q R+S PSP PP P + S P PPPPP PPPPP PP P PP+P Sbjct: 782 QARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSP 832 Score = 61.2 bits (147), Expect = 4e-08 Identities = 24/47 (51%), Positives = 27/47 (57%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P+PPPP P+PP PP PPPPP PPPP PP+P Sbjct: 798 SPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSP 844 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/47 (51%), Positives = 26/47 (55%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S P P PP P + PSPPPPP PPPPP PPP PP+P Sbjct: 804 SPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSP 850 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/52 (51%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPP--PPPPPPRPPPPGGGGGPPAPRDS 61 S P+P+PPPP AP+PPPPP PP PPP PPPP PP+P S Sbjct: 849 SPPPAPSPPPPP---NPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPS 897 Score = 57.0 bits (136), Expect = 8e-07 Identities = 23/47 (48%), Positives = 28/47 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P +PPPP+ + S P+P PPPPP PPP P PP PP+P S Sbjct: 835 PPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPS 881 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/51 (50%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = -1 Query: 204 APSPAPPP---PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 APSP PPP PA +P P PPP PPPPP PPPP P+P S Sbjct: 853 APSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPS 903 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP+ SS P P P PPP PPP P PP PPAP Sbjct: 824 PSP-PPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAP 866 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP+PPP P A P+PPP P PPPPP PPP PP P Sbjct: 842 PSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPP 886 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/53 (47%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAPRDS 61 S P P+PPPP ++ S PP PPP PPPPP PPP PP+P S Sbjct: 825 SPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPS 877 [222][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 63.5 bits (153), Expect = 8e-09 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP PSPPPPPPPPPPP PPPP PP P Sbjct: 257 PSPPPPPP---------PSPPPPPPPPPPPPPPPPPPSPSPPPP 291 Score = 60.1 bits (144), Expect = 9e-08 Identities = 27/50 (54%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAP------SPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP+PPPP + S P SPPPPPPP PPP PPPP PP P Sbjct: 234 PSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPP 283 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/50 (54%), Positives = 29/50 (58%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 S AP P+PPPP+ P PP PPPPPPPP PPPP PP P S Sbjct: 243 SPAP-PSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPP----PPPPPSPS 287 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/51 (50%), Positives = 27/51 (52%), Gaps = 7/51 (13%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-------PPPPPPPRPPPPGGGGGPPAP 70 PSP PP P+ S AP PPP PPPPPPP PPPP PP P Sbjct: 229 PSPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPP 279 [223][TOP] >UniRef100_Q9BL72 Frl (Formin related gene in leukocytes) homolog protein 1, partially confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=Q9BL72_CAEEL Length = 1115 Score = 63.5 bits (153), Expect = 8e-09 Identities = 39/112 (34%), Positives = 48/112 (42%), Gaps = 3/112 (2%) Frame = -1 Query: 405 PTGPWRTSPNAAKRNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*D 226 P P +P K +R S+ P +S+ P P + L+ T+ Sbjct: 508 PPTPPPPAPGPHKEQRRSTSKDPPRPAPPPVSSIPP----PPPIAGLLAANGTN------ 557 Query: 225 VQERRSRAPSPAPPPPAAAEKDSSAPSPPPPPPP---PPPPRPPPPGGGGGP 79 P P PPPP + S AP PPPPPPP PPP PPPPGG GP Sbjct: 558 -------VPIPPPPPPPLPQNLSGAPPPPPPPPPMLGGPPPPPPPPGGLMGP 602 [224][TOP] >UniRef100_Q7JP76 Cytokinesis defect protein 1, isoform a n=2 Tax=Caenorhabditis elegans RepID=Q7JP76_CAEEL Length = 1435 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/49 (57%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAPRDSG 58 P PPPP S P PPPPPP PPPPP PPP G GGPP P G Sbjct: 743 PPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPG 791 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 6/53 (11%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP--PP----PPPRPPPPGGGGGPPAPRDSGG 55 P PPPP + P PPPPP PP PPP PPPPGG PP P GG Sbjct: 727 PPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGG 779 [225][TOP] >UniRef100_Q7JP75 Cytokinesis defect protein 1, isoform b n=1 Tax=Caenorhabditis elegans RepID=Q7JP75_CAEEL Length = 1437 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/49 (57%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP---PPPPPRPPPPGGGGGPPAPRDSG 58 P PPPP S P PPPPPP PPPPP PPP G GGPP P G Sbjct: 743 PPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPG 791 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 6/53 (11%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP--PP----PPPRPPPPGGGGGPPAPRDSGG 55 P PPPP + P PPPPP PP PPP PPPPGG PP P GG Sbjct: 727 PPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGG 779 [226][TOP] >UniRef100_A0BLV2 Chromosome undetermined scaffold_115, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BLV2_PARTE Length = 1084 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPP-----PRPPPPGGGGGPPAP 70 AP P PPPP S +PPPPPPPPPP P PPPP GG PP P Sbjct: 565 APPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPPP 614 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/61 (49%), Positives = 32/61 (52%), Gaps = 11/61 (18%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP-----------PPPPPRPPPPGGGGGPPAPRDSGG 55 P P PPPP +AP PPPPPP PPPPP PPPPGG