[UP]
[1][TOP] >UniRef100_C8WRX3 Peptidase M20 n=1 Tax=Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 RepID=C8WRX3_ALIAC Length = 462 Score = 75.9 bits (185), Expect = 2e-12 Identities = 36/66 (54%), Positives = 45/66 (68%) Frame = +1 Query: 328 VDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENG 507 V+ +LER R L+ LK+LL IPS+SALS H DVR A EW A S GF + E++E G Sbjct: 7 VESYLERERDALLEELKELLSIPSVSALSEHRGDVRRAAEWIAERLKSAGFEHVELMETG 66 Query: 508 GHPVVY 525 GHP+VY Sbjct: 67 GHPLVY 72 [2][TOP] >UniRef100_Q67Q20 Putative peptidase n=1 Tax=Symbiobacterium thermophilum RepID=Q67Q20_SYMTH Length = 457 Score = 75.5 bits (184), Expect = 2e-12 Identities = 36/66 (54%), Positives = 41/66 (62%) Frame = +1 Query: 328 VDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENG 507 V+ +L R HL L D LRIPS+SALS H DVR A EW AA +G EV+E G Sbjct: 4 VEAYLRERRDEHLRQLMDFLRIPSVSALSEHRSDVRRAAEWLAAELRRIGLNRVEVMETG 63 Query: 508 GHPVVY 525 GHPVVY Sbjct: 64 GHPVVY 69 [3][TOP] >UniRef100_B7DNP7 Peptidase M20 n=1 Tax=Alicyclobacillus acidocaldarius LAA1 RepID=B7DNP7_9BACL Length = 462 Score = 72.4 bits (176), Expect = 2e-11 Identities = 35/66 (53%), Positives = 43/66 (65%) Frame = +1 Query: 328 VDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENG 507 V+ +LE R L LK+LL IPS+SALS H DVR A EW A S GF + E++E G Sbjct: 7 VESYLESQRDALLGELKELLSIPSVSALSEHRGDVRRAAEWIAERLKSAGFEHVELMETG 66 Query: 508 GHPVVY 525 GHP+VY Sbjct: 67 GHPLVY 72 [4][TOP] >UniRef100_C1F7H5 Peptidase, M20/M25/M40 family n=1 Tax=Acidobacterium capsulatum ATCC 51196 RepID=C1F7H5_ACIC5 Length = 457 Score = 71.6 bits (174), Expect = 3e-11 Identities = 35/67 (52%), Positives = 45/67 (67%) Frame = +1 Query: 325 AVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLEN 504 AVD + +H+ LD LKDLLRIPS+S L H DVR A EW AA T +G ++ EV++ Sbjct: 5 AVD-YARQHQSRFLDELKDLLRIPSVSTLPEHKADVRRAAEWLAAELTRIGMQHVEVIDT 63 Query: 505 GGHPVVY 525 GHP+VY Sbjct: 64 PGHPLVY 70 [5][TOP] >UniRef100_A3I827 Putative uncharacterized protein n=1 Tax=Bacillus sp. B14905 RepID=A3I827_9BACI Length = 460 Score = 69.3 bits (168), Expect = 2e-10 Identities = 30/71 (42%), Positives = 42/71 (59%) Frame = +1 Query: 313 TNFTAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAE 492 TN +D + HR HL+ LK+ L+IPSIS+LS H D++ A +W A +L N Sbjct: 2 TNLQQIDAYFAEHREAHLNELKEFLQIPSISSLSEHKEDIQHAAQWLANAFETLNLENIS 61 Query: 493 VLENGGHPVVY 525 + + GHPVVY Sbjct: 62 ITQTAGHPVVY 72 [6][TOP] >UniRef100_B1HZ90 Cytosolic nonspecific dipeptidase (Glutamate carboxypeptidase-like protein 1) (CNDP dipeptidase 2) n=1 Tax=Lysinibacillus sphaericus C3-41 RepID=B1HZ90_LYSSC Length = 460 Score = 68.9 bits (167), Expect = 2e-10 Identities = 30/71 (42%), Positives = 41/71 (57%) Frame = +1 Query: 313 TNFTAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAE 492 TN +D + HR HL+ LK+ L+IPSIS+LS H D++ A +W A L N Sbjct: 2 TNLQQIDAYFAEHREAHLNELKEFLQIPSISSLSEHKEDIQHAAQWLANAFEKLNLENIS 61 Query: 493 VLENGGHPVVY 525 + + GHPVVY Sbjct: 62 ITQTAGHPVVY 72 [7][TOP] >UniRef100_C1D3C2 Putative peptidase M20 n=1 Tax=Deinococcus deserti VCD115 RepID=C1D3C2_DEIDV Length = 466 Score = 66.6 bits (161), Expect = 1e-09 Identities = 31/62 (50%), Positives = 39/62 (62%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 +LE H HL+ L+ +RIPS+S HAPDVR A EW AA +S G +A V + GHP Sbjct: 8 YLEEHYERHLEDLRTFVRIPSVSTEGQHAPDVRRAAEWVAARLSSAGLTDARVTDTPGHP 67 Query: 517 VV 522 VV Sbjct: 68 VV 69 [8][TOP] >UniRef100_UPI0001B4FF0C peptidase n=1 Tax=Streptomyces viridochromogenes DSM 40736 RepID=UPI0001B4FF0C Length = 475 Score = 65.5 bits (158), Expect = 2e-09 Identities = 34/76 (44%), Positives = 44/76 (57%) Frame = +1 Query: 298 VAALSTNFTAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLG 477 V T +AV ++E+HR LD L + LRIPS+SA HAPDVR + +W AA G Sbjct: 7 VTMSQTPDSAVRTYIEQHRAAFLDDLAEWLRIPSVSAQPDHAPDVRRSADWLAAELKQTG 66 Query: 478 FRNAEVLENGGHPVVY 525 F AEV + G P V+ Sbjct: 67 FPTAEVWQTPGAPAVF 82 [9][TOP] >UniRef100_C1PFF3 Peptidase M20 n=1 Tax=Bacillus coagulans 36D1 RepID=C1PFF3_BACCO Length = 459 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/63 (49%), Positives = 39/63 (61%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 +L+ H HL+ L D L+IPSIS+LS H PDVR A EW A G + V+E G+P Sbjct: 8 YLKEHHEQHLEELFDFLQIPSISSLSEHQPDVRKAAEWLKAELGKTGLEHTAVMETKGNP 67 Query: 517 VVY 525 VVY Sbjct: 68 VVY 70 [10][TOP] >UniRef100_UPI0001692C64 hypothetical protein Plarl_21196 n=1 Tax=Paenibacillus larvae subsp. larvae BRL-230010 RepID=UPI0001692C64 Length = 457 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/63 (41%), Positives = 41/63 (65%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 ++ +H+ HL+ LK LRIPSISA+S H PD+ A +W A+ + G + +++ GHP Sbjct: 8 YMVQHQERHLEELKQFLRIPSISAVSLHKPDIEACAQWLASSLKTAGMEHVQIMPTEGHP 67 Query: 517 VVY 525 +VY Sbjct: 68 IVY 70 [11][TOP] >UniRef100_Q9K657 BH3875 protein n=1 Tax=Bacillus halodurans RepID=Q9K657_BACHD Length = 458 Score = 65.1 bits (157), Expect = 3e-09 Identities = 31/63 (49%), Positives = 38/63 (60%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 +LE+ R HLD LK LL IPS+SALS H DVR A W G + E++E GHP Sbjct: 7 YLEQKREEHLDELKQLLAIPSVSALSEHKEDVRKAAAWFVDTLQKAGLEHVEMIETKGHP 66 Query: 517 VVY 525 +VY Sbjct: 67 LVY 69 [12][TOP] >UniRef100_A9WGN8 Peptidase M20 n=2 Tax=Chloroflexus RepID=A9WGN8_CHLAA Length = 455 Score = 65.1 bits (157), Expect = 3e-09 Identities = 32/63 (50%), Positives = 38/63 (60%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 +L H+ L L D LRIPSISA+S+HA DV A EW A T G + +L GGHP Sbjct: 7 YLAEHQERFLAELVDFLRIPSISAISAHAGDVLRAAEWVANRLTQAGMEHVAILPTGGHP 66 Query: 517 VVY 525 VVY Sbjct: 67 VVY 69 [13][TOP] >UniRef100_UPI0001B51E04 peptidase n=1 Tax=Streptomyces griseoflavus Tu4000 RepID=UPI0001B51E04 Length = 470 Score = 64.7 bits (156), Expect = 4e-09 Identities = 32/68 (47%), Positives = 40/68 (58%) Frame = +1 Query: 322 TAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLE 501 +AV ++E+HR LD L + LRIPS+SA HAPDVR + +W AA GF EV Sbjct: 10 SAVRTYIEQHRAAFLDDLAEWLRIPSVSAQPDHAPDVRGSADWLAAALEETGFPTVEVWH 69 Query: 502 NGGHPVVY 525 G P VY Sbjct: 70 TPGAPAVY 77 [14][TOP] >UniRef100_UPI000178AA44 peptidase M20 n=1 Tax=Geobacillus sp. Y412MC10 RepID=UPI000178AA44 Length = 453 Score = 64.7 bits (156), Expect = 4e-09 Identities = 30/62 (48%), Positives = 37/62 (59%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 + HR THL+ LK+ L IPSISALS H DV A EW A T G + EV + GHP Sbjct: 8 YFAEHRETHLNELKEWLSIPSISALSEHKGDVAKAAEWLAGKLTEAGLEHVEVHQTAGHP 67 Query: 517 VV 522 ++ Sbjct: 68 II 69 [15][TOP] >UniRef100_C1ZNJ3 Acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase n=1 Tax=Rhodothermus marinus DSM 4252 RepID=C1ZNJ3_RHOMR Length = 458 Score = 64.7 bits (156), Expect = 4e-09 Identities = 30/63 (47%), Positives = 40/63 (63%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 +++ H ++ LKDLLRIPSIS +AP+VR A +W A + LGF EV E GHP Sbjct: 8 YVDTHFSRFVEELKDLLRIPSISTDPDYAPEVRRAADWLAEHFRKLGFLKVEVFETEGHP 67 Query: 517 VVY 525 +VY Sbjct: 68 IVY 70 [16][TOP] >UniRef100_B5HN80 Peptidase n=1 Tax=Streptomyces sviceus ATCC 29083 RepID=B5HN80_9ACTO Length = 471 Score = 64.7 bits (156), Expect = 4e-09 Identities = 32/68 (47%), Positives = 41/68 (60%) Frame = +1 Query: 322 TAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLE 501 +AV ++E+HR LD L + LRIPS+SA H PDVR + +W AA GF AEV E Sbjct: 10 SAVRTYIEQHRAAFLDDLAEWLRIPSVSAQPDHGPDVRRSADWLAAKLRETGFPTAEVWE 69 Query: 502 NGGHPVVY 525 G P V+ Sbjct: 70 TPGAPAVF 77 [17][TOP] >UniRef100_B8G9L7 Peptidase M20 n=1 Tax=Chloroflexus aggregans DSM 9485 RepID=B8G9L7_CHLAD Length = 455 Score = 64.3 bits (155), Expect = 5e-09 Identities = 31/65 (47%), Positives = 40/65 (61%) Frame = +1 Query: 331 DGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGG 510 + +L H+ L L + LRIPSISA+S+HA DV A EW A T+ G + +L GG Sbjct: 5 NSYLTEHQDRFLAELVEFLRIPSISAISTHANDVLRAAEWVANRLTAAGMEHVAILPTGG 64 Query: 511 HPVVY 525 HPVVY Sbjct: 65 HPVVY 69 [18][TOP] >UniRef100_C9ZBS0 Putative peptidase n=1 Tax=Streptomyces scabiei 87.22 RepID=C9ZBS0_STRSC Length = 475 Score = 64.3 bits (155), Expect = 5e-09 Identities = 34/81 (41%), Positives = 46/81 (56%) Frame = +1 Query: 283 SVGAEVAALSTNFTAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAY 462 S+ V + ++ T V +++ HR LD L + LRIPS+SA HAPDVR + +W AA Sbjct: 2 SMSQSVDSDVSDVTVVRTYIQDHRAAFLDDLVEWLRIPSVSAQPEHAPDVRRSADWLAAK 61 Query: 463 ATSLGFRNAEVLENGGHPVVY 525 GF AEV E G P V+ Sbjct: 62 LRETGFPTAEVWETPGAPAVF 82 [19][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 63.5 bits (153), Expect = 8e-09 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP+PPPPPLPPPPPPP LP PPPL P P Sbjct: 85 PPPLPPPPPLPPPPPPPPPLPPPPPLPPPPP 115 Score = 57.8 bits (138), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP+PPPPPLPPPPPPP P PPPL P P Sbjct: 101 PPPLPPPPPLPPPPPPP---PLPPPLPPPLP 128 Score = 57.0 bits (136), Expect = 8e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP+PPPPPLPPPPP P P PPPL P P Sbjct: 79 PPPLPPPPPLPPPPPLPPPPPPPPPLPPPPP 109 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP+PPPPP PPP PPP LP PPP P P Sbjct: 91 PPPLPPPPPPPPPLPPPPPLPPPPPPPPLPP 121 [20][TOP] >UniRef100_UPI0001B53EB1 peptidase n=1 Tax=Streptomyces sp. SPB78 RepID=UPI0001B53EB1 Length = 473 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/90 (40%), Positives = 47/90 (52%) Frame = +1 Query: 256 NTTPTGTDASVGAEVAALSTNFTAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVR 435 +TTP+G D +VGA A ++ HR LD L LRIPS+SA HA DVR Sbjct: 2 STTPSGADDAVGAVRAHVTA-----------HRAAFLDDLAAWLRIPSVSAQPEHAADVR 50 Query: 436 AAGEWTAAYATSLGFRNAEVLENGGHPVVY 525 + EW AA + GF E+ + G P V+ Sbjct: 51 RSAEWLAAQLRATGFPTVEIWDTPGAPAVF 80 [21][TOP] >UniRef100_B9L2V7 Peptidase M20 n=1 Tax=Thermomicrobium roseum DSM 5159 RepID=B9L2V7_THERP Length = 464 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/65 (46%), Positives = 39/65 (60%) Frame = +1 Query: 331 DGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGG 510 D +L H HL AL DLLRIPS+SAL H DV+ A EW AA ++G +LE Sbjct: 9 DRYLAEHEAEHLQALGDLLRIPSVSALPQHQADVQRAAEWVAARLRAIGVPEVRLLETER 68 Query: 511 HPVVY 525 +P+V+ Sbjct: 69 NPIVF 73 [22][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 62.4 bits (150), Expect = 2e-08 Identities = 44/111 (39%), Positives = 49/111 (44%), Gaps = 10/111 (9%) Frame = +2 Query: 167 WLV--GRARRRPPP--------MPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRR 316 WL+ G+AR+ PPP PPPPP PPPPPPP S P PPP PT P Sbjct: 776 WLIVLGQARQSPPPSPPPPLPPSPPPPPSPPPPPPPPS-PPPPPNPPTPPSPPPP----- 829 Query: 317 TSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 S P + PS S P P P PT PP + PP PP Sbjct: 830 PSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPP 880 Score = 53.9 bits (128), Expect = 7e-06 Identities = 36/104 (34%), Positives = 42/104 (40%), Gaps = 5/104 (4%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP P PPP PPP PPP P PPP P P S +S P + + P Sbjct: 868 PPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSS-PPPLSSPPPP 926 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPP-----RMPPRWDSAMP 490 S S P P P+ P PP + P PPR + P Sbjct: 927 SSPPPPSPPLPPSPPLPPNPPPPPSPSPXXXXXXXPPRLPTPSP 970 [23][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/108 (34%), Positives = 45/108 (41%), Gaps = 15/108 (13%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAP---------------TRPWALKSLRCRRTSRP 328 PPP PPPPPLPPPPPPP LP PPP P ++P L + T+ Sbjct: 263 PPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVAPPSTSQPTQLSTTPTSSTTST 322 Query: 329 WTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPR 472 T NA++ ++T S L R P P PPR Sbjct: 323 GTTTTNASIMDNTQQAQTQTQSQELLEVRCRMTPPDTPAFTPYLSPPR 370 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPPL P P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP LP PPP P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 Score = 54.3 bits (129), Expect = 5e-06 Identities = 37/110 (33%), Positives = 40/110 (36%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PPP P P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP----------------------------- 264 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMPRCSRTVATQSS 523 P P P+ P PP PP PP +P S TVA S+ Sbjct: 265 --------PPPPPPPLPPPPPPPPPLPP-PPPSLPLPLPTTSATVAPPST 305 [24][TOP] >UniRef100_B4V910 Peptidase n=1 Tax=Streptomyces sp. Mg1 RepID=B4V910_9ACTO Length = 469 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/68 (48%), Positives = 40/68 (58%) Frame = +1 Query: 322 TAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLE 501 +AV +++ HR LD L D LRIPS+SA HA DVR + EW AA GF AEV E Sbjct: 10 SAVRTYIDTHRADFLDDLVDWLRIPSVSAQPEHAGDVRRSAEWLAAKLKETGFPVAEVWE 69 Query: 502 NGGHPVVY 525 G P V+ Sbjct: 70 TDGAPAVF 77 [25][TOP] >UniRef100_A8W0R6 Putative uncharacterized protein n=1 Tax=Bacillus selenitireducens MLS10 RepID=A8W0R6_9BACI Length = 458 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/66 (43%), Positives = 39/66 (59%) Frame = +1 Query: 328 VDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENG 507 V +L+ HR +L L + L IPS+S S+H DV AGE+ Y +GF E+ E G Sbjct: 5 VKTYLKTHREQNLARLNEFLSIPSVSTTSAHKDDVLKAGEFVRDYLNEIGFDKVEIKETG 64 Query: 508 GHPVVY 525 GHP+VY Sbjct: 65 GHPLVY 70 [26][TOP] >UniRef100_C5XMP4 Putative uncharacterized protein Sb03g003730 n=1 Tax=Sorghum bicolor RepID=C5XMP4_SORBI Length = 557 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/94 (39%), Positives = 43/94 (45%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 P P PPPPPL P PPPP LP+PPP P P R+ P ++ A V H Sbjct: 432 PLPSPPPPPLLPSPPPPSPLPSPPP-PPLLPSPPPPSPRPRSPPPPSSPPPAPVYHPPPQ 490 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRW 475 C P LPC P P PP P +PP + Sbjct: 491 CPPCPVLPPPLPCTPTHPWPPPPPFYPGPLPPTY 524 [27][TOP] >UniRef100_UPI0001AEF37A peptidase n=1 Tax=Streptomyces ghanaensis ATCC 14672 RepID=UPI0001AEF37A Length = 470 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/68 (47%), Positives = 40/68 (58%) Frame = +1 Query: 322 TAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLE 501 +AV ++E+H LD L LRIPS+SA HAPDVR + +W AA GF AEV + Sbjct: 10 SAVRTYIEQHCSAFLDDLTAWLRIPSVSARPDHAPDVRRSADWLAAELRRTGFPTAEVWQ 