PP P GG Sbjct: 549 PPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGG 608 Query: 54 V 52 + Sbjct: 609 M 609 Score = 53.9 bits (128), Expect = 6e-06 Identities = 31/65 (47%), Positives = 32/65 (49%), Gaps = 15/65 (23%) Frame = -1 Query: 204 APSP---APPPPAAAEKDSSAPSPPPPP------PPPPPPRPPPPGGGGG------PPAP 70 AP+P APPPP P PPPPP PPPPPP PPPP GG PP P Sbjct: 540 APNPPQIAPPPPP--------PPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPP 591 Query: 69 RDSGG 55 GG Sbjct: 592 PPPGG 596 [227][TOP] >UniRef100_Q0CPW4 Actin cytoskeleton-regulatory complex protein pan1 n=1 Tax=Aspergillus terreus NIH2624 RepID=PAN1_ASPTN Length = 1469 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = -1 Query: 204 APSPAPPPPA-AAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 AP P PPPP AA + SA +PPPPPPPP PP PPP G PP P Sbjct: 1380 APPPPPPPPVPAAAPNGSAGAPPPPPPPPAPPMAPPPPPAGVPPPP 1425 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSA--PSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PP PAAA S+ P PPPPP PP P PPPP G PPAP Sbjct: 1383 PPPPPPVPAAAPNGSAGAPPPPPPPPAPPMAP-PPPPAGVPPPPAP 1427 [228][TOP] >UniRef100_Q9LI74 Protein CHUP1, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=CHUP1_ARATH Length = 1004 Score = 63.5 bits (153), Expect = 8e-09 Identities = 33/82 (40%), Positives = 40/82 (48%), Gaps = 8/82 (9%) Frame = -1 Query: 228 DVQERRSRAPSPAPPPPAAAEKDSSAPSP--------PPPPPPPPPPRPPPPGGGGGPPA 73 D+++R R P P PP A K ++ PS PPPPPPPP PPPP GGG PP Sbjct: 643 DIEKRPPRVPRP-PPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPP 701 Query: 72 PRDSGGVDEERNSSGVDRRAPK 7 P G + RAP+ Sbjct: 702 PPPPGALGRGAGGGNKVHRAPE 723 [229][TOP] >UniRef100_UPI00016E70C3 UPI00016E70C3 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E70C3 Length = 188 Score = 63.2 bits (152), Expect = 1e-08 Identities = 36/97 (37%), Positives = 55/97 (56%), Gaps = 1/97 (1%) Frame = +2 Query: 230 YLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTP-LGNLDLPRLFRFAAFGLVLQGPVG 406 YL L PI TK++T+G+L LG+ L+Q L G +D + R+A +GL + GPV Sbjct: 21 YLFLLKRYPIITKSVTSGILTALGNLLSQNLEARKKAGAIDGTGVARYAVYGLFITGPVS 80 Query: 407 HAWYNLLERVVRLPGVAGIAGKVAADQLLFAPVFTSI 517 H +Y L+E ++ I ++ D+L+FAP F I Sbjct: 81 HCFYQLMEALIPTTDPHCIIKRLLLDRLIFAPGFLLI 117 [230][TOP] >UniRef100_Q5PQ06 LOC496023 protein n=1 Tax=Xenopus laevis RepID=Q5PQ06_XENLA Length = 193 Score = 63.2 bits (152), Expect = 1e-08 Identities = 43/115 (37%), Positives = 65/115 (56%), Gaps = 7/115 (6%) Frame = +2 Query: 185 GGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTG-----TPLGNLD 349 G A L +LL YL+ L P+ TKA+T+ +L LG+ L+Q + N+D Sbjct: 10 GSAPLHTVLL---LRYLQLLHSRPVLTKALTSAILSALGNILSQTIQKWRKEQKAPQNVD 66 Query: 350 LPRLFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAGIAG--KVAADQLLFAPVF 508 L FRFA +GL+ GP+ H +Y LLE++V P A +AG ++ ++L+ AP F Sbjct: 67 LRGPFRFAVYGLLFTGPLSHYFYLLLEQLV--PSSAPLAGLQRLLIERLMIAPAF 119 [231][TOP] >UniRef100_Q56WE5 Putative uncharacterized protein At4g14310 n=1 Tax=Arabidopsis thaliana RepID=Q56WE5_ARATH Length = 185 Score = 63.2 bits (152), Expect = 1e-08 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 1/96 (1%) Frame = +2 Query: 218 SWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQG 397 +W YL L P++TKAITAGVL G D +AQ ++G + + RL +G G Sbjct: 8 AWRKYLIQLQAHPLRTKAITAGVLAGCSDAIAQKISG--VKRIQFRRLLLLMLYGFAYGG 65 Query: 398 PVGHAWYNLLERVVR-LPGVAGIAGKVAADQLLFAP 502 P GH ++ L++ + + G + +A KV +QL +P Sbjct: 66 PFGHFFHKLMDTIFKGKKGNSTVAKKVLLEQLTSSP 101 [232][TOP] >UniRef100_Q6Z1N7 Os08g0566900 protein n=2 Tax=Oryza sativa RepID=Q6Z1N7_ORYSJ Length = 187 Score = 63.2 bits (152), Expect = 1e-08 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 1/93 (1%) Frame = +2 Query: 227 SYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLDLPRLFRFAAFGLVLQGPVG 406 +Y++ L P++TKAIT+GVL G D +AQ ++G P NL RL +G GP G Sbjct: 11 AYMRQLQAHPLRTKAITSGVLAGCSDAIAQKISGVP--NLQRRRLLLIMLYGFAYAGPFG 68 Query: 407 HAWYNLLERVVR-LPGVAGIAGKVAADQLLFAP 502 H + L++R + G A KV +QL +P Sbjct: 69 HFLHKLMDRFFKGKKGKETTAKKVLVEQLTASP 101 [233][TOP] >UniRef100_A8J163 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J163_CHLRE Length = 226 Score = 63.2 bits (152), Expect = 1e-08 Identities = 38/114 (33%), Positives = 55/114 (48%), Gaps = 5/114 (4%) Frame = +2 Query: 182 GGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTP-LGNLDLPR 358 G G+ W Y + L P+ T+ +T+ +L G GD LAQ + L +D R Sbjct: 4 GVSLGISGSFRSLWGKYERTLQRRPVLTQCVTSCILWGCGDVLAQRVAEQRRLSEVDARR 63 Query: 359 LFRFAAFGLVLQGPVGHAWYNLLERVVRLPGVAG----IAGKVAADQLLFAPVF 508 + AAFG GPVGH WY+ L+ V AG +A K+ AD + P++ Sbjct: 64 VVTTAAFGACFMGPVGHFWYHSLDVVCARLLTAGSPSFLAAKLIADTAIMGPLY 117 [234][TOP] >UniRef100_A8IYH3 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8IYH3_CHLRE Length = 206 Score = 63.2 bits (152), Expect = 1e-08 Identities = 38/113 (33%), Positives = 54/113 (47%), Gaps = 1/113 (0%) Frame = +2 Query: 170 AAAGGGGAGLGALLLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGTPLGNLD 349 A+ G G G ++ +W Y++ L P++TK IT+ + GL D +AQ +T N Sbjct: 6 ASPGASGLPPGGIVGLAWQRYIQELHRRPLRTKCITSACVAGLSDVIAQFITQGSFKNWK 65 Query: 350 LPRLFRFAAFGLVLQGPVGHAWYNLLERVVR-LPGVAGIAGKVAADQLLFAPV 505 R AAFG GP H W +E + V + KVA DQL + PV Sbjct: 66 --RTLAVAAFGAAYTGPSAHFWQKFMEWLFSGKVDVGTVLVKVAVDQLSYGPV 116 [235][TOP] >UniRef100_A7P5C2 Chromosome chr4 scaffold_6, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7P5C2_VITVI Length = 218 Score = 63.2 bits (152), Expect = 1e-08 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 18/117 (15%) Frame = +2 Query: 209 LLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGT------PLGNLDLP----- 355 LLR W Y L V P+KT+ I++G++ G GD AQ +T T +G+ D Sbjct: 3 LLRLWKWYQDCLAVHPVKTQIISSGLIWGFGDICAQTITHTTAKRHHQIGDEDKELKINW 62 Query: 356 -RLFRFAAFGLVLQGPVGHAWYNLLERVVR------LPGVAGIAGKVAADQLLFAPV 505 R+ + FG GPVGH WY L+R++R +A KVA D ++F P+ Sbjct: 63 RRVATTSLFGFGFVGPVGHFWYEGLDRLIRHRLQLQPKSFRFVAAKVAIDGIIFGPL 119 [236][TOP] >UniRef100_A5BLD1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BLD1_VITVI Length = 218 Score = 63.2 bits (152), Expect = 1e-08 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 18/117 (15%) Frame = +2 Query: 209 LLRSWTSYLKALDVAPIKTKAITAGVLVGLGDTLAQMLTGT------PLGNLDLP----- 355 LLR W Y L V P+KT+ I++G++ G GD AQ +T T +G+ D Sbjct: 3 LLRLWKWYQDCLAVHPVKTQIISSGLIWGFGDICAQTITHTTAKRXHQIGDEDKELKINW 62 Query: 356 -RLFRFAAFGLVLQGPVGHAWYNLLERVVR------LPGVAGIAGKVAADQLLFAPV 505 R+ + FG GPVGH WY L+R++R +A KVA D ++F P+ Sbjct: 63 RRVATTSLFGFGFVGPVGHFWYEGLDRLIRHRLQLQPKSFRFVAAKVAIDGIIFGPL 119 [237][TOP] >UniRef100_UPI000175FB6D PREDICTED: similar to LOC495114 protein n=1 Tax=Danio rerio RepID=UPI000175FB6D Length = 954 Score = 63.2 bits (152), Expect = 1e-08 Identities = 32/68 (47%), Positives = 35/68 (51%), Gaps = 7/68 (10%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGGGGPPAPRDSGGVDE 46 AP P PPPP +P PPPPPPPP PPP PPPPGG PP P G+ Sbjct: 320 APPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIPPPP----GLFT 375 Query: 45 ERNSSGVD 22 S G+D Sbjct: 376 TSPSQGLD 383 Score = 58.5 bits (140), Expect = 3e-07 Identities = 28/58 (48%), Positives = 30/58 (51%), Gaps = 10/58 (17%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPP-------PPPPPRPPPPGGGG---GPPAPRDSGGV 52 P PPPP + P PPPPPP PPPPP PPPPG G PP P GG+ Sbjct: 308 PPPPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGL 365 [238][TOP] >UniRef100_UPI0000E12BCF Os07g0596300 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E12BCF Length = 754 Score = 63.2 bits (152), Expect = 1e-08 Identities = 40/117 (34%), Positives = 49/117 (41%), Gaps = 5/117 (4%) Frame = -1 Query: 405 PTGPWRTSPNAAKRNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*D 226 P P P +A ++ S P P + SV P P P + A R + Sbjct: 81 PPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFN 140 Query: 225 VQERRSRAPS-----PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P+ P PPPP + + PSPPPPP PPPP PPPPG GPP P Sbjct: 141 APPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPP--PPPPGARPGPPPP 195 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/63 (49%), Positives = 33/63 (52%), Gaps = 14/63 (22%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP-------PPPPPP------PPRPPPPGGGG-GPPAPRD 64 P P PPPP + S+ P PPP PPPPPP PP PPPPG GG PP P Sbjct: 203 PGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPA 262 Query: 63 SGG 55 GG Sbjct: 263 PGG 265 Score = 60.1 bits (144), Expect = 9e-08 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 6/54 (11%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP-----PPPRPPPPGG-GGGPPAPRDSG 58 PSP PPPP + P PPPPPPPP PPP PPPPGG PP P G Sbjct: 177 PSPPPPPPPPGAR----PGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGG 226 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 12/62 (19%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPP------PPPPPPP------PRPPPPGGGGGPPAPRD 64 RA +P PPPP + + P PPP PPPPP P P PPPP GG PP PR Sbjct: 227 RASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRG 286 Query: 63 SG 58 G Sbjct: 287 PG 288 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 6/54 (11%) Frame = -1 Query: 213 RSRAPS---PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGG---GGGPPAP 70 RS P+ P PPPP + S AP PPPPPPPPPPP P P PP P Sbjct: 52 RSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPP 105 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 13/60 (21%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPS-------PPPPPPP------PPPPRPPPPGGGGGPPAP 70 S AP P PPPP SAPS PPPPPPP PPPP PPP PP P Sbjct: 73 SGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPP 132 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSP------PPPPPPPPPPRPPPPGGGGGPPAP 70 R AP P PPP A P+P PPPPPPP PPPP G G PP P Sbjct: 240 RLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAPPPP 293 Score = 54.7 bits (130), Expect = 4e-06 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 7/55 (12%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPS--PPPPPPPPPP-----PRPPPPGGGGGPPAP 70 RS AP P+PPPP + P P PPPPPPPP P PPPP GG P AP Sbjct: 166 RSGAP-PSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAP 219 Score = 53.9 bits (128), Expect = 6e-06 Identities = 33/92 (35%), Positives = 41/92 (44%), Gaps = 11/92 (11%) Frame = -1 Query: 312 ASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDSSAPSPPPP 133 +S+ P P P L+ GA +R P P PPPP + ++ P+PPPP Sbjct: 2 SSIPPPPPPPP----LMSFGAQTRTF--------VPPPPPPPPPPRSGVGGNTPPAPPPP 49 Query: 132 P---------PPPPPPRPP--PPGGGGGPPAP 70 P PPPPPP PP P G PP P Sbjct: 50 PLRSTVPAISPPPPPPPPPLKPSSGAPCPPPP 81 [239][TOP] >UniRef100_UPI0000D9B853 PREDICTED: similar to Formin-1 isoform IV (Limb deformity protein) n=1 Tax=Macaca mulatta RepID=UPI0000D9B853 Length = 1164 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/53 (54%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPP-----RPPPPGGGGGPPAPRDSG 58 P P PPPP SS+ PPPPPPPPPPP P PP GG PPAP G Sbjct: 685 PPPPPPPPPPPLPLSSSAGPPPPPPPPPPPPPLPNSPAPPNPGGPPPAPPPPG 737 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/58 (50%), Positives = 31/58 (53%), Gaps = 10/58 (17%) Frame = -1 Query: 198 SPAPP-PPAAAEKDSSAPSPPPPPP---------PPPPPRPPPPGGGGGPPAPRDSGG 55 SPAPP PP +A P PPPPPP PPPPP PPPP PAP + GG Sbjct: 671 SPAPPVPPVSAGPPPPPPPPPPPPPLPLSSSAGPPPPPPPPPPPPPLPNSPAPPNPGG 728 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/57 (45%), Positives = 27/57 (47%), Gaps = 15/57 (26%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPP---------------RPPPPGGGGGPP 76 P P PPPP S+ P PPPPPPPPPPP PPPPG PP Sbjct: 687 PPPPPPPPPLPLSSSAGPPPPPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPP 743 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 9/54 (16%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPS---------PPPPPPPPPPPRPPPPGGGGGPPAP 70 AP P PPPP DS +P+ PPPPPPPPPPP P P GPP P Sbjct: 655 APIP-PPPPLPLGLDSLSPAPPVPPVSAGPPPPPPPPPPPPPLPLSSSAGPPPP 707 [240][TOP] >UniRef100_UPI0001A2DDE0 UPI0001A2DDE0 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2DDE0 Length = 1417 Score = 63.2 bits (152), Expect = 1e-08 Identities = 32/68 (47%), Positives = 35/68 (51%), Gaps = 7/68 (10%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGGGGPPAPRDSGGVDE 46 AP P PPPP +P PPPPPPPP PPP PPPPGG PP P G+ Sbjct: 817 APPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIPPPP----GLFT 872 Query: 45 ERNSSGVD 22 S G+D Sbjct: 873 TSPSQGLD 880 [241][TOP] >UniRef100_UPI000179CB3D inverted formin 2 isoform 1 n=1 Tax=Bos taurus RepID=UPI000179CB3D Length = 1211 Score = 63.2 bits (152), Expect = 1e-08 Identities = 31/70 (44%), Positives = 35/70 (50%), Gaps = 10/70 (14%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP----------PPPRPPPPGGGGGPPAPRDSGGV 52 P P PPPP ++ PSPPPPPPPP PPP PPP G GGPP P GV Sbjct: 444 PPPPPPPPPLPGMRAAFPSPPPPPPPPLPNSAITIPAPPPPPPPLPGLGGPPPPPPLPGV 503 Query: 51 DEERNSSGVD 22 + V+ Sbjct: 504 SGPPTAGSVE 513 Score = 61.2 bits (147), Expect = 4e-08 Identities = 36/100 (36%), Positives = 45/100 (45%), Gaps = 1/100 (1%) Frame = -1 Query: 366 RNKRGRSRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRAPSP-A 190 +++RG S SG P + +P V ++ G A + E R P P A Sbjct: 366 QSQRGSSPQNSGTPTADLGQQPAAALGSPPVASV--QGERGPAPQPTAPEPLERPPPPPA 423 Query: 189 PPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PP P P PPPPPPPPPPP PP PG P+P Sbjct: 424 PPLPGPTTAPRPPPPPPPPPPPPPPPPPPLPGMRAAFPSP 463 [242][TOP] >UniRef100_A9WHI6 Putative uncharacterized protein n=1 Tax=Chloroflexus aurantiacus J-10-fl RepID=A9WHI6_CHLAA Length = 344 Score = 63.2 bits (152), Expect = 1e-08 Identities = 38/116 (32%), Positives = 46/116 (39%), Gaps = 12/116 (10%) Frame = -1 Query: 348 SRLPSGVPVSICASVSPRPTNTPAVMALVLMGATSRALR*DVQERRSRA----------- 202 +R P P +V+P PT +P A+ A A Sbjct: 231 TRQPVSTPSPTVVTVTPSPTTSPTASPTASPTASPTASPTASPTASPTASATASPTEPPP 290 Query: 201 -PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERN 37 P P PPPP A +PPPPPPPPPPP PPPP G D G D++ N Sbjct: 291 PPPPPPPPPTVAPPPPPTVAPPPPPPPPPPPPPPPPPGDDD-----DDDGDDDDDN 341 [243][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP +P PPPPPPPPPPP PPPP PP P Sbjct: 94 PVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPP 137 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/51 (54%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP----PPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP S P PPPPPPP PPPP PPPP PP+P S Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPS 159 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 +PSP PPPP P PPPPPP PPPP PPPP PP P Sbjct: 84 SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPP 128 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 210 SRAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 S +P P PPPP P PPPP PPPPPP PPPP PP P Sbjct: 84 SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPP 130 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP PSPPPPPPPPPPP P PP PP P Sbjct: 92 PPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPP 135 Score = 61.2 bits (147), Expect = 4e-08 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP +PSPPPPPPPP PP PPPP PP+P Sbjct: 68 PPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSP 111 Score = 60.8 bits (146), Expect = 5e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP S P PPPPPPPPP P PPPP PP P Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNP 139 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP + P PPPPP PPPPP PPPP PP P Sbjct: 100 PPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP + P PPPP PPPPPP PPPP PP P Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPP 144 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP+ P PPP PPPPPPP PPPP PP P Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145 Score = 60.5 bits (145), Expect = 7e-08 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP-PPPPPRPPPPGGGGGPPAP 70 P P PPPP S +P PPPPPP PPPPP PPPP PP P Sbjct: 70 PPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPP 114 Score = 60.5 bits (145), Expect = 7e-08 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPP PPPP PPPP PP P Sbjct: 99 PPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142 Score = 60.5 bits (145), Expect = 7e-08 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P+P PPPP S PSPPP PPP PPP PPP PP+P S Sbjct: 137 PNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPS 183 Score = 60.5 bits (145), Expect = 7e-08 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP+ + S PSPPP PPP PPP PPP PP+P Sbjct: 141 PPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 184 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -1 Query: 204 APSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 +P P+PPP P + S PSPPP PPP PPPRPPP PP+P S Sbjct: 155 SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPS 203 Score = 58.5 bits (140), Expect = 3e-07 Identities = 31/76 (40%), Positives = 32/76 (42%), Gaps = 8/76 (10%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPP--------PPRPPPPGGGGGPPAPRDSGGV 52 R P P PPPP + P PPPP PPPP PPRPPPP P P S Sbjct: 310 RPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPP 369 Query: 51 DEERNSSGVDRRAPKA 4 