69 Query: 502 NGGHPVVY 525 G P VY Sbjct: 70 TPGAPAVY 77 [28][TOP] >UniRef100_Q2B8C1 Putative uncharacterized protein n=1 Tax=Bacillus sp. NRRL B-14911 RepID=Q2B8C1_9BACI Length = 458 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/63 (47%), Positives = 35/63 (55%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 +L + R THL L + L IPSISAL H DVR A EWTA G N + + HP Sbjct: 8 YLIKERDTHLQELTEFLSIPSISALPDHKEDVRKAAEWTAKALEKAGAENVNIYDTSRHP 67 Query: 517 VVY 525 VVY Sbjct: 68 VVY 70 [29][TOP] >UniRef100_C4CQE5 Acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase n=1 Tax=Sphaerobacter thermophilus DSM 20745 RepID=C4CQE5_9CHLR Length = 457 Score = 61.2 bits (147), Expect = 4e-08 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = +1 Query: 331 DGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGG 510 D +LE HL+A+++ LRIPS+SAL H DVR A EW A Y +G E+L Sbjct: 7 DRYLEEREQEHLEAIQEFLRIPSVSALPEHQGDVRRAAEWLADYLRRIGVPQVELLPTER 66 Query: 511 HPVVY 525 +PVV+ Sbjct: 67 NPVVF 71 [30][TOP] >UniRef100_B5GQ80 Peptidase n=1 Tax=Streptomyces clavuligerus ATCC 27064 RepID=B5GQ80_STRCL Length = 465 Score = 61.2 bits (147), Expect = 4e-08 Identities = 32/68 (47%), Positives = 40/68 (58%) Frame = +1 Query: 322 TAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLE 501 +AV ++E+HR LD L D LRIPS+SA H DVR + +W AA T GF AEV Sbjct: 7 SAVRQYIEQHRAAFLDDLADWLRIPSVSAQPEHDADVRRSADWLAAKLTETGFPVAEVWP 66 Query: 502 NGGHPVVY 525 G P V+ Sbjct: 67 TPGAPAVF 74 [31][TOP] >UniRef100_C6CZ37 Peptidase M20 n=1 Tax=Paenibacillus sp. JDR-2 RepID=C6CZ37_PAESJ Length = 451 Score = 60.8 bits (146), Expect = 5e-08 Identities = 27/65 (41%), Positives = 37/65 (56%) Frame = +1 Query: 331 DGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGG 510 + + R L+ LK+ LRIPSISALS H D+ A EW A + G N ++ + G Sbjct: 4 ESYFSERREQQLEELKEFLRIPSISALSEHKQDMIKAAEWVAGKLEAAGLENVKIHQTAG 63 Query: 511 HPVVY 525 HP+VY Sbjct: 64 HPIVY 68 [32][TOP] >UniRef100_C6J1X7 Peptidase M20 n=1 Tax=Paenibacillus sp. oral taxon 786 str. D14 RepID=C6J1X7_9BACL Length = 451 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/63 (46%), Positives = 37/63 (58%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 + +R HL+ L +LLRIPSISALS H DV+ A EW A G + E+ GHP Sbjct: 6 YFNTNREQHLNELGELLRIPSISALSEHKGDVQKAAEWIAEALRRAGMESVEIHPTAGHP 65 Query: 517 VVY 525 +VY Sbjct: 66 IVY 68 [33][TOP] >UniRef100_C5YU09 Putative uncharacterized protein Sb08g008380 n=1 Tax=Sorghum bicolor RepID=C5YU09_SORBI Length = 149 Score = 60.8 bits (146), Expect = 5e-08 Identities = 31/51 (60%), Positives = 32/51 (62%) Frame = +2 Query: 185 RRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTA 337 RRRPPP PPPPP PPPPPPP P PPPL+P SLR RR TA Sbjct: 6 RRRPPPPPPPPPPPPPPPPP---PPPPPLSP-------SLRRRRRGHQATA 46 [34][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/50 (52%), Positives = 27/50 (54%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGW 343 PPP PPPPP PPPPPPP P PPP P P R + R W GW Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRRWLLGW 54 [35][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 60.5 bits (145), Expect = 7e-08 Identities = 39/104 (37%), Positives = 39/104 (37%), Gaps = 3/104 (2%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PPP P P C P P Sbjct: 266 PPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPP-PPPPPPPCPPPPPP 324 Query: 374 SRTC---CASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMPRC 496 C C PC P P C PP PP PP P C Sbjct: 325 PPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPPCPPPPPPCPPAC 368 Score = 57.0 bits (136), Expect = 8e-07 Identities = 31/92 (33%), Positives = 31/92 (33%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PPP P Sbjct: 258 PPPCPPPPPPPPPPPPPPPPPPPPPCPP-------------------------------- 285 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 PC P P C PP PP PP Sbjct: 286 -----------PCPPPPPPCPPPPPPPPPCPP 306 [36][TOP] >UniRef100_Q9FCK3 Putative peptidase n=1 Tax=Streptomyces coelicolor RepID=Q9FCK3_STRCO Length = 470 Score = 60.5 bits (145), Expect = 7e-08 Identities = 31/68 (45%), Positives = 40/68 (58%) Frame = +1 Query: 322 TAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLE 501 +AV ++E+HR LD L + LRIPS+SA HA DVR + +W AA GF AEV Sbjct: 10 SAVRTYIEQHRAAFLDDLVEWLRIPSVSAQPDHATDVRRSADWLAAKLKETGFPTAEVWP 69 Query: 502 NGGHPVVY 525 G P V+ Sbjct: 70 TRGAPAVF 77 [37][TOP] >UniRef100_UPI0001AECBC1 M20/M25/M40 family peptidase n=1 Tax=Streptomyces roseosporus NRRL 11379 RepID=UPI0001AECBC1 Length = 471 Score = 60.1 bits (144), Expect = 9e-08 Identities = 31/68 (45%), Positives = 40/68 (58%) Frame = +1 Query: 322 TAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLE 501 +AV + E+HR LD L + LRIPS+SA HA DVR + EW +A GF AE+ E Sbjct: 7 SAVRTYTEQHRAAFLDDLAEWLRIPSVSAQPEHAGDVRRSAEWLSAKLKETGFPVAEIWE 66 Query: 502 NGGHPVVY 525 G P V+ Sbjct: 67 TPGAPAVF 74 [38][TOP] >UniRef100_UPI0001951234 Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein). n=1 Tax=Canis lupus familiaris RepID=UPI0001951234 Length = 1045 Score = 60.1 bits (144), Expect = 9e-08 Identities = 35/86 (40%), Positives = 42/86 (48%), Gaps = 7/86 (8%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPT---RPWALKS----LRCRRTSRPWTAGWNAT 352 PPP PPPPP PPPPPPP P PPPL T P + KS + +TS P T Sbjct: 865 PPPPPPPPPPPPPPPPPAPAPAPPPLTATPTVSPASDKSGSPGKKTSKTSSPGAKKPPPT 924 Query: 353 VRHT*TPSRTCCASHPFLPCRPMRPT 430 + + + CA HP P RP+ Sbjct: 925 PQRNSSIKSSSCAEHP----EPKRPS 946 Score = 53.9 bits (128), Expect = 7e-06 Identities = 37/100 (37%), Positives = 42/100 (42%), Gaps = 4/100 (4%) Frame = +2 Query: 182 ARRRPPPMPPPPPLPPPPPPPHSLPTPPP--LAPTRPWALKSLRC--RRTSRPWTAGWNA 349 A + PP+PPP P PPPPPPP P PPP AP P L C R R + Sbjct: 673 ASQPSPPLPPPHPPPPPPPPPPPPPPPPPPARAPPSPAFPNPLLCPHRPAPRLCHSVMTQ 732 Query: 350 TVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 V T TP P P + P+ PP P PP Sbjct: 733 AVPPTPTPPAPPAKKQPAFPVSHIPPS--PPAPPGPVPPP 770 [39][TOP] >UniRef100_B5GJP1 Peptidase n=1 Tax=Streptomyces sp. SPB74 RepID=B5GJP1_9ACTO Length = 473 Score = 60.1 bits (144), Expect = 9e-08 Identities = 35/90 (38%), Positives = 46/90 (51%) Frame = +1 Query: 256 NTTPTGTDASVGAEVAALSTNFTAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVR 435 +TTP G D +VGA A ++ HR LD L LRIPS+SA HA DVR Sbjct: 2 STTPHGADDAVGAVRAHVTA-----------HRAAFLDDLAAWLRIPSVSAQPEHAADVR 50 Query: 436 AAGEWTAAYATSLGFRNAEVLENGGHPVVY 525 + +W AA + GF E+ + G P V+ Sbjct: 51 RSADWLAATLRATGFPTVEIWDTPGAPAVF 80 [40][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 59.7 bits (143), Expect = 1e-07 Identities = 46/141 (32%), Positives = 60/141 (42%), Gaps = 17/141 (12%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P G V+ LPA+ P R + + + PPP PPPPP PPPPPPP P PPP + Sbjct: 2377 PSGSPSVSSLPAKPRPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2432 Query: 275 PTRPWALKSLRCRRTSRPWTA----------GWNATVRHT*TP-SRTCCASHPFLPCRPM 421 P +P L + S TA A +R P +R C + P +P +P Sbjct: 2433 P-KPTILPKKKLTVASPVTTATPLFDAVTTLETTAVLRSNGLPVTRICTTAPPPVPPKPS 2491 Query: 422 RPTCG------PPVNGPPRMP 466 G P + PP P Sbjct: 2492 SIPSGLVFTHRPEPSKPPIAP 2512 [41][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 59.7 bits (143), Expect = 1e-07 Identities = 46/141 (32%), Positives = 60/141 (42%), Gaps = 17/141 (12%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P G V+ LPA+ P R + + + PPP PPPPP PPPPPPP P PPP + Sbjct: 2377 PSGSPSVSSLPAKPRPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2432 Query: 275 PTRPWALKSLRCRRTSRPWTA----------GWNATVRHT*TP-SRTCCASHPFLPCRPM 421 P +P L + S TA A +R P +R C + P +P +P Sbjct: 2433 P-KPTILPKKKLTVASPVTTATPLFDAVTTLETTAVLRSNGLPVTRICTTAPPPVPPKPS 2491 Query: 422 RPTCG------PPVNGPPRMP 466 G P + PP P Sbjct: 2492 SIPSGLVFTHRPEPSKPPIAP 2512 [42][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 59.7 bits (143), Expect = 1e-07 Identities = 40/103 (38%), Positives = 46/103 (44%), Gaps = 3/103 (2%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPPLPPPP PP P+PPP +P P L + P +R+ P Sbjct: 1217 PPPPPPPPPLPPPPSPPPPPPSPPPPSPPPPPPWWMLEWAALNPPGPPVVFDPIRNPNWP 1276 Query: 374 SRTCC--ASHPFLPCRPMRPT-CGPPVNGPPRMPPRWDSAMPR 493 P P P+RP N PP PPR DS PR Sbjct: 1277 DFEFVDGEESPPPPPPPVRPVPASGSSNAPPPPPPR-DSDAPR 1318 [43][TOP] >UniRef100_A6NG74 Putative uncharacterized protein PCLO n=2 Tax=Homo sapiens RepID=A6NG74_HUMAN Length = 5073 Score = 59.7 bits (143), Expect = 1e-07 Identities = 46/141 (32%), Positives = 60/141 (42%), Gaps = 17/141 (12%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P G V+ LPA+ P R + + + PPP PPPPP PPPPPPP P PPP + Sbjct: 2308 PSGSPSVSSLPAKPRPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2363 Query: 275 PTRPWALKSLRCRRTSRPWTA----------GWNATVRHT*TP-SRTCCASHPFLPCRPM 421 P +P L + S TA A +R P +R C + P +P +P Sbjct: 2364 P-KPTILPKKKLTVASPVTTATPLFDAVTTLETTAVLRSNGLPVTRICTTAPPPVPPKPS 2422 Query: 422 RPTCG------PPVNGPPRMP 466 G P + PP P Sbjct: 2423 SIPSGLVFTHRPEPSKPPIAP 2443 [44][TOP] >UniRef100_Q9Y6V0-2 Isoform 2 of Protein piccolo n=1 Tax=Homo sapiens RepID=Q9Y6V0-2 Length = 4866 Score = 59.7 bits (143), Expect = 1e-07 Identities = 46/141 (32%), Positives = 60/141 (42%), Gaps = 17/141 (12%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P G V+ LPA+ P R + + + PPP PPPPP PPPPPPP P PPP + Sbjct: 2308 PSGSPSVSSLPAKPRPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2363 Query: 275 PTRPWALKSLRCRRTSRPWTA----------GWNATVRHT*TP-SRTCCASHPFLPCRPM 421 P +P L + S TA A +R P +R C + P +P +P Sbjct: 2364 P-KPTILPKKKLTVASPVTTATPLFDAVTTLETTAVLRSNGLPVTRICTTAPPPVPPKPS 2422 Query: 422 RPTCG------PPVNGPPRMP 466 G P + PP P Sbjct: 2423 SIPSGLVFTHRPEPSKPPIAP 2443 [45][TOP] >UniRef100_Q9Y6V0 Protein piccolo n=1 Tax=Homo sapiens RepID=PCLO_HUMAN Length = 5183 Score = 59.7 bits (143), Expect = 1e-07 Identities = 46/141 (32%), Positives = 60/141 (42%), Gaps = 17/141 (12%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P G V+ LPA+ P R + + + PPP PPPPP PPPPPPP P PPP + Sbjct: 2308 PSGSPSVSSLPAKPRPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2363 Query: 275 PTRPWALKSLRCRRTSRPWTA----------GWNATVRHT*TP-SRTCCASHPFLPCRPM 421 P +P L + S TA A +R P +R C + P +P +P Sbjct: 2364 P-KPTILPKKKLTVASPVTTATPLFDAVTTLETTAVLRSNGLPVTRICTTAPPPVPPKPS 2422 Query: 422 RPTCG------PPVNGPPRMP 466 G P + PP P Sbjct: 2423 SIPSGLVFTHRPEPSKPPIAP 2443 [46][TOP] >UniRef100_Q84ZL0-2 Isoform 2 of Formin-like protein 5 n=1 Tax=Oryza sativa Japonica Group RepID=Q84ZL0-2 Length = 1627 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/113 (34%), Positives = 51/113 (45%), Gaps = 18/113 (15%) Frame = +2 Query: 185 RRRPPPMPPPPPLPPPPPPP-----HSLPTPPPLAPTRPWALKSLRCRRTSRP------- 328 +++PPP PPPPPLPPPPPPP S+P PPP P + ++ RT P Sbjct: 850 KQQPPPPPPPPPLPPPPPPPASSGLSSIPPPPPPPPLMSFGAQT----RTFVPPPPPPPP 905 Query: 329 ---WTAGWNATVRHT*TPSRT---CCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 G N P R+ + P P P++P+ G P PP PP Sbjct: 906 PPRSGVGGNTPPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPP 958 [47][TOP] >UniRef100_Q84ZL0 Formin-like protein 5 n=1 Tax=Oryza sativa Japonica Group RepID=FH5_ORYSJ Length = 1627 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/113 (34%), Positives = 51/113 (45%), Gaps = 18/113 (15%) Frame = +2 Query: 185 RRRPPPMPPPPPLPPPPPPP-----HSLPTPPPLAPTRPWALKSLRCRRTSRP------- 328 +++PPP PPPPPLPPPPPPP S+P PPP P + ++ RT P Sbjct: 850 KQQPPPPPPPPPLPPPPPPPASSGLSSIPPPPPPPPLMSFGAQT----RTFVPPPPPPPP 905 Query: 329 ---WTAGWNATVRHT*TPSRT---CCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 G N P R+ + P P P++P+ G P PP PP Sbjct: 906 PPRSGVGGNTPPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPP 958 [48][TOP] >UniRef100_A7NJW8 Peptidase dimerisation domain protein n=1 Tax=Roseiflexus castenholzii DSM 13941 RepID=A7NJW8_ROSCS Length = 456 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/63 (44%), Positives = 36/63 (57%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 +L + L L D L IPS+SAL HA DV+ A EW A + G + ++L GGHP Sbjct: 6 YLREQQDRFLAELLDFLHIPSVSALPEHAGDVQRAAEWVAERMRTAGIESVQILPTGGHP 65 Query: 517 VVY 525 VVY Sbjct: 66 VVY 68 [49][TOP] >UniRef100_A5UT66 Peptidase dimerisation domain protein n=1 Tax=Roseiflexus sp. RS-1 RepID=A5UT66_ROSS1 Length = 475 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/63 (44%), Positives = 35/63 (55%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 +L + L L D L IPS+SAL HA DV A EW A + G + ++L GGHP Sbjct: 6 YLNEQQDRFLAELLDFLHIPSVSALPEHAADVHRAAEWVAERMRAAGIESVQILPTGGHP 65 Query: 517 VVY 525 VVY Sbjct: 66 VVY 68 [50][TOP] >UniRef100_B0MXU9 Putative uncharacterized protein n=1 Tax=Alistipes putredinis DSM 17216 RepID=B0MXU9_9BACT Length = 454 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/66 (45%), Positives = 41/66 (62%) Frame = +1 Query: 328 VDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENG 507 V ++E+++ L+ L +LLRIPSISA S H PD+ EW AA G +AEVL Sbjct: 4 VKSYIEKNKDRFLNELFELLRIPSISAQSDHKPDMTRCAEWLAASLMKAGADHAEVLPTE 63 Query: 508 GHPVVY 525 G+PVV+ Sbjct: 64 GNPVVF 69 [51][TOP] >UniRef100_Q4YEI4 Putative uncharacterized protein (Fragment) n=1 Tax=Plasmodium berghei RepID=Q4YEI4_PLABE Length = 182 Score = 59.3 bits (142), Expect = 2e-07 Identities = 54/142 (38%), Positives = 59/142 (41%), Gaps = 6/142 (4%) Frame = +2 Query: 83 RGSGPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMP-PPPPLPPPPPPPHSLPT 259 R + P GGG PAR A R R RRR PP P PPPP PP P +P Sbjct: 50 RPARPPPGGGAPPRPARGGRRPRAPPPR----RPRRRAPPRPTPPPPRPPATLRPPPVPP 105 Query: 260 PPPLAPTRPWALKSLRCR-----RTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMR 424 PP LAP P A + R R R P+TAG A R P CA RP Sbjct: 106 PPRLAPPSP-ARRGPRPRPGCPPRPRPPYTAGAAAPPRR---PRPRLCAPRTGAAARPRP 161 Query: 425 PTCGPPVNGPPRMPPRWDSAMP 490 P GPP PP P + P Sbjct: 162 P--GPPPPPPPVARPPAPRSQP 181 [52][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPPLPPPPPPP LP PPP P P Sbjct: 1215 PPPPPPPPPLPPPPPPPPPLPPPPPPPPPPP 1245 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/32 (71%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = +2 Query: 194 PPPM-PPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP+ PPPPPLPPPPPPP LP PPP P P Sbjct: 1204 