R RR P A Sbjct: 370 RPPRRPPRPPRRPPTA 385 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP + PSP PPPPPPPP PPPP PP P Sbjct: 66 PPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPP 109 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/47 (51%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPS--PPPPPPPPPPPRPPPPGGGGGPPAP 70 +P P PPP S P PPPPPPPPPPP+PP P PP P Sbjct: 45 SPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPP 91 Score = 57.4 bits (137), Expect = 6e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP PPPPPPPPPPP PPP PP+P Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSP 150 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/51 (50%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -1 Query: 210 SRAPSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 S +P P+PPP P + S PSPPP PPP PPP PPP PP+P S Sbjct: 149 SPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPS 199 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -1 Query: 204 APSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPR 67 +P P+PPP P S PSPPP PPP PPPRPPP PP+PR Sbjct: 175 SPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPP---SPNPPSPR 218 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/48 (47%), Positives = 26/48 (54%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 +P P PPPP + P PPPPP P PPP PPP PP+P S Sbjct: 124 SPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPS 171 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/47 (53%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-PPRPPPPGGGGGPPAP 70 R P PAPPPP P PPPP PPPP PP P PP PP+P Sbjct: 245 RPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSP 291 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPP S P P PPPP PPPPRPPPP PP P Sbjct: 225 PSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPP----SPPPP 264 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPP + + P PPPPPPPP PP PP P PP P Sbjct: 51 PPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPP 94 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP PPPPPPPPP P PPP PP+P S Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPS 167 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/46 (52%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -1 Query: 204 APSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 +P P+PPP P + S PSPPP PPP PPP PPP PP+P Sbjct: 159 SPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSP 204 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/50 (52%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPP-----PPPPPPPPRPPPPGGGGGPPAPR 67 PSP PP P +P PPP PPP PPPPRPPPP PP PR Sbjct: 210 PSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPP----APPPPR 255 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/45 (55%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P PPPPA PSPPPP PPPP PP P PP PP+P Sbjct: 242 PPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSP 286 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -1 Query: 204 APSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 +P P+PPP P + S PSPPP PPP PPP PPP PP P S Sbjct: 163 SPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPS 211 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/46 (52%), Positives = 26/46 (56%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 R PSP+PP P + P P PPPP PPPP PPPP PP P Sbjct: 218 RPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPP----RPPPP 259 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAPR 67 P P PPPP+ PSPPPP PP PPPP PPPP PP+PR Sbjct: 252 PPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPP--SPLPPSPR 297 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 PSP+PPP + S PSPPP PPP PPP PPP PP P S Sbjct: 148 PSPSPPP---SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPS 191 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/50 (50%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -1 Query: 216 RRSRAPSPAPPPPAAAEKDSSAPSPPPPPPPPP-PPRPPPPGGGGGPPAP 70 RR P P+PPPP P PPPP PPPP PP P PP PP+P Sbjct: 232 RRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSP 281 Score = 53.5 bits (127), Expect = 8e-06 Identities = 25/50 (50%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -1 Query: 204 APSPAPPP-PAAAEKDSSAPSPPPPPPPPPPPRPPPPG---GGGGPPAPR 67 +P P+PPP P + S PSPPP PPP PPP P PP PP+PR Sbjct: 179 SPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPR 228 [244][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP+ PSPPPP PPPPPPP PPPP PP P S Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 451 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/51 (52%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP----PPPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP+ PSPPPPPP PPPPP PPPP PP P S Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 459 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PP P S P PPP PPPPPPP PPPP PP P S Sbjct: 421 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 467 Score = 61.2 bits (147), Expect = 4e-08 Identities = 29/49 (59%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAP-SPPPP-PPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP + S P SPPPP PPPPPPP PPPP PP P S Sbjct: 305 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 353 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPPPPP PPP PPP PP P Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 261 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPPPPP PPP PPP PP+P Sbjct: 311 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 354 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPPPP PPP PP P Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 393 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPPPPP PPP PPP PP+P Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPPPP PPP PP P Sbjct: 464 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 507 Score = 60.8 bits (146), Expect = 5e-08 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPPPPP PPP PPP PP+P Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512 Score = 60.1 bits (144), Expect = 9e-08 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPPPPP PPPP PP P Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP----SPPPP 253 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 264 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 307 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 364 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 365 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 408 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 479 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 522 Score = 60.1 bits (144), Expect = 9e-08 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPPPPP PPPP PP P Sbjct: 513 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP----SPPPP 553 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/48 (58%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP + PSPPPP PPPPPPP PPPP PP P S Sbjct: 253 PSPPPPPPPSPPP----PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 296 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ P PP PPPPPPP PPPP PP+P Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 302 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ P PP PPPPPPP PPPP PP+P Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 359 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ P PP PPPPPPP PPPP PP+P Sbjct: 360 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 403 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ P PP PPPPPPP PPPP PP+P Sbjct: 474 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 517 Score = 59.3 bits (142), Expect = 2e-07 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 7/54 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAP-SPPPPPPP------PPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP + S P SPPPPPPP PPPP PPPP PP P S Sbjct: 235 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 288 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP + S P PPPPPPP PP P PP PP+P Sbjct: 287 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 330 Score = 59.3 bits (142), Expect = 2e-07 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 7/54 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAP-SPPPP------PPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP + S P SPPPP PPPPPPP PPPP PP P S Sbjct: 344 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 397 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP+ PSPPPP PP PPPP PPPP PP P S Sbjct: 394 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 443 Score = 59.3 bits (142), Expect = 2e-07 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 7/54 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAP-SPPPP------PPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP + S P SPPPP PPPPPPP PPPP PP P S Sbjct: 458 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 511 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP +P PP PPPPPPP PPPP PP P Sbjct: 251 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/48 (52%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP+ +P PP PPPP PPPP PPPP PP P S Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 345 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/47 (51%), Positives = 26/47 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP+ PSPPPP PPPP P PP P PP P S Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 244 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP +P PP PPPP PPPP PPPP PP P S Sbjct: 342 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 389 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP +P PP PPPP PPPP PPPP PP P S Sbjct: 456 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 503 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 P P PPP + S P PPP PPPPPPP PPPP PP Sbjct: 258 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 299 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 PSP PPPP + PPPPPP PPPP PPPP PP Sbjct: 271 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 PSP PPPP S P PPP PPPPPPP PPPP PP Sbjct: 434 PSPPPPPPP-----SPPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP + PPPPPP PPPP PPPP PP P Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP----SPPPP 367 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP + PPPPPP PPPP PPPP PP P Sbjct: 372 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP----SPPPP 411 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP + PSPPPPPPP PPP PPP PP+P Sbjct: 426 PSPPPPPPPSPPPPPP-PSPPPPPPPSPPPPPPPSPPPPPPPSP 468 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP S P PPP PPPPPPP PPPP PP P Sbjct: 442 PSPPPPPPP-----SPPPPPPPSPPPPPPPSPPPP----SPPPP 476 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP + PPPPPP PPPP PPPP PP P Sbjct: 486 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP----SPPPP 525 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 193 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 237 Score = 57.0 bits (136), Expect = 8e-07 Identities = 22/42 (52%), Positives = 25/42 (59%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P PPPP+ +P PPPPP PPPPP P PP PP+P Sbjct: 437 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 478 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP-PPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSPPPPPP PPPP PPPP PP P Sbjct: 518 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP----SPPPP 558 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPP 76 P P+PPPP+ PSPPPP PP PPPP PPPP PP Sbjct: 203 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 247 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ +P PP PPPP PPP PPP PP P Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 271 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/48 (54%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAP-SPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP + S P SPPPP PPPP P PP P PP P S Sbjct: 388 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 435 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ P PP PPPP PPP PPP PP P Sbjct: 223 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 266 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP +P PP PPPPPPP PPP PP P Sbjct: 233 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP P PPPP PPPP PPPP PP+P Sbjct: 277 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 320 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP +P PP PPPPPPP PPP PP P Sbjct: 285 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP P PPPPPPP PP P PP PP+P Sbjct: 326 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 369 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP P PPPPPPP PP P PP PP+P Sbjct: 370 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 413 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP P PPPPPPP PP P PP PP+P Sbjct: 440 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 483 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP P PPPPPPP PP P PP PP+P Sbjct: 484 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 527 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP +P PP PPPP PPP PPP PP P Sbjct: 500 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/46 (54%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -1 Query: 201 PSPAPPPPAAAEKDS----SAPSPPPPPPPPPPPRPPPPGGGGGPP 76 PSP PPPP + S S P P PPPP PPPP PPPP PP Sbjct: 502 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 547 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP P PPPPPPP PP PPPP PP P Sbjct: 432 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP----SPPPP 471 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/44 (50%), Positives = 23/44 (52%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP P PPPPPPP PP P PP PP P Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPP-PPPPRPPPPGGGGGPPAP 70 P P+PPPP +P PP PPPP PPPP PPPP PP P Sbjct: 386 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP 426 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/43 (53%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -1 Query: 195 PAPPPPAAAEKDSSAPSPPPP-PPPPPPPRPPPPGGGGGPPAP 70 P+PPPP+ PSPPPP PPPP PP P PP PP+P Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 232 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/50 (54%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP------PPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP + PSPPPP PPPPPPP PPPP PP P Sbjct: 279 PSPPPPPPPSPPPPPP-PSPPPPSPPPPSPPPPPPPSPPPP----SPPPP 323 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP + PSPPPP PPPP P PP P PP P S Sbjct: 336 PSPPPPPPPSPPPPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 381 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PPPP + PSPPPP PPPP P PP P PP P S Sbjct: 450 PSPPPPPPPSPPPPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 495 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP S P PPP PPPP PP P PP PP+P Sbjct: 380 PSPPPPPPP-----SPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 418 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPPP S P PPP PPPP PP P PP PP+P Sbjct: 494 PSPPPPPPP-----SPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 532 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PP P +P PPPPP PPPP PPP PP+P Sbjct: 220 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 263 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/44 (50%), Positives = 23/44 (52%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPP + S P PPP PPPP PP P PP PP P Sbjct: 292 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPP 335 [245][TOP] >UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum bicolor RepID=C5XPK9_SORBI Length = 613 Score = 63.2 bits (152), Expect = 1e-08 Identities = 24/44 (54%), Positives = 28/44 (63%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ + S P P PPPP PPPP PPPP PP+P Sbjct: 432 PPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSP 475 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 449 PPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 492 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPP 76 PSP+PPPP+ PSP PPPP PPPP PPPP PP Sbjct: 466 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP 507 Score = 60.5 bits (145), Expect = 7e-08 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP+PPPP+ PSP PPPP PPPP PPPP PP P Sbjct: 422 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPP----SPPPP 461 Score = 60.5 bits (145), Expect = 7e-08 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP+PPPP+ PSPPPP PPPP P PPPP PP P Sbjct: 439 PSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPP----SPPPP 478 Score = 60.1 bits (144), Expect = 9e-08 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PPP+ PSP PPPP PPPP PPPP PP+P Sbjct: 405 PSPPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 448 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP+ S P P PPPP PPPP PPPP PP P S Sbjct: 427 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPP----SPPPPSPS 469 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P P+PPPP+ PSPPPP P PPPP PPPP PP P S Sbjct: 444 PPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPP----SPPPPSPS 486 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 410 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 453 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ S P P PPPP PPPP P PP PP+P Sbjct: 454 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 497 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 PSP PP P+ PSPPPP P PPPP PPPP PP P S Sbjct: 461 PSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP----SPPPPSPS 503 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 PSP PP P+ PSPPPP P PPPP PPPP PP P Sbjct: 417 PSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP----SPPPP 456 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ + S P P PPPP P PP P PP PP+P Sbjct: 415 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 458 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P+PPPP+ + S P P PPPP P PP P PP PP+P Sbjct: 459 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 502 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/47 (51%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPP---PPPPPPPRPPPPGGGGGPPAP 70 PSP PP P+ PSPPPP PP PPPP P PP PP+P Sbjct: 434 PSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSP 480 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/45 (51%), Positives = 25/45 (55%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 +PSP PP P +PSPPPP PPPP P PP P PP P Sbjct: 467 SPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP----SPPPP 507 [246][TOP] >UniRef100_C1MSQ5 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MSQ5_9CHLO Length = 1516 Score = 63.2 bits (152), Expect = 1e-08 Identities = 34/84 (40%), Positives = 38/84 (45%), Gaps = 10/84 (11%) Frame = -1 Query: 291 TNTPAVMALVLMGATSRALR*DVQERRSRAPSPAPPPPAAAEKDS-----SAPSPPPPPP 127 T T V L G ++R VQ +P P PPPP S +P PPPPPP Sbjct: 1017 TETVTVRVLANDGLSAREYHVLVQRAAPSSPPPPPPPPPPPSPPSPPPPNGSPQPPPPPP 1076 Query: 126 PP-----PPPRPPPPGGGGGPPAP 70 PP PPP PPPP PP P Sbjct: 1077 PPPPLPSPPPSPPPPSPSPSPPPP 1100 [247][TOP] >UniRef100_A8J9H7 Mastigoneme-like flagellar protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J9H7_CHLRE Length = 1987 Score = 63.2 bits (152), Expect = 1e-08 Identities = 38/76 (50%), Positives = 42/76 (55%), Gaps = 11/76 (14%) Frame = -1 Query: 207 RAPSPAPP---PPAAAEKDSSAPSPPPP--PP-PPPPPRPPPPGGGGGPPAPRDS----- 61 R PSPAPP PP + S PSPPPP PP PPPPP PPPP PP P S Sbjct: 1881 RPPSPAPPSPNPPPTSPPPSPPPSPPPPRPPPPPPPPPSPPPPNRSPPPPPPASSAINPG 1940 Query: 60 GGVDEERNSSGVDRRA 13 GGV++ + G RRA Sbjct: 1941 GGVNQNGDPVG-HRRA 1955 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/47 (51%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -1 Query: 207 RAPSPAPPPPAAAEKDSSAPSPPPPPPPP-PPPRPPPPGGGGGPPAP 70 R PSP PP P +P+PPP PPP PPP PPPP PP P Sbjct: 1871 RPPSPNPPSPRPPSPAPPSPNPPPTSPPPSPPPSPPPPRPPPPPPPP 1917 [248][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P+P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P P PPPP P PPPPPPPPPPP PPPP PP P S Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPS 109 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -1 Query: 204 APSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 AP P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-----PPPP 100 Score = 60.1 bits (144), Expect = 9e-08 Identities = 24/47 (51%), Positives = 27/47 (57%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P P PPPP P PPPPPPPPPPP PPPP PP +++ Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQEN 112 [249][TOP] >UniRef100_Q1HMI8 Formin A n=2 Tax=Trypanosoma cruzi RepID=Q1HMI8_TRYCR Length = 1097 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/55 (54%), Positives = 30/55 (54%), Gaps = 11/55 (20%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPP--------PPPPPRPPPPGGG---GGPPAP 70 P P PPPP A S P PPPPPP PPPPP PPPPG G G PP P Sbjct: 523 PPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPPPGAGTKSGLPPPP 577 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/58 (51%), Positives = 31/58 (53%), Gaps = 10/58 (17%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPPPPP-------PPPRPPPPGGG---GGPPAP 70 +S P P PPPP A K P PPPPPPP PPP PPPPG G G PP P Sbjct: 536 KSGLPPPPPPPPGAGAKSGLPPPPPPPPPPGAGTKSGLPPPPPPPPGAGTKSGLPPPP 593 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/71 (43%), Positives = 34/71 (47%), Gaps = 8/71 (11%) Frame = -1 Query: 213 RSRAPSPAPPPPAAAEKDSSAPSPPPPP--------PPPPPPRPPPPGGGGGPPAPRDSG 58 +S P P PPPP A K P PPPPP PPPPPP PP G P P S Sbjct: 570 KSGLPPPPPPPPGAGTKSGLPPPPPPPPGAGTKSGLPPPPPPPPPKAKSGPAQPGPTRSI 629 Query: 57 GVDEERNSSGV 25 +D +N S V Sbjct: 630 PIDVVKNISKV 640 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/53 (52%), Positives = 28/53 (52%), Gaps = 9/53 (16%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPP------PPPRPPPPGGG---GGPPAP 70 P P PPPP A S P PPPPPP PPP PPPPG G G PP P Sbjct: 557 PPPPPPPPPGAGTKSGLPPPPPPPPGAGTKSGLPPPPPPPPGAGTKSGLPPPP 609 [250][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDS 61 P P PPPP P PPPPPPPPPPP PPPP PP P S Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQS 57 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/65 (44%), Positives = 32/65 (49%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAPRDSGGVDEERNSSGVD 22 P P PPPP P PPPPPPPPPPP PPPP PP P+ V E + + Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFRFVLERFSKTCTS 71 Query: 21 RRAPK 7 R K Sbjct: 72 SREAK 76 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 201 PSPAPPPPAAAEKDSSAPSPPPPPPPPPPPRPPPPGGGGGPPAP 70 P P PPPP P PPPPPPPPPPP PPPP PP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53