PPPLTPPPPPLPPPPPPPPPLPPPPPPPPPLP 1235 [53][TOP] >UniRef100_Q9VEP4 CG5225 n=2 Tax=Drosophila melanogaster RepID=Q9VEP4_DROME Length = 594 Score = 50.8 bits (120), Expect(2) = 2e-07 Identities = 22/38 (57%), Positives = 23/38 (60%), Gaps = 10/38 (26%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLP----------TPPPLAP 277 PPP PPPPP PPPPPPPHS P TPP + P Sbjct: 155 PPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVP 192 Score = 28.1 bits (61), Expect(2) = 2e-07 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 117 PYCPPGAGRVALLSCGAGSSGGRGGDHHRCHHHHH 221 P PPG L G G G H HHHHH Sbjct: 123 PIGPPG------LPGPPGHKSGHGHHDHHDHHHHH 151 [54][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 55.1 bits (131), Expect(2) = 2e-07 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P+ P Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 23.9 bits (50), Expect(2) = 2e-07 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 348 PPSDTPRRPQGPAAHPIHF 404 PPS P P+GP+ P +F Sbjct: 264 PPSPNPPPPKGPSPTPNNF 282 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 [55][TOP] >UniRef100_UPI0000F3115A fms-related tyrosine kinase 3 ligand n=2 Tax=Bos taurus RepID=UPI0000F3115A Length = 1858 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/98 (35%), Positives = 42/98 (42%) Frame = +2 Query: 191 RPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*T 370 +PPP PPP P P PPPPP +LP+PPPL P + + P A Sbjct: 1270 KPPPSPPPAPTPQPPPPPPALPSPPPLVTPAPSSPPQPQPPPPPPPPAPALPA------L 1323 Query: 371 PSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSA 484 PS P P P P PP PP+ PP +A Sbjct: 1324 PS-------PPAPVPPPPPPPPPPATAPPKTPPEEPAA 1354 [56][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 58.9 bits (141), Expect = 2e-07 Identities = 46/141 (32%), Positives = 61/141 (43%), Gaps = 17/141 (12%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P G V+ LPA+ P R + + + PPP PPPPP PPPPPPP P PPP + Sbjct: 2315 PSGSPSVSSLPAKPRPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2370 Query: 275 PTRPWALKSLRCR-----RTSRP-----WTAGWNATVRHT*TP-SRTCCASHPFLPCRPM 421 P +P L + T+ P T A +R P +R C + P +P +P Sbjct: 2371 P-KPTILPKKKLTVAAPVTTATPLFDAVTTLETTAVLRSNGLPVTRICTTAPPPVPPKPS 2429 Query: 422 RPTCG------PPVNGPPRMP 466 G P + PP P Sbjct: 2430 SIPSGLVFTHRPEPSKPPIAP 2450 [57][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 58.9 bits (141), Expect = 2e-07 Identities = 46/141 (32%), Positives = 61/141 (43%), Gaps = 17/141 (12%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P G V+ LPA+ P R + + + PPP PPPPP PPPPPPP P PPP + Sbjct: 1253 PSGSPSVSSLPAKPRPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 1308 Query: 275 PTRPWALKSLRCR-----RTSRP-----WTAGWNATVRHT*TP-SRTCCASHPFLPCRPM 421 P +P L + T+ P T A +R P +R C + P +P +P Sbjct: 1309 P-KPTILPKKKLTVAAPVTTATPLFDAVTTLETTAVLRSNGLPVTRICTTAPPPVPPKPS 1367 Query: 422 RPTCG------PPVNGPPRMP 466 G P + PP P Sbjct: 1368 SIPSGLVFTHRPEPSKPPIAP 1388 [58][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 58.9 bits (141), Expect = 2e-07 Identities = 46/141 (32%), Positives = 61/141 (43%), Gaps = 17/141 (12%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P G V+ LPA+ P R + + + PPP PPPPP PPPPPPP P PPP + Sbjct: 2315 PSGSPSVSSLPAKPRPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2370 Query: 275 PTRPWALKSLRCR-----RTSRP-----WTAGWNATVRHT*TP-SRTCCASHPFLPCRPM 421 P +P L + T+ P T A +R P +R C + P +P +P Sbjct: 2371 P-KPTILPKKKLTVAAPVTTATPLFDAVTTLETTAVLRSNGLPVTRICTTAPPPVPPKPS 2429 Query: 422 RPTCG------PPVNGPPRMP 466 G P + PP P Sbjct: 2430 SIPSGLVFTHRPEPSKPPIAP 2450 [59][TOP] >UniRef100_Q82IQ8 Putative peptidase n=1 Tax=Streptomyces avermitilis RepID=Q82IQ8_STRAW Length = 467 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/68 (44%), Positives = 39/68 (57%) Frame = +1 Query: 322 TAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLE 501 +AV +++ HR LD L + LRIPS+SA HA DVR + +W AA GF AEV Sbjct: 7 SAVRTYIDSHRAVFLDDLAEWLRIPSVSAQPDHAADVRRSADWLAAKLKETGFPTAEVWA 66 Query: 502 NGGHPVVY 525 G P V+ Sbjct: 67 TPGAPAVF 74 [60][TOP] >UniRef100_Q1IQK0 Peptidase M20 n=1 Tax=Candidatus Koribacter versatilis Ellin345 RepID=Q1IQK0_ACIBL Length = 459 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/68 (41%), Positives = 39/68 (57%) Frame = +1 Query: 322 TAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLE 501 +A G+ ++ L+ LK LLRIPS+S H DVR A + A +GF N +V+E Sbjct: 3 SAAVGYARENQSRFLEELKALLRIPSVSTAEEHKDDVRKAANFVAEELKRIGFENVQVIE 62 Query: 502 NGGHPVVY 525 GHP+VY Sbjct: 63 TKGHPLVY 70 [61][TOP] >UniRef100_B7PLD9 Circumsporozoite protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PLD9_IXOSC Length = 188 Score = 58.9 bits (141), Expect = 2e-07 Identities = 42/118 (35%), Positives = 48/118 (40%), Gaps = 14/118 (11%) Frame = +2 Query: 158 LRRWLVGRARRRP------PPMPPPPPLPPPPPPPHSLPTPP--------PLAPTRPWAL 295 + R +V R RR+P PP PPPPP PPPPPPP P PP P+ P Sbjct: 10 VNRRVVRRRRRKPRSETPPPPPPPPPPPPPPPPPPPPPPAPPSETTIIEVPVPMPFPVPA 69 Query: 296 KSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 RCRR P + + PS S P P PP PP MPP Sbjct: 70 PPRRCRRPPPPPCRQPSIVILAPPAPSPPPPPSFLIPP-----PIMAPPFMMPPFMPP 122 [62][TOP] >UniRef100_A9V3V4 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V3V4_MONBE Length = 2296 Score = 58.9 bits (141), Expect = 2e-07 Identities = 47/152 (30%), Positives = 55/152 (36%) Frame = +2 Query: 71 RGPRRGSGPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHS 250 RGP S GGG V+ P R R+ L G + PP PPP PPPPPPP + Sbjct: 2068 RGPEALSATNGGGAVSQTPVERQEERATTLAS---GTSSPPPPAATSPPPPPPPPPPPPA 2124 Query: 251 LPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPT 430 +PPP P P A A+ P A+ P P P P Sbjct: 2125 AASPPPPPPPPPAA------------------ASPPPPPPPPPPLVAASP--PPPPPPPP 2164 Query: 431 CGPPVNGPPRMPPRWDSAMPRCSRTVATQSSM 526 PPV P PP T +Q M Sbjct: 2165 PPPPVAAPAPSPPPSPPVASALPETAVSQQPM 2196 [63][TOP] >UniRef100_Q02CS1 Peptidase M20 n=1 Tax=Candidatus Solibacter usitatus Ellin6076 RepID=Q02CS1_SOLUE Length = 458 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/67 (40%), Positives = 40/67 (59%) Frame = +1 Query: 325 AVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLEN 504 A D ++ +++ L+ LK LRIPSIS L + PDV A E+ A + G N E+++ Sbjct: 4 ATDSFVNQNQARLLEELKQFLRIPSISTLPENRPDVERAAEFVAGALRTAGMENVELIQT 63 Query: 505 GGHPVVY 525 GHP+VY Sbjct: 64 AGHPLVY 70 [64][TOP] >UniRef100_A8ITW8 Dicer-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8ITW8_CHLRE Length = 3556 Score = 58.5 bits (140), Expect = 3e-07 Identities = 35/77 (45%), Positives = 37/77 (48%), Gaps = 6/77 (7%) Frame = +2 Query: 74 GPRRGSGPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPP-PPHS 250 G G G GGG A+ A R V A PPP+PPPPPLPPPPP PPH Sbjct: 2486 GNNSGDGGGGGRDEAMADANRD-----------VPSAPPPPPPLPPPPPLPPPPPLPPHL 2534 Query: 251 L-----PTPPPLAPTRP 286 P PPPL P P Sbjct: 2535 THQPPPPPPPPLPPPPP 2551 [65][TOP] >UniRef100_A8IDJ1 Scavenger receptor cysteine-rich protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8IDJ1_CHLRE Length = 389 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRP 328 PPP PPPPP PPPPPPP ++P PPPL P LR S P Sbjct: 50 PPPPPPPPPPPPPPPPPRAVPLPPPLVVRAPAREGDLRLVNGSSP 94 [66][TOP] >UniRef100_Q4DD51 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi RepID=Q4DD51_TRYCR Length = 603 Score = 58.5 bits (140), Expect = 3e-07 Identities = 42/121 (34%), Positives = 50/121 (41%), Gaps = 17/121 (14%) Frame = +2 Query: 182 ARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRH 361 A PPP PPPPP PPPPPPP + PPP P P KS++ P ++ Sbjct: 379 ALEAPPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPP-PPPPAMMMKT 437 Query: 362 T*TPSRTCCASHP----------FLPCRPMRPTCGPP-------VNGPPRMPPRWDSAMP 490 P+RT A P LP P+ P GPP + PP PP P Sbjct: 438 AVQPARTMTAIPPPPPPLSAEAAPLPISPIAP--GPPAARSLPKLGNPPPAPPLPPPPPP 495 Query: 491 R 493 R Sbjct: 496 R 496 [67][TOP] >UniRef100_UPI0001B58635 hypothetical protein StAA4_25414 n=1 Tax=Streptomyces sp. AA4 RepID=UPI0001B58635 Length = 326 Score = 58.2 bits (139), Expect = 4e-07 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP + P PPP++P P Sbjct: 242 PPPPPPPPPTPPPPPPPVTAPPPPPVSPPPP 272 [68][TOP] >UniRef100_B9XS95 Peptidase M20 n=1 Tax=bacterium Ellin514 RepID=B9XS95_9BACT Length = 475 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = +1 Query: 373 LKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHPVVY 525 L + +RIPS+S + A DV+ A EW AA+ +LG +NA+V+ GGHPVVY Sbjct: 31 LHEFIRIPSLSGDPARAGDVKRAAEWLAAHLHALGIKNAKVMPTGGHPVVY 81 [69][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 58.2 bits (139), Expect = 4e-07 Identities = 43/119 (36%), Positives = 49/119 (41%), Gaps = 12/119 (10%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRC-----RRTSRPWTAGWNATVR 358 PPP PPPPP PPPPPPP P PPP P P KS+ S P G V Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLIEEAQSSPALGGCRRPVM 558 Query: 359 HT*TPSRTCCASHPFLPCRPMRPTC---GPPVNGPPRMPPRWDSA----MPRCSRTVAT 514 T S T P C GP + PP +PP S+ + CS + AT Sbjct: 559 ---TVSITSHIPRPIPEHSSGGEGCSHKGPSPSPPPLLPPGSSSSAVGGVASCSSSSAT 614 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 [70][TOP] >UniRef100_A8MSW5 Putative uncharacterized protein TNRC18 n=1 Tax=Homo sapiens RepID=A8MSW5_HUMAN Length = 1308 Score = 58.2 bits (139), Expect = 4e-07 Identities = 48/146 (32%), Positives = 53/146 (36%) Frame = +2 Query: 68 RRGPRRGSGPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPH 247 R+ PR+ + GGG LPA P RPPP PP PP PPPPPP Sbjct: 1099 RKDPRKKNRSNPGGGGCTLPAPGRP---------------HRPPPPPPHPPPPPPPPPHP 1143 Query: 248 SLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRP 427 LP PP P P L L RP H P P P P Sbjct: 1144 PLPPPPLPPPPLPLRLPPLPPPPLPRP----------HPPPPP-------PLPPLLPPPQ 1186 Query: 428 TCGPPVNGPPRMPPRWDSAMPRCSRT 505 T P R PP A+PR R+ Sbjct: 1187 TRTLPAARTMRQPPPPRLALPRRRRS 1212 [71][TOP] >UniRef100_B2AKS1 Translation initiation factor IF-2 n=1 Tax=Podospora anserina RepID=B2AKS1_PODAN Length = 1038 Score = 58.2 bits (139), Expect = 4e-07 Identities = 39/115 (33%), Positives = 48/115 (41%), Gaps = 8/115 (6%) Frame = +2 Query: 179 RARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPT-----RPWALKSLRCRRTSRPWTAGW 343 RA + PPP PPPPP PPPPPP S P PPP P +P + + R+S P+ Sbjct: 117 RAPKPPPPPPPPPPPPPPPPPKASTPPPPPPPPPPPRQWQPSPARDQKSERSSTPFQFSR 176 Query: 344 NATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNG---PPRMPPRWDSAMPRCS 499 + P F P RPT PP + P P W + R S Sbjct: 177 HKNYNPADKPFFNPSDRPTFNPSD--RPTFNPPPSSQSTPSNPFPEWANLTRRRS 229 [72][TOP] >UniRef100_B3NTG0 GG18108 n=1 Tax=Drosophila erecta RepID=B3NTG0_DROER Length = 1373 Score = 52.0 bits (123), Expect(2) = 4e-07 Identities = 21/40 (52%), Positives = 27/40 (67%) Frame = +2 Query: 188 RRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLR 307 R PPP+ PPPP PPPPPPP P PPP +P + + ++ R Sbjct: 1048 RPPPPLQPPPPPPPPPPPP---PPPPPPSPPQMYPMRQQR 1084 Score = 25.8 bits (55), Expect(2) = 4e-07 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +3 Query: 321 HGRGRLAGTPPS--DTPRRPQGPAAHPIH 401 HGRGR+ G PS + P G H +H Sbjct: 1116 HGRGRVNGPSPSRGALSQNPYGQMTHALH 1144 [73][TOP] >UniRef100_B3P3J0 GG21917 n=1 Tax=Drosophila erecta RepID=B3P3J0_DROER Length = 573 Score = 50.1 bits (118), Expect(2) = 4e-07 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPP 268 PPP PPPPP PPPPPPP S P P P Sbjct: 154 PPPPPPPPPPPPPPPPPPSYPHPHP 178 Score = 27.7 bits (60), Expect(2) = 4e-07 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 75 GPVGVPALVAAAE*PYCPPGAGRVALLSCGAGSSGGRGGDHHRCHHHH 218 GP+G P L PPG SG DHH HHHH Sbjct: 120 GPIGPPGLPG-------PPGL-----------KSGHGHHDHHDYHHHH 149 Score = 48.1 bits (113), Expect(2) = 7e-06 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPP + P P P P P Sbjct: 156 PPPPPPPPPPPPPPPPSYPHPHPHPHHPPPP 186 Score = 25.4 bits (54), Expect(2) = 7e-06 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 117 PYCPPGAGRVALLSCGAGSSGGRGGDHHRCHHHHH 221 P PPG L G G G H +HHHH Sbjct: 121 PIGPPG------LPGPPGLKSGHGHHDHHDYHHHH 149 [74][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 57.8 bits (138), Expect = 5e-07 Identities = 35/102 (34%), Positives = 41/102 (40%), Gaps = 10/102 (9%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPP P PPPPPPP P PPP P P C + P + G+ R P Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTSCGFGCHYRDRLLP 431 Query: 374 SRTCCASHPFLPCRP----------MRPTCGPPVNGPPRMPP 469 + T L C P + T PP P +PP Sbjct: 432 TLTYPCDTCTLICLPGCEQSCCKTKNQQTIFPPAPTMPVLPP 473 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP S P PPP P P Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 391 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P+PPP P P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 388 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 390 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 362 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 392 [75][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/61 (44%), Positives = 33/61 (54%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P G ++ LP + P R V + + PPP PPPPP PPPPPPP P PPP + Sbjct: 2318 PSGSPSLSSLPTKTRPF----FRSSSVDASAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2373 Query: 275 P 277 P Sbjct: 2374 P 2374 [76][TOP] >UniRef100_Q9Q5L3 EBNA-2 n=1 Tax=Macacine herpesvirus 4 RepID=Q9Q5L3_9GAMA Length = 605 Score = 57.8 bits (138), Expect = 5e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPPLPPPPPPP P PPP+ P P Sbjct: 65 PPPPPPPPPLPPPPPPPLPPPPPPPVQPPPP 95 [77][TOP] >UniRef100_Q2W222 RTX toxins and related Ca2+-binding protein n=1 Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W222_MAGSA Length = 1274 Score = 57.8 bits (138), Expect = 5e-07 Identities = 30/72 (41%), Positives = 34/72 (47%) Frame = +2 Query: 71 RGPRRGSGPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHS 250 +G +G+G GGG AV+ P PPP PPPPP PPPP PP Sbjct: 251 KGAGQGAGAGGGAEAAVVDVAPPPPPP--------------PPPPPPPPPPPPPPSPPAP 296 Query: 251 LPTPPPLAPTRP 286 P PPP AP P Sbjct: 297 APPPPPPAPPPP 308 [78][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 57.8 bits (138), Expect = 5e-07 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = +2 Query: 167 WLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 W + PPP PPPPP PPPPPPP S P PPP +P P Sbjct: 477 WFLRSGGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPP 516 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 53.5 bits (127), Expect = 9e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPT 280 PPP PPPPP PPPPPPP P PPP P+ Sbjct: 509 PPPSPPPPPPPPPPPPPPPPPPPPPPGPS 537 [79][TOP] >UniRef100_C6VWB4 Peptidase M20 n=1 Tax=Dyadobacter fermentans DSM 18053 RepID=C6VWB4_DYAFD Length = 453 Score = 57.8 bits (138), Expect = 5e-07 Identities = 29/63 (46%), Positives = 37/63 (58%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 ++E+HR L+ L DLLRIPS+SA S PD+ A E+ G AE+ E GHP Sbjct: 4 YIEKHRDRFLNELLDLLRIPSVSADSKFKPDMLKAAEYVRDRIAEAGADRAEIFETEGHP 63 Query: 517 VVY 525 VVY Sbjct: 64 VVY 66 [80][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 57.8 bits (138), Expect = 5e-07 Identities = 37/102 (36%), Positives = 44/102 (43%), Gaps = 2/102 (1%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPP P PPPPPPP P PPP P P + S P + + +P Sbjct: 117 PPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSP 176 Query: 374 SRTCCASHPFL--PCRPMRPTCGPPVNGPPRMPPRWDSAMPR 493 + S P P P P PP + PPR PP + PR Sbjct: 177 PPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPR 218 Score = 57.4 bits (137), Expect = 6e-07 Identities = 35/92 (38%), Positives = 39/92 (42%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP+PPPPP PPPPPPP S P PPP P P S P P Sbjct: 92 PPPVPPPPPPPPPPPPPPSPPPPPPPPPPPP----------PSPP-----------PPPP 130 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 +P P P P+ PP + PP PP Sbjct: 131 PPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP 162 Score = 57.0 bits (136), Expect = 8e-07 Identities = 35/92 (38%), Positives = 40/92 (43%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP P PPPPP P PPP P P S P + + +P Sbjct: 113 PPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSP 172 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 + S P P P RP PP + PP PP Sbjct: 173 PPSPPPSPP--PSPPPRPPPSPPPSPPPSPPP 202 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/96 (37%), Positives = 41/96 (42%), Gaps = 3/96 (3%) Frame = +2 Query: 191 RPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*T 370 RPPP PPPPLPPPP PP LP PP P P P + + R Sbjct: 255 RPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSP-------------PPPSPLPPSPR---- 297 Query: 371 PSRTCCASHPF---LPCRPMRPTCGPPVNGPPRMPP 469 P + ++PF P P P PP PPR PP Sbjct: 298 PPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPP 333 [81][TOP] >UniRef100_C1N5J8 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N5J8_9CHLO Length = 848 Score = 57.8 bits (138), Expect = 5e-07 Identities = 35/75 (46%), Positives = 35/75 (46%), Gaps = 20/75 (26%) Frame = -2 Query: 234 GGGGSGGGGGIGGGRRRARPTSQRRN*AERHGQRR----------AGNTAT--------- 112 GGGG GGGGG GGG RA P Q AER RR G T T Sbjct: 661 GGGGGGGGGGGGGGDSRAAPAWQSEGKAERERSRRRERRPERREPPGATTTKASDDDDEV 720 Query: 111 -PPPPPGPEPRRGPR 70 PPPPP P PR GPR Sbjct: 721 DPPPPPPPPPRAGPR 735 [82][TOP] >UniRef100_C0SUI0 Ecdysone receptor B1 isoform (Fragment) n=1 Tax=Anterhynchium flavomarginatum RepID=C0SUI0_9HYME Length = 263 Score = 57.8 bits (138), Expect = 5e-07 Identities = 30/70 (42%), Positives = 38/70 (54%), Gaps = 8/70 (11%) Frame = -2 Query: 345 FQPAVHGREVRRQRSDFSAHGRVGASGGGVGRE*GGGGGGGSGGGGGIGGG--------R 190 FQP V GR+ Q + +G G GGG G GGGGGGG GGGGG GG R Sbjct: 141 FQPTVEGRDELSQPGSLNGYGSGGGGGGGGGGGGGGGGGGGGGGGGGGAGGGGSDGCDAR 200 Query: 189 RRARPTSQRR 160 ++ PT +++ Sbjct: 201 KKKGPTPRQQ 210 [83][TOP] >UniRef100_Q7SC01 Putative uncharacterized protein n=1 Tax=Neurospora crassa RepID=Q7SC01_NEUCR Length = 1395 Score = 57.8 bits (138), Expect = 5e-07 Identities = 38/98 (38%), Positives = 43/98 (43%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 P P PPPPP PPPPPPP P PPP+ P P + RP A RH P Sbjct: 327 PIPTPPPPPPPPPPPPP---PPPPPIPPQLP---PQVSAHIPPRPEVA------RHASVP 374 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAM 487 S T LP P PP PP +PP +A+ Sbjct: 375 SPT-----TQLPPVRSSPAPLPPTTLPPTLPPTTTAAL 407 [84][TOP] >UniRef100_B4PM92 GE24601 n=1 Tax=Drosophila yakuba RepID=B4PM92_DROYA Length = 595 Score = 50.1 bits (118), Expect(2) = 5e-07 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPPH P P P P P Sbjct: 157 PPPPPPPPPPPPPPPPPH--PHPHPHHPQPP 185 Score = 27.3 bits (59), Expect(2) = 5e-07 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +3 Query: 51 HYDVLNGGGPVGVPALVAAAE*PYCPPGAGRVALLSCGAGSSGGRGGDHHRCHHHHH 221 HY + G G P P PPG L G G H HHHHH Sbjct: 109 HYGLPGQPGQPGQPG-------PIGPPG------LPGPPSHKSGHGHHDHHDHHHHH 152 [85][TOP] >UniRef100_UPI0001A7B3C7 unknown protein n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B3C7 Length = 530 Score = 57.4 bits (137), Expect = 6e-07 Identities = 37/97 (38%), Positives = 45/97 (46%) Frame = +2 Query: 179 RARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVR 358 R + PPP PP P PPPPPP + TPPP P P R T+ P T + + Sbjct: 50 RTPKTPPPPPPRTPRTPPPPPPRTPRTPPPPPPRTP------RTPPTAPPRTPPVSPRIP 103 Query: 359 HT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 P +T + P P P+ P PP N PPR PP Sbjct: 104 PI-LPPKTPPTAPPQTP--PVSPPKSPP-NSPPRAPP 136 Score = 54.3 bits (129), Expect = 5e-06 Identities = 38/103 (36%), Positives = 46/103 (44%), Gaps = 6/103 (5%) Frame = +2 Query: 179 RARRRPPPMPPP------PPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAG 340 RA PPP PP PPL PP PP+S P PP +P R + R T+ P Sbjct: 197 RAPPVPPPNTPPTSPPRAPPLSPPRTPPNSPPRTPPTSPPRAPPVPPPRISPTAPPRAPP 256 Query: 341 WNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 + +P RT S P P P P PP++ PPR PP Sbjct: 257 LSPPRTPPTSPPRTPPLSPPITP--PTSPPRAPPLS-PPRTPP 296 Score = 54.3 bits (129), Expect = 5e-06 Identities = 37/104 (35%), Positives = 44/104 (42%), Gaps = 11/104 (10%) Frame = +2 Query: 191 RPPPMPPP------PPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNAT 352 R PP+ PP PP PP PPP + PT PPL+P P S P Sbjct: 301 RAPPISPPRTPPSSPPRAPPMPPPRTPPTSPPLSPLSP--------PPRSPPMPPTRTPP 352 Query: 353 VRHT*TPSRTCCASHPFLP--CRPMRPTCGPPV---NGPPRMPP 469 V +PSRT + P P P P PP+ N PP+ PP Sbjct: 353 VSPPTSPSRTPPVTPPRAPPTAPPQTPPVSPPIVPPNSPPKRPP 396 Score = 53.5 bits (127), Expect = 9e-06 Identities = 36/95 (37%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +2 Query: 191 RPPPMPPP--PPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT 364 + PP PP PP+ PP PP+S P PPL+P R R S P T + Sbjct: 109 KTPPTAPPQTPPVSPPKSPPNSPPRAPPLSPPRTPPTSPPRVPPLSPPRTPPTSPPRAPP 168 Query: 365 *TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 P RT S P P P+ P PP + PPR PP Sbjct: 169 IPPPRTPSTSPPRAP--PLSPPRTPPTS-PPRAPP 200 Score = 53.5 bits (127), Expect = 9e-06 Identities = 41/108 (37%), Positives = 44/108 (40%), Gaps = 8/108 (7%) Frame = +2 Query: 191 RPPPMPPP--PPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT 364 R PP PP PPL PP PP S P PPL+P R R S P T + Sbjct: 261 RTPPTSPPRTPPLSPPITPPTSPPRAPPLSPPRTPPTSPPRAPPISPPRTPPSSPPRAPP 320 Query: 365 *TPSRTCCASHPFLPCR------PMRPTCGPPVNGPPRMPPRWDSAMP 490 P RT S P P PM PT PPV+ PP P R P Sbjct: 321 MPPPRTPPTSPPLSPLSPPPRSPPMPPTRTPPVS-PPTSPSRTPPVTP 367 [86][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 57.4 bits (137), Expect = 6e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP PTPPP P P Sbjct: 97 PPPPPPPPPPPPPPPPPTPPPTPPPTPPPTP 127 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPP PPP PTPPP P P Sbjct: 105 PPPPPPPPPTPPPTPPPTPPPTPPPTPPPTP 135 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 191 RPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 +PPP PPPPP PPPPPPP PTPPP P P Sbjct: 95 QPPPPPPPPPPPPPPPPP---PTPPPTPPPTP 123 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPP PPP PTPPP P P Sbjct: 101 PPPPPPPPPPPPPTPPPTPPPTPPPTPPPTP 131 [87][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +2 Query: 176 GRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 G A PPP PPPPP PPPPPPP P PPP PT P Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 57.0 bits (136), Expect = 8e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP PTPPP P P Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 1415 PPPPPPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 [88][TOP] >UniRef100_C9Z517 Putative secreted proline-rich protein n=1 Tax=Streptomyces scabiei 87.22 RepID=C9Z517_STRSC Length = 211 Score = 57.4 bits (137), Expect = 6e-07 Identities = 47/138 (34%), Positives = 49/138 (35%) Frame = +2 Query: 92 GPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPL 271 GPGGGG VAV C PPP PPPPP P P PP PTP P Sbjct: 48 GPGGGGAVAVAVGGTDSCEPT-------------PPPPPPPPPTPSPSCPPEPPPTPAP- 93 Query: 272 APTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNG 451 P RP RP PS T P P RPT PP Sbjct: 94 -PPRP------------RP--------------PSPTPTPDPAPDPPPPPRPTPAPPRKA 126 Query: 452 PPRMPPRWDSAMPRCSRT 505 P PP + PR + T Sbjct: 127 APPPPPPPVTQTPRPAPT 144 [89][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 57.4 bits (137), Expect = 6e-07 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP+ P+PPP P+ P Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 [90][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 57.4 bits (137), Expect = 6e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPPL P+ P Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 57.4 bits (137), Expect = 6e-07 Identities = 23/32 (71%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPH-SLPTPPPLAPTRP 286 PPP PPPPP PPPPPPPH P+PPPL P P Sbjct: 686 PPPPPPPPPPPPPPPPPHPPPPSPPPLVPALP 717 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP+PPPPP PPPPPPP P PPP P P Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 55.1 bits (131), Expect = 3e-06 Identities = 35/101 (34%), Positives = 37/101 (36%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PPP P P L +P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP----------------------SP 679 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMPRC 496 P P P P PP PP PP + P C Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPPSC 720 Score = 54.3 bits (129), Expect = 5e-06 Identities = 35/99 (35%), Positives = 37/99 (37%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PPP P P L P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP--------------- 683 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMP 490 P P P P PP + PP PP A+P Sbjct: 684 -----PPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALP 717 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPLPPPPPPP P PPP P P Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 [91][TOP] >UniRef100_C1N0J8 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N0J8_9CHLO Length = 2933 Score = 57.4 bits (137), Expect = 6e-07 Identities = 36/95 (37%), Positives = 40/95 (42%) Frame = +2 Query: 197 PPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPS 376 PP PPPPP PPPPP P P PPP P P+ + T P + NA Sbjct: 443 PPSPPPPPFPPPPPTPSPPPFPPPEMP--PFTPPGVNNPYTYPPPSPPPNA--------- 491 Query: 377 RTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDS 481 S P P P P PP PP PP WD+ Sbjct: 492 ----PSPPPNPSPPPSPPSPPPPPSPP--PPNWDT 520 [92][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRR 316 PPP PPPPP PPPPPPP P PPP P P +CRR Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPCCEKCRR 125 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 [93][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 57.4 bits (137), Expect = 6e-07 Identities = 37/93 (39%), Positives = 39/93 (41%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP PPP P P P AG H P Sbjct: 141 PPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPP-----AGPPPVAGPPVPPPHP-PP 194 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPR 472 + P P P P PPV GPP PP+ Sbjct: 195 AEPA----PPPPPAPQGPPAPPPVEGPP--PPK 221 [94][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 57.4 bits (137), Expect = 6e-07 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +2 Query: 182 ARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 A+ PPP PPPPP PPPPPPP P PPP A T+P Sbjct: 349 AQAPPPPPPPPPPPPPPPPPPPPPPPPPPPASTKP 383 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWAL 295 PPP PPPPP PPPPPPP P PPP + P AL Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPASTKPPQAL 387 [95][TOP] >UniRef100_UPI0001982977 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982977 Length = 1622 Score = 57.0 bits (136), Expect = 8e-07 Identities = 34/88 (38%), Positives = 35/88 (39%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PP PP PPPPPPP P+PPP P P L L P G Sbjct: 1211 PPPPPPLPPSPPPPPPPPLSPSPPPPPPPFPSQLPPLPPPPAGPPPPTG----------- 1259 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPP 457 P P P PT PP GPP Sbjct: 1260 --------PPPPAGPPPPTVHPPPMGPP 1279 [96][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKS 301 PPP PPPPP PPPPPPP P PPPL T P KS Sbjct: 47 PPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDPKS 82 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +2 Query: 170 LVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 L +A PPP PPPPP PPPPPPP P PPP P P Sbjct: 36 LNNKAEAAPPPPPPPPPPPPPPPPP---PPPPPTPPPPP 71 [97][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKS 301 PPP PPPPP PPPPPPP P PPPL T P KS Sbjct: 47 PPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDPKS 82 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +2 Query: 170 LVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 L +A PPP PPPPP PPPPPPP P PPP P P Sbjct: 36 LNNKAEAAPPPPPPPPPPPPPPPPP---PPPPPTPPPPP 71 [98][TOP] >UniRef100_B5HB29 Peptidase n=1 Tax=Streptomyces pristinaespiralis ATCC 25486 RepID=B5HB29_STRPR Length = 465 Score = 57.0 bits (136), Expect = 8e-07 Identities = 29/67 (43%), Positives = 39/67 (58%) Frame = +1 Query: 325 AVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLEN 504 AV ++++HR LD L + LRIPS+SA H DVR + EW AA + GF AE+ Sbjct: 8 AVRTYIQQHRAAFLDDLAEWLRIPSVSAQPEHDGDVRRSAEWLAAKLSETGFPVAEIWPT 67 Query: 505 GGHPVVY 525 G P V+ Sbjct: 68 PGAPAVF 74 [99][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 57.0 bits (136), Expect = 8e-07 Identities = 35/92 (38%), Positives = 37/92 (40%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P+PPP P P S P P Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP---------PPSPP-------------PP 256 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 S P P P P PP + PP PP Sbjct: 257 PPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPP 288 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P+PPP P P Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 237 [100][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 57.0 bits (136), Expect = 8e-07 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSL 304 PPP PPPPP PPPPPPP P PPPL P P + ++L Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENL 113 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 [101][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 56.6 bits (135), Expect = 1e-06 Identities = 39/105 (37%), Positives = 41/105 (39%), Gaps = 6/105 (5%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSL------PTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATV 355 PPP PPPPP PPPPPPP + P PPP AP P C P Sbjct: 148 PPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPP------ 201 Query: 356 RHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMP 490 P C P PC P C PP PP PP + MP Sbjct: 202 -----PPPPCPLPPPPPPCPPPPAPCPPP---PP--PPACPAPMP 236 [102][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPPL P P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPLLPPPP 457 Score = 55.1 bits (131), Expect = 3e-06 Identities = 38/117 (32%), Positives = 46/117 (39%), Gaps = 10/117 (8%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PP L P P ++ S S P + Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPLLPPPPPPSISSFLVPPQSCPIPCSPQCAP----SC 483 Query: 374 SRTCCASHPFLPCRPM-----RPTCGPPVNGPPRMPPRWD-----SAMPRCSRTVAT 514 S CC+S +P P+ P P P + S P C R +T Sbjct: 484 SENCCSS--LIPSPPVLRMIDTPAFSATTTSPFECSPSCNSICGPSCSPSCCRAEST 538 [103][TOP] >UniRef100_UPI0000F2E472 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2E472 Length = 551 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +2 Query: 173 VGRARRRPP----PMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 V R RPP P PPPPP PPPPPPPH P PPP P P Sbjct: 410 VQSVRSRPPSPAAPSPPPPPPPPPPPPPHMSPLPPPPPPPPP 451 [104][TOP] >UniRef100_UPI0000F21440 PREDICTED: similar to RING finger protein 6 (RING-H2 protein) n=1 Tax=Danio rerio RepID=UPI0000F21440 Length = 691 Score = 56.6 bits (135), Expect = 1e-06 Identities = 40/105 (38%), Positives = 52/105 (49%), Gaps = 9/105 (8%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPP--PLAPTR--PWALKSLRCRRTSRPWTAGWNATVRH 361 P P PPPPP PPPPPPP +PP P P+R P++L+ TSRP T G VR Sbjct: 158 PMPPPPPPPPPPPPPPPVQSASPPTTPYNPSRAAPYSLQHPTPYSTSRP-TLGRRGAVRR 216 Query: 362 T*TPSR-----TCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDS 481 T + + + P +P R PT P + PP+ P + S Sbjct: 217 TRSSTTPPVMPPMTSQAPPMPLRRNLPTL--PSSPPPQAPLAFQS 259 [105][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P RP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [106][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/54 (50%), Positives = 31/54 (57%) Frame = +2 Query: 110 GVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPL 271 G V+ + +PC SA + A PPP PPPPP PPPPPPP P PPPL Sbjct: 436 GRPVIASPSYPCHSAPIPH---AGASLPPPPPPPPPPPPPPPPPPPPPPPPPPL 486 [107][TOP] >UniRef100_UPI00005A0B5E PREDICTED: similar to jumonji domain containing 3 n=1 Tax=Canis lupus familiaris RepID=UPI00005A0B5E Length = 1653 Score = 56.6 bits (135), Expect = 1e-06 Identities = 31/70 (44%), Positives = 36/70 (51%) Frame = +2 Query: 77 PRRGSGPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLP 256 P SGP G G++ RR C S + L PPP+PPPPP PPPPPP L Sbjct: 211 PAALSGPSGDEGLSPGGKRRRGCSSE--QTGLPPGLPLPPPPLPPPPPPPPPPPPLPGLA 268 Query: 257 TPPPLAPTRP 286 T PP T+P Sbjct: 269 TSPPFQLTKP 278 [108][TOP] >UniRef100_UPI0001A2BDC1 UPI0001A2BDC1 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2BDC1 Length = 713 Score = 56.6 bits (135), Expect = 1e-06 Identities = 40/105 (38%), Positives = 52/105 (49%), Gaps = 9/105 (8%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPP--PLAPTR--PWALKSLRCRRTSRPWTAGWNATVRH 361 P P PPPPP PPPPPPP +PP P P+R P++L+ TSRP T G VR Sbjct: 180 PMPPPPPPPPPPPPPPPVQSASPPTTPYNPSRAAPYSLQHPTPYSTSRP-TLGRRGAVRR 238 Query: 362 T*TPSR-----TCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDS 481 T + + + P +P R PT P + PP+ P + S Sbjct: 239 TRSSTTPPVMPPMTSQAPPMPLRRNLPTL--PSSPPPQAPLAFQS 281 [109][TOP] >UniRef100_UPI000184A33A JmjC domain-containing protein 3 (Jumonji domain-containing protein 3). n=1 Tax=Canis lupus familiaris RepID=UPI000184A33A Length = 1647 Score = 56.6 bits (135), Expect = 1e-06 Identities = 31/70 (44%), Positives = 36/70 (51%) Frame = +2 Query: 77 PRRGSGPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLP 256 P SGP G G++ RR C S + L PPP+PPPPP PPPPPP L Sbjct: 211 PAALSGPSGDEGLSPGGKRRRGCSSE--QTGLPPGLPLPPPPLPPPPPPPPPPPPLPGLA 268 Query: 257 TPPPLAPTRP 286 T PP T+P Sbjct: 269 TSPPFQLTKP 278 [110][TOP] >UniRef100_B4F6Q6 Putative uncharacterized protein (Fragment) n=1 Tax=Danio rerio RepID=B4F6Q6_DANRE Length = 711 Score = 56.6 bits (135), Expect = 1e-06 Identities = 40/105 (38%), Positives = 52/105 (49%), Gaps = 9/105 (8%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPP--PLAPTR--PWALKSLRCRRTSRPWTAGWNATVRH 361 P P PPPPP PPPPPPP +PP P P+R P++L+ TSRP T G VR Sbjct: 180 PMPPPPPPPPPPPPPPPVQSASPPTTPYNPSRAAPYSLQHPTPYSTSRP-TLGRRGAVRR 238 Query: 362 T*TPSR-----TCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDS 481 T + + + P +P R PT P + PP+ P + S Sbjct: 239 TRSSTTPPVMPPVTSQAPPMPLRRNLPTL--PSSPPPQAPLAFQS 281 [111][TOP] >UniRef100_Q67PY8 Putative uncharacterized protein n=1 Tax=Symbiobacterium thermophilum RepID=Q67PY8_SYMTH Length = 459 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/64 (45%), Positives = 34/64 (53%) Frame = +1 Query: 334 GWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGH 513 G+LE H+ L+ LLRIPSIS + A VR A EW A G +LE GGH Sbjct: 2 GYLEEHQSRFLNEFLSLLRIPSISTDPAAAGAVRQAAEWVAERLRQAGMDGVRILETGGH 61 Query: 514 PVVY 525 P VY Sbjct: 62 PAVY 65 [112][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/52 (51%), Positives = 29/52 (55%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNA 349 PPP PPPPP PPPPPPP P PPP P P L + RT AGW + Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPDVLAADAFDRTV---AAGWGS 702 [113][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P RP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 56.6 bits (135), Expect = 1e-06 Identities = 33/91 (36%), Positives = 37/91 (40%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PPP P P + +RP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPC--------PP 120 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMP 466 C PC + P G P+ PP P Sbjct: 121 KHECGLPE---PCPQVEPIAGEPMPIPPCAP 148 Score = 56.6 bits (135), Expect = 1e-06 Identities = 34/92 (36%), Positives = 36/92 (39%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PPP P P C P + P Sbjct: 86 PPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHEC---GLPEPCPQVEPIAGEPMP 142 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 C P PM P P+ P MPP Sbjct: 143 IPPCA---PMPMPMPMEPIGRQPLPIPMPMPP 171 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/100 (36%), Positives = 36/100 (36%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PPP P P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--------------------PPPPPPPPP 63 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMPR 493 R C P P P P PP PP PP PR Sbjct: 64 PRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 [114][TOP] >UniRef100_Q00ZZ2 Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins (ISS) n=1 Tax=Ostreococcus tauri RepID=Q00ZZ2_OSTTA Length = 685 Score = 56.6 bits (135), Expect = 1e-06 Identities = 41/120 (34%), Positives = 47/120 (39%), Gaps = 16/120 (13%) Frame = +2 Query: 179 RARRRPPPMPPPPPLPPPPPP----------------PHSLPTPPPLAPTRPWALKSLRC 310 RA PP PPPPP PPPPPP P S P PPP R + S++ Sbjct: 518 RAASTTPPPPPPPPPPPPPPPPPPPPPPPTTTGGVRSPPSHPPPPPSDDPRSMLMASIQA 577 Query: 311 RRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMP 490 + R A + PS S P LP P P PP + PP PP S P Sbjct: 578 GVSLRK----TKAKASFSSAPSSVVSDSEPSLPPSPSPP---PPPSPPPPPPPPPRSPSP 630 [115][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPPLPPPPPPP P PPP P P Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP+PPPPP PPPPPPP P PPP P P Sbjct: 28 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [116][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +2 Query: 173 VGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 V R PPP PPPPP PPPPPPP P PPP P P Sbjct: 10 VASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLR 307 PPP PPPPP PPPPPPP P PPP P P + ++ R Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQR 71 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 [117][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 56.6 bits (135), Expect = 1e-06 Identities = 30/62 (48%), Positives = 33/62 (53%), Gaps = 7/62 (11%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTR------PWALKSLRCR-RTSRPWTAGWNAT 352 PPP PPPPP PPPPPPP P PPP P R P L + CR R R +AG Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLSGVLCRDRKHRQRSAGDTTR 78 Query: 353 VR 358 V+ Sbjct: 79 VK 80 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 188 RRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 R PPP PPPPP PPPPPPP P PPP P P Sbjct: 1 RVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [118][TOP] >UniRef100_B5DWM1 GA26446 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DWM1_DROPS Length = 580 Score = 51.2 bits (121), Expect(2) = 1e-06 Identities = 21/32 (65%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTP-PPLAPTRP 286 PPP PPPPP PPPPPPPH P PP+ P P Sbjct: 147 PPPPPPPPPPPPPPPPPHHHHHPHPPIIPPPP 178 Score = 25.0 bits (53), Expect(2) = 1e-06 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +3 Query: 75 GPVGVPALVAAAE*PYCPPGAGRVALLSCGAGSSGGRGGDHHRCHHHH 218 GP G+P P PPG + GDH HHHH Sbjct: 113 GPPGLPG-------PIGPPGPSKYR-------------GDHDHHHHHH 140 [119][TOP] >UniRef100_UPI00015B4CAB PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B4CAB Length = 972 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/108 (33%), Positives = 47/108 (43%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PP PP PP+ PPPPP + P PPP PTRP ++ +RP R P Sbjct: 508 PPTRPPQPPVTRPPPPPPTRPPPPP--PTRPPVTQT----PYTRPPPPPTRPPTRPPPPP 561 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMPRCSRTVATQ 517 ++ P P RP +P P PP PP P ++T T+ Sbjct: 562 TQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTR 609 Score = 56.2 bits (134), Expect = 1e-06 Identities = 39/115 (33%), Positives = 46/115 (40%), Gaps = 6/115 (5%) Frame = +2 Query: 191 RPPPMPPP------PPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNAT 352 RPP PPP PP PP PP + PPP PTRP R T P+T Sbjct: 616 RPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYT------ 669 Query: 353 VRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMPRCSRTVATQ 517 R P+R P P RP +P P PP PP P ++T T+ Sbjct: 670 -RPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTR 723 Score = 55.1 bits (131), Expect = 3e-06 Identities = 37/102 (36%), Positives = 44/102 (43%), Gaps = 9/102 (8%) Frame = +2 Query: 191 RPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRR---------TSRPWTAGW 343 RPP PP PP+ PPPPP + P PPP PTRP ++ R T P+T Sbjct: 757 RPPTRPPQPPVTRPPPPPPTRPPPPP--PTRPPVTQTPYTRPPPPPTRPPVTQTPYTRPP 814 Query: 344 NATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 R P+R +LP P PPV PP PP Sbjct: 815 PPPTR---PPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPP 853 Score = 53.9 bits (128), Expect = 7e-06 Identities = 40/109 (36%), Positives = 43/109 (39%), Gaps = 12/109 (11%) Frame = +2 Query: 179 RARRRPPPMPPPPP-------LPP-----PPPPPHSLPTPPPLAPTRPWALKSLRCRRTS 322 R RPPP PPPP LPP PP PP + P PPP PTRP R T Sbjct: 483 RPPTRPPPTRPPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPP--PTRPPPPPPTRPPVTQ 540 Query: 323 RPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 P+T R P +LP P PPV PP PP Sbjct: 541 TPYTRPPPPPTRPPTRPPPPPTQPSTYLPPAPPTRPPQPPVTRPPPPPP 589 [120][TOP] >UniRef100_UPI0000F2CB43 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2CB43 Length = 252 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/80 (41%), Positives = 40/80 (50%) Frame = -2 Query: 324 REVRRQRSDFSAHGRVGASGGGVGRE*GGGGGGGSGGGGGIGGGRRRARPTSQRRN*AER 145 R+ RR+R +A G G GGG G GGGGGGG GGGGG GGG + + + Sbjct: 172 RQRRRRRRRGAAAGGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGS 231 Query: 144 HGQRRAGNTATPPPPPGPEP 85 G G +P P PG P Sbjct: 232 GGS--GGEDRSPEPSPGRRP 249 [121][TOP] >UniRef100_Q4RWN6 Chromosome 15 SCAF14981, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4RWN6_TETNG Length = 495 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/35 (68%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPP----HSLPTPPPLAPTRP 286 PPP PPPPPLPPPPPPP LP PP AP RP Sbjct: 5 PPPPPPPPPLPPPPPPPALVLPGLPQDPPAAPQRP 39 [122][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/92 (38%), Positives = 38/92 (41%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPP PPPP PP LP PPP +P P L P P Sbjct: 899 PPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPP--------------P 944 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 S P LP P+ P PP + PP PP Sbjct: 945 SPPPLPPPP-LPPPPLPPPPSPPPSPPPSPPP 975 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/96 (37%), Positives = 41/96 (42%), Gaps = 4/96 (4%) Frame = +2 Query: 194 PPPMPPPP----PLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRH 361 PPP+PPPP PLPPP PPP P+PPP P P L + P Sbjct: 1567 PPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLP-------- 1618 Query: 362 T*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 P S P LP P+ P PP + PP PP Sbjct: 1619 --PPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPP 1652 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/92 (38%), Positives = 39/92 (42%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPLPPPP PP LP PP P+ P S P + + P Sbjct: 830 PPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP----------PSPPPSPPPSPPPPTPPPP 879 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 + A P P P PT PP PP PP Sbjct: 880 APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPP 911 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/92 (38%), Positives = 39/92 (42%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPLPPPP PP LP PP P+ P S P + + P Sbjct: 1008 PPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP----------PSPPPSPPPSPPPPTPPPP 1057 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 + A P P P PT PP PP PP Sbjct: 1058 APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPP 1089 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/92 (38%), Positives = 39/92 (42%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPLPPPP PP LP PP P+ P S P + + P Sbjct: 1099 PPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP----------PSPPPSPPPSPPPPTPPPP 1148 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 + A P P P PT PP PP PP Sbjct: 1149 APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPP 1180 Score = 53.9 bits (128), Expect = 7e-06 Identities = 35/92 (38%), Positives = 37/92 (40%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPP PPP PPP P+PPP P P + P T A T P Sbjct: 746 PPPPAPPPPAPPPAPPPSPPPSPPPSPPPSP--------PPSPPPPTPPPPAPPPPTPPP 797 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 S P P PT PP PP PP Sbjct: 798 SP---------PPSPPPPTPPPPAPPPPNPPP 820 Score = 53.5 bits (127), Expect = 9e-06 Identities = 22/40 (55%), Positives = 24/40 (60%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCR 313 PPP PPPPLPPPP PP P PPP P P+ + L R Sbjct: 387 PPPPSPPPPLPPPPIPPPPSPPPPPPPPLAPFTCEDLASR 426 Score = 53.5 bits (127), Expect = 9e-06 Identities = 32/92 (34%), Positives = 38/92 (41%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP P PPP PPPP PP S P P P P P + S P + + +P Sbjct: 1542 PPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSP 1601 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 P P P+ P PP PP +PP Sbjct: 1602 PPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPP 1633 [123][TOP] >UniRef100_B6IW23 Putative uncharacterized protein n=1 Tax=Rhodospirillum centenum SW RepID=B6IW23_RHOCS Length = 2485 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 197 PPMPPPPPLPPPPPPPHSLPTPPPLAPT 280 PP PPPPPLPPPPPP LP PPP+ PT Sbjct: 1996 PPAPPPPPLPPPPPPTPVLPAPPPVVPT 2023 [124][TOP] >UniRef100_A4X4W6 Putative uncharacterized protein n=1 Tax=Salinispora tropica CNB-440 RepID=A4X4W6_SALTO Length = 539 Score = 56.2 bits (134), Expect = 1e-06 Identities = 52/145 (35%), Positives = 61/145 (42%), Gaps = 6/145 (4%) Frame = -2 Query: 459 RGGPFTGGPHVGRMGRQGRNGWDAQQVLEGV*VCRTVAFQPAVHGRE---VRRQRSDFSA 289 RG + GGP G G + G A G +P GR V +R A Sbjct: 404 RGAVYGGGPAAGAHGARREPGHAAAPADNG----GYGGGRPGEGGRPAAGVYGRRPAGGA 459 Query: 288 HGRVGASGG---GVGRE*GGGGGGGSGGGGGIGGGRRRARPTSQRRN*AERHGQRRAGNT 118 G A+GG G GR GG GGG GGGG+ GG R P R A R G+RR + Sbjct: 460 GGPRPAAGGQDSGGGRAADGGRGGGVYGGGGVHGGGRAQPPRRDRGGAAPRDGRRR--ES 517 Query: 117 ATPPPPPGPEPRRGPRR*GRHSDSY 43 + P PGPE G GRH Y Sbjct: 518 GSGPGGPGPESGGG---FGRHGGRY 539 [125][TOP] >UniRef100_C0UUQ6 Acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase n=1 Tax=Thermobaculum terrenum ATCC BAA-798 RepID=C0UUQ6_9BACT Length = 456 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/55 (43%), Positives = 36/55 (65%) Frame = +1 Query: 361 HLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHPVVY 525 +L+ LK+ LRIPSISALS + +V +W + ++G + AEV+ GHP+VY Sbjct: 16 YLEDLKEFLRIPSISALSDYKAEVARCAQWLKEHMITIGLQKAEVIPTSGHPIVY 70 [126][TOP] >UniRef100_B4YB55 BimA n=1 Tax=Burkholderia pseudomallei RepID=B4YB55_BURPS Length = 369 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP + P+PPP T P Sbjct: 98 PPPPPPPPPPPPPPPPPSTTPSPPPPTTTPP 128 [127][TOP] >UniRef100_Q851M1 DnaJ domain containing protein n=1 Tax=Oryza sativa Japonica Group RepID=Q851M1_ORYSJ Length = 477 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/58 (43%), Positives = 30/58 (51%) Frame = +2 Query: 164 RWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTA 337 RW+ ++ P P PPP P PPPPPPPH TP P P +P C R +TA Sbjct: 386 RWVSTSSQSGPAPPPPPQPPPPPPPPPHQRETPSPSPPPQPQFPCPGNCSRCGAKFTA 443 [128][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP PTPPP P P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPTPPPPPPRPP 449 Score = 55.8 bits (133), Expect = 2e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP + P PPP P+ P Sbjct: 422 PPPPPPPPPPPPPPPPPPTPPPPPPRPPSPP 452 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 421 PPPPPPPPPPPPPPPPPPPTPPPPPPRPPSP 451 [129][TOP] >UniRef100_B8AN55 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AN55_ORYSI Length = 599 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/58 (43%), Positives = 30/58 (51%) Frame = +2 Query: 164 RWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTA 337 RW+ ++ P P PPP P PPPPPPPH TP P P +P C R +TA Sbjct: 508 RWVSTSSQSGPAPPPPPQPPPPPPPPPHQRETPSPSPPPQPQFPCPGNCSRCGAKFTA 565 [130][TOP] >UniRef100_A3API4 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3API4_ORYSJ Length = 291 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/58 (43%), Positives = 30/58 (51%) Frame = +2 Query: 164 RWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTA 337 RW+ ++ P P PPP P PPPPPPPH TP P P +P C R +TA Sbjct: 200 RWVSTSSQSGPAPPPPPQPPPPPPPPPHQRETPSPSPPPQPQFPCPGNCSRCGAKFTA 257 [131][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/104 (32%), Positives = 36/104 (34%) Frame = +2 Query: 179 RARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVR 358 R PPP PPPPP PPPPPPP P PPP P P Sbjct: 40 RNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP---------------------- 77 Query: 359 HT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMP 490 P P P PP PP PP+W+ A P Sbjct: 78 ----------------PPPPPPPPPPPPPPPPPPPPPQWEPADP 105 [132][TOP] >UniRef100_B7QAY9 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QAY9_IXOSC Length = 345 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 34/56 (60%), Gaps = 8/56 (14%) Frame = +2 Query: 176 GRARRRPPPMPPPPPLPPPPPPPHSLPTP-------PPLAPTRPWALKS-LRCRRT 319 G + +PPP PPPPP PPPPPPP PTP PP+A T P A + LR RRT Sbjct: 254 GFPKEQPPPPPPPPPPPPPPPPPSVPPTPTLTLPAMPPVALTIPIAHRQLLRPRRT 309 [133][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/41 (58%), Positives = 27/41 (65%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRR 316 PPP PPPPP PPPPPPP P PPPL + A ++R RR Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPSAVRPRR 54 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/43 (55%), Positives = 27/43 (62%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTS 322 PPP PPPPP PPPPPPP P PPP P P L++ + R S Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPS 48 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRP 328 PPP PPPPP PPPPPPP P PPP P P R RP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPSAVRP 52 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRP 328 PPP PPPPP PPPPPPP P PPP P P LR + P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAP 47 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 [134][TOP] >UniRef100_UPI0001795D07 PREDICTED: similar to espin n=1 Tax=Equus caballus RepID=UPI0001795D07 Length = 807 Score = 55.8 bits (133), Expect = 2e-06 Identities = 47/150 (31%), Positives = 59/150 (39%), Gaps = 11/150 (7%) Frame = +2 Query: 92 GPGGGGGVAVLPARRWPCRSA*LRRWLVG-----------RARRRPPPMPPPPPLPPPPP 238 GP G +++ WP RR L G +A R PP PPPPP PPPPP Sbjct: 545 GPRGAAHISLA----WPPPLPRRRRLLPGNNVHNGCAADPKASRDLPPPPPPPPPPPPPP 600 Query: 239 PPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRP 418 P +L + PP AP P+ C + + G T P CC RP Sbjct: 601 LPEALSSAPP-APPLPFEGAGPGCGQRRSSSSTG---TANRPSRPDCRCCRR------RP 650 Query: 419 MRPTCGPPVNGPPRMPPRWDSAMPRCSRTV 508 R +G R PRW A P + +V Sbjct: 651 RR-------HGARRPTPRWQDAHPLLNGSV 673 [135][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 55.8 bits (133), Expect = 2e-06 Identities = 40/125 (32%), Positives = 48/125 (38%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P GG V+ P++ P R + + + PPP PPPPP PPPPPPP P PP + Sbjct: 2307 PSGGLPVSTHPSKSHPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 Query: 275 PTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGP 454 P P K TA A T T LP + PPV Sbjct: 2363 PKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKICAAAPPPVPPK 2422 Query: 455 PRMPP 469 P P Sbjct: 2423 PSSIP 2427 [136][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 55.8 bits (133), Expect = 2e-06 Identities = 40/125 (32%), Positives = 48/125 (38%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P GG V+ P++ P R + + + PPP PPPPP PPPPPPP P PP + Sbjct: 2307 PSGGLPVSTHPSKSHPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 Query: 275 PTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGP 454 P P K TA A T T LP + PPV Sbjct: 2363 PKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKICAAAPPPVPPK 2422 Query: 455 PRMPP 469 P P Sbjct: 2423 PSSIP 2427 [137][TOP] >UniRef100_UPI0000DD984C Os09g0538700 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD984C Length = 727 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/95 (35%), Positives = 39/95 (41%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PP P PPPPPPP P PPPL+PT P T W T Sbjct: 74 PPPQTPPSPPPPPPPPP---PPPPPLSPT---------------PTTTSW--------TT 107 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWD 478 + + ++ P LP P PP MP WD Sbjct: 108 NSSSISASPILPPPP-----------PPPMPSSWD 131 [138][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 55.8 bits (133), Expect = 2e-06 Identities = 40/125 (32%), Positives = 48/125 (38%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P GG V+ P++ P R + + + PPP PPPPP PPPPPPP P PP + Sbjct: 2277 PSGGLPVSTHPSKSHPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 Query: 275 PTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGP 454 P P K TA A T T LP + PPV Sbjct: 2333 PKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKICAAAPPPVPPK 2392 Query: 455 PRMPP 469 P P Sbjct: 2393 PSSIP 2397 [139][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 55.8 bits (133), Expect = 2e-06 Identities = 40/125 (32%), Positives = 48/125 (38%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P GG V+ P++ P R + + + PPP PPPPP PPPPPPP P PP + Sbjct: 2307 PSGGLPVSTHPSKSHPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 Query: 275 PTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGP 454 P P K TA A T T LP + PPV Sbjct: 2363 PKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKICAAAPPPVPPK 2422 Query: 455 PRMPP 469 P P Sbjct: 2423 PSSIP 2427 [140][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 55.8 bits (133), Expect = 2e-06 Identities = 40/125 (32%), Positives = 48/125 (38%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P GG V+ P++ P R + + + PPP PPPPP PPPPPPP P PP + Sbjct: 2277 PSGGLPVSTHPSKSHPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 Query: 275 PTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGP 454 P P K TA A T T LP + PPV Sbjct: 2333 PKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKICAAAPPPVPPK 2392 Query: 455 PRMPP 469 P P Sbjct: 2393 PSSIP 2397 [141][TOP] >UniRef100_Q4TB69 Chromosome 11 SCAF7190, whole genome shotgun sequence n=1 Tax=Tetraodon nigroviridis RepID=Q4TB69_TETNG Length = 452 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/76 (44%), Positives = 38/76 (50%), Gaps = 6/76 (7%) Frame = +2 Query: 74 GPRRGSGPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRR------PPPMPPPPPLPPPP 235 GP GS G G P P R + R + R +RR PPP+PPPPP PPPP Sbjct: 314 GPLIGSDSPAGRGP---PPGMGPLRPS--RSLALMRQKRRMSSPPPPPPLPPPPPPPPPP 368 Query: 236 PPPHSLPTPPPLAPTR 283 PPP PT PP A R Sbjct: 369 PPPPRPPTCPPTAAAR 384 [142][TOP] >UniRef100_A5VB72 Filamentous haemagglutinin family outer membrane protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5VB72_SPHWW Length = 1531 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/67 (41%), Positives = 35/67 (52%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP+ PPPPPP P PPP P P ++ T T ++++ T T Sbjct: 1287 PPPPPPPPPVSPPPPPPPVSPPPPP--PPPPPVIEDPAVNETVTTETTNITSSIQSTLTG 1344 Query: 374 SRTCCAS 394 SRT S Sbjct: 1345 SRTAGGS 1351 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Frame = +2 Query: 173 VGRARRRPPPMPPPPPL---PPPPPPPHSLPTPPPLAPTRP 286 V RA PPP PPPPP+ PPPPPPP S P PPP P P Sbjct: 1258 VARAVSPPPPPPPPPPVSPPPPPPPPPVSPPPPPPPPPVSP 1298 [143][TOP] >UniRef100_Q2PY11 Peptidase, M20/M25/M40 family n=1 Tax=uncultured marine bacterium Ant39E11 RepID=Q2PY11_9BACT Length = 460 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/63 (42%), Positives = 40/63 (63%) Frame = +1 Query: 337 WLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHP 516 ++++H+ LD L LLR+PSISA S++ DV + AA+ T+ G N +V E G+P Sbjct: 4 YIDKHKQRFLDELMTLLRMPSISADSAYQEDVLKTADAVAAFLTAAGANNVDVCETPGYP 63 Query: 517 VVY 525 VVY Sbjct: 64 VVY 66 [144][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/37 (64%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +2 Query: 179 RARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA-PTRP 286 +AR PPP PPPPP PPPPPPP P PPP A P+ P Sbjct: 59 QARPTPPPPPPPPPPPPPPPPPPPPPPPPPAAKPSAP 95 Score = 53.5 bits (127), Expect = 9e-06 Identities = 22/37 (59%), Positives = 24/37 (64%) Frame = +2 Query: 182 ARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWA 292 A+ RP P PPPPP PPPPPPP P PPP +P A Sbjct: 58 AQARPTPPPPPPPPPPPPPPPPPPPPPPPPPAAKPSA 94 [145][TOP] >UniRef100_C1XQM5 Acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase n=1 Tax=Meiothermus silvanus DSM 9946 RepID=C1XQM5_9DEIN Length = 440 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = +1 Query: 361 HLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHPVVY 525 HLDAL + LRIPS+SA H DV A W A ++LGF+ EV+ GHP+VY Sbjct: 4 HLDALIEFLRIPSVSANPDHKEDVARAARWLEAKLSALGFQ-VEVVATPGHPIVY 57 [146][TOP] >UniRef100_B4Y9V9 Intracellular mobility A n=1 Tax=Burkholderia pseudomallei RepID=B4Y9V9_BURPS Length = 365 Score = 55.8 bits (133), Expect = 2e-06 Identities = 33/83 (39%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP + P PPP T P P T T T TP Sbjct: 84 PPPPPPPPPPPPPPPPPSTTPPPPPPPSTTP---------SPPPPTTTPPTRTTPSTTTP 134 Query: 374 SRTCCASHPFLPCR-PMRPTCGP 439 + + HP P + P P P Sbjct: 135 TP---SMHPIQPTQLPSIPNATP 154 [147][TOP] >UniRef100_Q69JE5 Os09g0538700 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q69JE5_ORYSJ Length = 311 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/95 (35%), Positives = 39/95 (41%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PP P PPPPPPP P PPPL+PT P T W T Sbjct: 74 PPPQTPPSPPPPPPPPP---PPPPPLSPT---------------PTTTSW--------TT 107 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWD 478 + + ++ P LP P PP MP WD Sbjct: 108 NSSSISASPILPPPP-----------PPPMPSSWD 131 [148][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP S P PPP P P Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSL 304 PPP PPPPP PPPPPPP P PPP P P L L Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPL 284 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALK 298 PPP PPPPP PPPPPPP P PP L P P+ K Sbjct: 256 PPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAK 290 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 185 RRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 R PPPMPPPPP PPPPPPP P PPP P P Sbjct: 240 RPPPPPMPPPPPPPPPPPPP---PPPPPSPPPPP 270 Score = 53.9 bits (128), Expect = 7e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 P P PPPPP+PPPPPPP P PPP P+ P Sbjct: 237 PSPRPPPPPMPPPPPPPPPPPPPPPPPPSPP 267 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPP P PPPL P P Sbjct: 255 PPPPPPPPPPSPPPPPPPPPPPPPPLLPPLP 285 [149][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP S P PPP P P Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P+PPP P P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 53.5 bits (127), Expect = 9e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAP 277 PPP PPPPP PPPPPPP P PPP+ P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 [150][TOP] >UniRef100_C0PGT8 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PGT8_MAIZE Length = 787 Score = 55.8 bits (133), Expect = 2e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPL 271 PPP PPPPP PPPPPPP LP+PPP+ Sbjct: 434 PPPPPPPPPTPPPPPPPPRLPSPPPV 459 [151][TOP] >UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis RepID=B9S5R2_RICCO Length = 210 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/97 (36%), Positives = 41/97 (42%) Frame = +2 Query: 191 RPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*T 370 +PPP PPPP PPP PPP S P PPP P P S P +++ Sbjct: 41 QPPPPPPPPSPPPPSPPPPSPPPPPPPPPPSP-----------SPPPPTSPPSSLLSPPP 89 Query: 371 PSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDS 481 PS AS P P P PP + PP P + S Sbjct: 90 PSPPPPASSSSPPPPPPPPPSSPPPSPPPPPTPSYTS 126 [152][TOP] >UniRef100_B8BDX6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BDX6_ORYSI Length = 670 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/95 (35%), Positives = 39/95 (41%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PP P PPPPPPP P PPPL+PT P T W T Sbjct: 74 PPPQTPPSPPPPPPPPP---PPPPPLSPT---------------PTTTSW--------TT 107 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWD 478 + + ++ P L PP PP MP WD Sbjct: 108 NSSSISASPIL----------PPPPPPPPMPSSWD 132 [153][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 55.8 bits (133), Expect = 2e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PP L P +P Sbjct: 268 PPPPPPPPPPPPPPPPPSPSPPPPELPPAQP 298 [154][TOP] >UniRef100_Q29MS4 GA18884 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=Q29MS4_DROPS Length = 207 Score = 55.8 bits (133), Expect = 2e-06 Identities = 40/94 (42%), Positives = 52/94 (55%), Gaps = 1/94 (1%) Frame = -2 Query: 405 RNGWDAQQVLEGV*VC-RTVAFQPAVHGREVRRQRSDFSAHGRVGASGGGVGRE*GGGGG 229 R+ DA + ++G + R + Q A +GR RS+ G GGG G GGGGG Sbjct: 75 RDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSN-------GRRGGGSG---GGGGG 124 Query: 228 GGSGGGGGIGGGRRRARPTSQRRN*AERHGQRRA 127 GG+GGGGG GGGRRR+R S R R +RR+ Sbjct: 125 GGAGGGGGGGGGRRRSRSRSPMRR-RSRSPRRRS 157 [155][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 55.8 bits (133), Expect = 2e-06 Identities = 37/100 (37%), Positives = 39/100 (39%), Gaps = 1/100 (1%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PPP P +P P G P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPQQP------------LPGNPG---------PP 91 Query: 374 SRTCCASHPFLPCRPMRP-TCGPPVNGPPRMPPRWDSAMP 490 R A P P P P GPP P PP + P Sbjct: 92 GRPGPAGPPGPPGPPGPPGPAGPPGQAGPGGPPGQPAPAP 131 [156][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 55.8 bits (133), Expect = 2e-06 Identities = 39/105 (37%), Positives = 40/105 (38%), Gaps = 6/105 (5%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTA-GWNATVRHT*T 370 PPP PPPPP PPPPPPP P PPP P P RR RP+ GW Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP---PPPPPRRRPRPYYGHGWWPR------ 128 Query: 371 PSRTCCASHPF-----LPCRPMRPTCGPPVNGPPRMPPRWDSAMP 490 PF P P PP PP PP S P Sbjct: 129 -PYDYYPEQPFDYDYGDAAPPAPPAAAPPPPPPPPPPPSPPSPQP 172 [157][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPP--HSLPTPPPLAPTRPWALKSL 304 PPP PPPPPLPPPPPPP P PPP P +P KSL Sbjct: 273 PPPPPPPPPLPPPPPPPPLPPQPPPPPPPPLQPQQHKSL 311 [158][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 191 RPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 RPPP PPPPP PPPPPPP P PPP P P Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 188 RRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 R PPP PPPPP PPPPPPP P PPP P P Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAP 277 PPP PPPPP PPPPPPP P PPPL P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPLPP 100 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLR 307 PPP PPPPP PPPPPPP P PPP P P + LR Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIPLR 109 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 185 RRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 R PPP PPPPP PPPPPPP P PPP P P Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 99 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 100 [159][TOP] >UniRef100_Q0VHD7 CD95 ligand n=1 Tax=Homo sapiens RepID=Q0VHD7_HUMAN Length = 281 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = +2 Query: 125 PARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTP-PPL 271 P PC ++ RR +RRPPP PPPPPLPPPPPPP P P PPL Sbjct: 26 PGTVLPCPTSVPRR----PGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPL 71 [160][TOP] >UniRef100_P48023-2 Isoform 2 of Tumor necrosis factor ligand superfamily member 6 n=1 Tax=Homo sapiens RepID=P48023-2 Length = 127 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = +2 Query: 125 PARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTP-PPL 271 P PC ++ RR +RRPPP PPPPPLPPPPPPP P P PPL Sbjct: 26 PGTVLPCPTSVPRR----PGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPL 71 [161][TOP] >UniRef100_P48023 Tumor necrosis factor ligand superfamily member 6, soluble form n=2 Tax=Homo sapiens RepID=TNFL6_HUMAN Length = 281 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = +2 Query: 125 PARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTP-PPL 271 P PC ++ RR +RRPPP PPPPPLPPPPPPP P P PPL Sbjct: 26 PGTVLPCPTSVPRR----PGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPL 71 [162][TOP] >UniRef100_Q9QYX7-2 Isoform 2 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-2 Length = 4833 Score = 55.8 bits (133), Expect = 2e-06 Identities = 40/125 (32%), Positives = 48/125 (38%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P GG V+ P++ P R + + + PPP PPPPP PPPPPPP P PP + Sbjct: 2277 PSGGLPVSTHPSKSHPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 Query: 275 PTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGP 454 P P K TA A T T LP + PPV Sbjct: 2333 PKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKICAAAPPPVPPK 2392 Query: 455 PRMPP 469 P P Sbjct: 2393 PSSIP 2397 [163][TOP] >UniRef100_Q9QYX7-3 Isoform 3 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-3 Length = 4981 Score = 55.8 bits (133), Expect = 2e-06 Identities = 40/125 (32%), Positives = 48/125 (38%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P GG V+ P++ P R + + + PPP PPPPP PPPPPPP P PP + Sbjct: 2307 PSGGLPVSTHPSKSHPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 Query: 275 PTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGP 454 P P K TA A T T LP + PPV Sbjct: 2363 PKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKICAAAPPPVPPK 2422 Query: 455 PRMPP 469 P P Sbjct: 2423 PSSIP 2427 [164][TOP] >UniRef100_Q9QYX7-4 Isoform 4 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-4 Length = 5177 Score = 55.8 bits (133), Expect = 2e-06 Identities = 40/125 (32%), Positives = 48/125 (38%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P GG V+ P++ P R + + + PPP PPPPP PPPPPPP P PP + Sbjct: 2307 PSGGLPVSTHPSKSHPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 Query: 275 PTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGP 454 P P K TA A T T LP + PPV Sbjct: 2363 PKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKICAAAPPPVPPK 2422 Query: 455 PRMPP 469 P P Sbjct: 2423 PSSIP 2427 [165][TOP] >UniRef100_Q9QYX7 Protein piccolo n=1 Tax=Mus musculus RepID=PCLO_MOUSE Length = 5038 Score = 55.8 bits (133), Expect = 2e-06 Identities = 40/125 (32%), Positives = 48/125 (38%) Frame = +2 Query: 95 PGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLA 274 P GG V+ P++ P R + + + PPP PPPPP PPPPPPP P PP + Sbjct: 2277 PSGGLPVSTHPSKSHPF----FRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 Query: 275 PTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGP 454 P P K TA A T T LP + PPV Sbjct: 2333 PKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKICAAAPPPVPPK 2392 Query: 455 PRMPP 469 P P Sbjct: 2393 PSSIP 2397 [166][TOP] >UniRef100_UPI0001B56803 M20/M25/M40 family peptidase n=1 Tax=Streptomyces sp. C RepID=UPI0001B56803 Length = 476 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/68 (41%), Positives = 38/68 (55%) Frame = +1 Query: 322 TAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLE 501 + V +++ HR LD L + LRIPS+SA HA DVR + +W AA GF EV + Sbjct: 7 SVVRTYIDTHRAAFLDDLAEWLRIPSVSAQPEHAGDVRRSADWLAAKLKETGFPVTEVWD 66 Query: 502 NGGHPVVY 525 G P V+ Sbjct: 67 TPGAPAVF 74 [167][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP AP P Sbjct: 938 PPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWA 292 PPP PPPPP PPPPPPP P PPP P P A Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGA 964 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 935 PPPPPPPPPPPPPPPPPPPPPPPPPPPPGAP 965 Score = 53.9 bits (128), Expect = 7e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAP 277 PPP PPPPP PPPPPPP + P PPP P Sbjct: 946 PPPPPPPPPPPPPPPPPGAPPPPPPALP 973 [168][TOP] >UniRef100_UPI000175F433 PREDICTED: similar to formin-like 1 n=1 Tax=Danio rerio RepID=UPI000175F433 Length = 1102 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Frame = +2 Query: 194 PPPMPPPPP---LPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRT 319 PPP PPPPP PPPPPPP S P PPP AP P A + R+T Sbjct: 610 PPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAPGAETGPKARKT 654 [169][TOP] >UniRef100_UPI0000E80902 PREDICTED: similar to RAPH1 protein n=1 Tax=Gallus gallus RepID=UPI0000E80902 Length = 1132 Score = 55.5 bits (132), Expect = 2e-06 Identities = 35/99 (35%), Positives = 43/99 (43%), Gaps = 3/99 (3%) Frame = +2 Query: 182 ARRRPPPMPPPPPLPPPPPPPHSLPT-PPPLAPTRP--WALKSLRCRRTSRPWTAGWNAT 352 A + PP+PPPPP PPPPPPP +P PPP P +P AL R+ + P + + Sbjct: 632 ASQPSPPLPPPPPPPPPPPPPPPVPAPPPPQEPPKPLMTALPPQPSRKAASPGVSHITSP 691 Query: 353 VRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 V P P P P P P PP P Sbjct: 692 VP---VPLPLAVKKQPTSPQVPPLPQVPPLPPAPPGPTP 727 [170][TOP] >UniRef100_UPI00005A9692 PREDICTED: similar to cytochrome P450, family 11, subfamily B, polypeptide 1 isoform 1 precursor n=1 Tax=Canis lupus familiaris RepID=UPI00005A9692 Length = 562 Score = 55.5 bits (132), Expect = 2e-06 Identities = 35/78 (44%), Positives = 41/78 (52%), Gaps = 10/78 (12%) Frame = +2 Query: 80 RRGSGPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRRP------PPM----PPPPPLPP 229 +R + PGG G V+ PA R +R LVGRA RP P+ PPPPP PP Sbjct: 34 QRQAAPGGSGRVSGPPAPMPRLRPQDQKRSLVGRASLRPCASGSEAPIHLFRPPPPPPPP 93 Query: 230 PPPPPHSLPTPPPLAPTR 283 PPPPP P P LA +R Sbjct: 94 PPPPPALTPEPGFLASSR 111 [171][TOP] >UniRef100_UPI00005A148F PREDICTED: similar to Tumor necrosis factor ligand superfamily member 6 (FAS antigen ligand) (Apoptosis antigen ligand) (APTL) (CD178 antigen) n=1 Tax=Canis lupus familiaris RepID=UPI00005A148F Length = 286 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/65 (47%), Positives = 35/65 (53%) Frame = +2 Query: 125 PARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSL 304 P PC S+ + GR +R PP PPPP LPPPPPPP P PPPL P LK+ Sbjct: 26 PGSVLPCPSS-----VPGRPGQRRPP-PPPPTLPPPPPPPPPPPPPPPLPPLPLPPLKTR 79 Query: 305 RCRRT 319 R T Sbjct: 80 RDHNT 84 [172][TOP] >UniRef100_Q5WAW6 Putative uncharacterized protein n=1 Tax=Bacillus clausii KSM-K16 RepID=Q5WAW6_BACSK Length = 457 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/62 (40%), Positives = 34/62 (54%) Frame = +1 Query: 340 LERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLENGGHPV 519 L + R HL+ L L+IPSIS++S H D+RAA EW E++E HP+ Sbjct: 9 LRQDRAAHLEELSAFLKIPSISSISEHKEDIRAAAEWLKQAFLQAKMEKVEIIETKKHPI 68 Query: 520 VY 525 VY Sbjct: 69 VY 70 [173][TOP] >UniRef100_A3WBS5 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBS5_9SPHN Length = 378 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = +2 Query: 167 WLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAP 277 W +G PPP PPPPP PPPPPPP P PPP P Sbjct: 223 WNLGGQAAPPPPPPPPPPPPPPPPPPLPPPAPPPPPP 259 [174][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P+PPP P P Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPPPPPPP 247 [175][TOP] >UniRef100_Q10R38 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10R38_ORYSJ Length = 209 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/40 (60%), Positives = 27/40 (67%), Gaps = 4/40 (10%) Frame = +2 Query: 194 PPPM----PPPPPLPPPPPPPHSLPTPPPLAPTRPWALKS 301 PPP PPPPPLPPPPPPP + P PPP +P P +KS Sbjct: 75 PPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKS 114 [176][TOP] >UniRef100_B9FY87 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FY87_ORYSJ Length = 1589 Score = 55.5 bits (132), Expect = 2e-06 Identities = 39/112 (34%), Positives = 50/112 (44%), Gaps = 17/112 (15%) Frame = +2 Query: 185 RRRPPPMPPPPPLPPPPPPP-----HSLPTPPPLAPTRPWALKSLRCRRTSRP------- 328 +++PPP PPPPPLPPPPPPP S+P PPP P + ++ RT P Sbjct: 909 KQQPPPPPPPPPLPPPPPPPASSGLSSIPPPPPPPPLMSFGAQT----RTFVPPPPPPPP 964 Query: 329 -----WTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 A +NA P T + P P P+ + PP PP PP Sbjct: 965 PPRSGVAARFNAPPPPP-PPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPP 1015 [177][TOP] >UniRef100_A9TWA3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWA3_PHYPA Length = 2209 Score = 55.5 bits (132), Expect = 2e-06 Identities = 39/100 (39%), Positives = 44/100 (44%), Gaps = 2/100 (2%) Frame = +2 Query: 197 PPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPS 376 PP PPPPP PPPPPP S P PPP P P L R + P G A P Sbjct: 1581 PPPPPPPPPPPPPPPGRSAPPPPP-PPPPPLPLGG----RAAPPPPPGGRAAP----PPP 1631 Query: 377 RTCCASHPFLPCRPMRP--TCGPPVNGPPRMPPRWDSAMP 490 A+ P P P+ P PP PP +PP +A P Sbjct: 1632 PGGRAAPPPPPPPPLPPGGRAAPPPPPPPPLPPGGRAAPP 1671 [178][TOP] >UniRef100_A9TLH5 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TLH5_PHYPA Length = 234 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/91 (36%), Positives = 39/91 (42%), Gaps = 5/91 (5%) Frame = +2 Query: 197 PPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TPS 376 PP+PPPPP PPPPPPP P PPP +PT + + P A R T P+ Sbjct: 145 PPLPPPPPPPPPPPPPG--PRPPPSSPTPSYPSSLSPSPSSPPPRVPDVPAPTRPTPCPT 202 Query: 377 RTCCASHPF-----LPCRPMRPTCGPPVNGP 454 + PF C P RP P P Sbjct: 203 PRSPSDPPFPTPRCSACSPSRPPVSHPCPTP 233 [179][TOP] >UniRef100_A8HYC3 Hydroxyproline-rich glycoprotein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HYC3_CHLRE Length = 612 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/93 (35%), Positives = 34/93 (36%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPP PPPP PP P PPP P +P P W A Sbjct: 531 PPPPSPPPPAPPPPSPPPPRPPPPPRLPPKP-----------PSPMPPDWPAD------- 572 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPR 472 P P R RP PP PP P R Sbjct: 573 -----PQAPNAPSRRKRPPPSPPRPPPPPPPKR 600 [180][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRR 316 PPP PPPPP PPPPPPP P PPP P P + CR+ Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVDCRQ 88 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 [181][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/48 (56%), Positives = 28/48 (58%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTA 337 PPP PPPPP PPPPPPP P PPP P P L TSRP +A Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLV------TSRPLSA 108 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 [182][TOP] >UniRef100_B7PUP0 Beta-1 subunit of nicotinic acetylcholine receptor, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PUP0_IXOSC Length = 489 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 185 RRRPPPMPPPPPLPPPPPPPHSLPTPPPLAP 277 R+ PPP PPPPP PPPPPPP L PPPL P Sbjct: 377 RQPPPPPPPPPPPPPPPPPPPHLLQPPPLKP 407 [183][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 8/50 (16%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTR--------PWALKSLRCRRT 319 PPP PPPPP PPPPPPP P PPP PT+ P L++ R RR+ Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTQEDLAGGNAPQHLRTRRRRRS 52 [184][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/56 (48%), Positives = 28/56 (50%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRH 361 PPP PPPPP PPPPPPP P PPP P P L +L W G N H Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCNL--------WDVGANTKHSH 62 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 [185][TOP] >UniRef100_B4PVU3 GE23484 n=1 Tax=Drosophila yakuba RepID=B4PVU3_DROYA Length = 291 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +2 Query: 173 VGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWAL 295 VG+ + +PPP PPPPP PPPPPPP + P PP AP P +L Sbjct: 65 VGKPKVKPPPPPPPPPPPPPPPPPPAPPAPPG-APVYPNSL 104 [186][TOP] >UniRef100_B4NYJ9 GE18286 n=1 Tax=Drosophila yakuba RepID=B4NYJ9_DROYA Length = 622 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP + P PPP P P Sbjct: 505 PPPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 535 [187][TOP] >UniRef100_B4LU87 GJ17267 n=1 Tax=Drosophila virilis RepID=B4LU87_DROVI Length = 1229 Score = 55.5 bits (132), Expect = 2e-06 Identities = 41/113 (36%), Positives = 50/113 (44%), Gaps = 12/113 (10%) Frame = +2 Query: 182 ARRRPPPMPPPPP--LPPPPPPP------HSLPTPPPLAPTRPWALKSLRCRRTSRPWTA 337 A PPP PPPPP PPPPPPP + P PPPL+ ++ +L P Sbjct: 692 AAAAPPPPPPPPPGGGPPPPPPPGPANVGNGPPPPPPLSTSKSGT--ALAPAPLPDPAEG 749 Query: 338 GWNATVRHT*TPSRTCCASHPFLPCRPMR----PTCGPPVNGPPRMPPRWDSA 484 W T + A +P P RP+ TCGPPV PP + DSA Sbjct: 750 NWFLR-----TSVQRKSAVNPPKPMRPLYWTRIVTCGPPVPRPPSIANSTDSA 797 [188][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTR 283 PPP PPPPP PPPPPPP P PPPL TR Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPPLFTTR 150 [189][TOP] >UniRef100_B3N3R7 GG25000 n=1 Tax=Drosophila erecta RepID=B3N3R7_DROER Length = 613 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP + P PPP P P Sbjct: 496 PPPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 526 [190][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 156 PPPSPPPPPSPPPPPPPSPPPPPPPPPPPPP 186 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 170 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 [191][TOP] >UniRef100_UPI0001868097 hypothetical protein BRAFLDRAFT_128521 n=1 Tax=Branchiostoma floridae RepID=UPI0001868097 Length = 1189 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALK 298 PPP PPPPP PPPPPPP P PPPL ALK Sbjct: 684 PPPPPPPPPAPPPPPPPGMPPPPPPLPGAAMAALK 718 [192][TOP] >UniRef100_UPI00005A3746 PREDICTED: similar to Splicing factor 1 (Zinc finger protein 162) (Transcription factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point binding protein mBBP) (BBP) isoform 5 n=1 Tax=Canis lupus familiaris RepID=UPI00005A3746 Length = 616 Score = 55.1 bits (131), Expect = 3e-06 Identities = 39/116 (33%), Positives = 44/116 (37%), Gaps = 24/116 (20%) Frame = +2 Query: 194 PPPMP--PPPPL---PPPPPPPHSLPTPPPLAPTRPWALK-----------SLRCRRTSR 325 PPPM PPPP+ PPPPPPP P PPP P PW + S T Sbjct: 441 PPPMGMMPPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPL 500 Query: 326 PWTAGWNATVRHT*TPS-------RTCCASHPFLPCRPMRPTCGP-PVNGPPRMPP 469 PW T T S + A+ P P PT P P P +PP Sbjct: 501 PWQQNTTTTTTSAGTGSIPPWQQQQAAAAASPGAPQMQGNPTMVPLPPGVQPPLPP 556 [193][TOP] >UniRef100_UPI0000586F5E PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000586F5E Length = 287 Score = 55.1 bits (131), Expect = 3e-06 Identities = 31/60 (51%), Positives = 34/60 (56%), Gaps = 7/60 (11%) Frame = -2 Query: 327 GREVRRQRSDFSAHGRVGASGGGVGRE*GG-------GGGGGSGGGGGIGGGRRRARPTS 169 G+ R RS + G G GGG GRE GG GGGGGSGGGGG GG R R+R S Sbjct: 191 GQSRSRSRSPYGRGGGEGGGGGGRGREGGGGGGGGGRGGGGGSGGGGGGGGYRSRSRSRS 250 [194][TOP] >UniRef100_UPI000024DCC5 zinc finger homeodomain 4 n=1 Tax=Mus musculus RepID=UPI000024DCC5 Length = 3581 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAP 277 PPP PPPPP PPPPPPP P PPP AP Sbjct: 2008 PPPTPPPPPPPPPPPPPPPPPPPPPSAP 2035 [195][TOP] >UniRef100_UPI00002109E8 brain-specific angiogenesis inhibitor 1 precursor n=1 Tax=Homo sapiens RepID=UPI00002109E8 Length = 1584 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/58 (44%), Positives = 29/58 (50%) Frame = +2 Query: 113 VAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 ++ P P RS R+ G PP PPPPP PPPPPP LP PP L P P Sbjct: 1380 LSTAPEASLPARSPPSRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPP 1437 [196][TOP] >UniRef100_Q2NNS2 1629capsid n=1 Tax=Hyphantria cunea nucleopolyhedrovirus RepID=Q2NNS2_NPVHC Length = 539 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 2/36 (5%) Frame = +2 Query: 194 PPPMPPPPP--LPPPPPPPHSLPTPPPLAPTRPWAL 295 PPP PPPPP +PPPPPPP ++P PPP P P +L Sbjct: 241 PPPTPPPPPPNMPPPPPPPPNMPPPPPPPPPPPLSL 276 [197][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTR 283 PPP PPPPP PPPPPPP P PPP P R Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPFQPPR 266 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P +P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPFQP 264 [198][TOP] >UniRef100_Q28MA6 Peptidase M20 n=1 Tax=Jannaschia sp. CCS1 RepID=Q28MA6_JANSC Length = 470 Score = 55.1 bits (131), Expect = 3e-06 Identities = 30/71 (42%), Positives = 41/71 (57%) Frame = +1 Query: 310 STNFTAVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNA 489 S + AV + + H L L DL+RIPS+S + +HA D RAA +W + LGF +A Sbjct: 4 SPDLQAVLDYADAHMNDSLARLFDLVRIPSVSTVPAHAGDCRAAAQWLSDQLNDLGF-DA 62 Query: 490 EVLENGGHPVV 522 V GGHP+V Sbjct: 63 SVRPTGGHPMV 73 [199][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P +P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPEPPPQP 369 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 191 RPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 +PPP PPPPP PPPPPPP P PPP P P Sbjct: 320 QPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 [200][TOP] >UniRef100_A8L0S9 Serine/threonine protein kinase with FHA domain n=1 Tax=Frankia sp. EAN1pec RepID=A8L0S9_FRASN Length = 1108 Score = 55.1 bits (131), Expect = 3e-06 Identities = 38/106 (35%), Positives = 48/106 (45%), Gaps = 9/106 (8%) Frame = +2 Query: 179 RARRRPPPMPPPPPLPPPPP--------PPHSLPTP-PPLAPTRPWALKSLRCRRTSRPW 331 +A PPP PP PP PP PP S P P PP +P P AL R + RP Sbjct: 332 QATSTPPPAPPAPPAPPAPPATPASGWWQAASAPPPTPPASPATPTALFETRHHQPKRPA 391 Query: 332 TAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 TA + T + +P+ + P P +PT GPP P +PP Sbjct: 392 TATPSPTTQGPGSPT----SGLPPTAQAPGKPTSGPP---PTALPP 430 [201][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P +P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPQP 46 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 [202][TOP] >UniRef100_C5X6V4 Putative uncharacterized protein Sb02g031210 n=1 Tax=Sorghum bicolor RepID=C5X6V4_SORBI Length = 666 Score = 55.1 bits (131), Expect = 3e-06 Identities = 37/95 (38%), Positives = 41/95 (43%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPP PPPPPPP P PPPL+P+ T+R WT T Sbjct: 76 PPPSPPPPATPPPPPPPP--PPPPPLSPS-----------PTTRSWT-----------TN 111 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWD 478 S + AS P PP PP MP WD Sbjct: 112 SSSISASTILPP---------PP---PPPMPSSWD 134 [203][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 55.1 bits (131), Expect = 3e-06 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 4/96 (4%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPH----SLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRH 361 PPP PPPPP PPPPPPP P+PPP +P P P + + + Sbjct: 423 PPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAP 482 Query: 362 T*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 PS + +P P P+ P+ PP PP P Sbjct: 483 PLPPSPPPPSPYPPSPAPPVPPSPAPPSPEPPSPAP 518 [204][TOP] >UniRef100_C3ZR57 Putative uncharacterized protein (Fragment) n=1 Tax=Branchiostoma floridae RepID=C3ZR57_BRAFL Length = 1018 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALK 298 PPP PPPPP PPPPPPP P PPPL ALK Sbjct: 575 PPPPPPPPPAPPPPPPPGMPPPPPPLPGAAMAALK 609 [205][TOP] >UniRef100_B6ACL7 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6ACL7_9CRYT Length = 506 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/45 (57%), Positives = 32/45 (71%), Gaps = 2/45 (4%) Frame = +2 Query: 194 PPPMPPP--PPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTS 322 PPP+PPP PPLPPP PPP P PPPL PTR L++ + ++TS Sbjct: 324 PPPLPPPLPPPLPPPLPPPLPPPLPPPLPPTR---LENQKIKQTS 365 [206][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPW 289 PPP PPPPP PPPPPPP P PPP P P+ Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPAPY 69 [207][TOP] >UniRef100_C5PHL5 Putative uncharacterized protein n=1 Tax=Coccidioides posadasii C735 delta SOWgp RepID=C5PHL5_COCP7 Length = 1016 Score = 55.1 bits (131), Expect = 3e-06 Identities = 33/67 (49%), Positives = 35/67 (52%), Gaps = 15/67 (22%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHS-------------LPTP--PPLAPTRPWALKSLRCRRTSRP 328 PPP PPPPP PPPPPPP S LPTP P + P P A S+R RR S Sbjct: 475 PPPPPPPPPPPPPPPPPPSAALPFSLPSSLPPLPTPIQPTITPNSPVA-PSVRARRLS-- 531 Query: 329 WTAGWNA 349 GWNA Sbjct: 532 ---GWNA 535 [208][TOP] >UniRef100_Q9Z0G8-2 Isoform 2 of WAS/WASL-interacting protein family member 3 n=2 Tax=Rattus norvegicus RepID=Q9Z0G8-2 Length = 451 Score = 55.1 bits (131), Expect = 3e-06 Identities = 40/100 (40%), Positives = 43/100 (43%), Gaps = 4/100 (4%) Frame = +2 Query: 182 ARRRPP----PMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNA 349 AR PP P PPPP PPPPPPP P PPPL P P S+ P T G Sbjct: 163 ARPVPPRPSVPAPPPPTTPPPPPPPPPPPPPPPLPPASPIKAPSV---SPPVPPTKG--- 216 Query: 350 TVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 PS A +PC P P PP PP +PP Sbjct: 217 ------NPS----AVPAPIPCVPPLP---PPPPTPPPLPP 243 [209][TOP] >UniRef100_Q9Z0G8 WAS/WASL-interacting protein family member 3 n=2 Tax=Rattus norvegicus RepID=WIPF3_RAT Length = 485 Score = 55.1 bits (131), Expect = 3e-06 Identities = 40/100 (40%), Positives = 43/100 (43%), Gaps = 4/100 (4%) Frame = +2 Query: 182 ARRRPP----PMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNA 349 AR PP P PPPP PPPPPPP P PPPL P P S+ P T G Sbjct: 163 ARPVPPRPSVPAPPPPTTPPPPPPPPPPPPPPPLPPASPIKAPSV---SPPVPPTKG--- 216 Query: 350 TVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 PS A +PC P P PP PP +PP Sbjct: 217 ------NPS----AVPAPIPCVPPLP---PPPPTPPPLPP 243 [210][TOP] >UniRef100_O14514 Brain-specific angiogenesis inhibitor 1 n=1 Tax=Homo sapiens RepID=BAI1_HUMAN Length = 1584 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/58 (44%), Positives = 29/58 (50%) Frame = +2 Query: 113 VAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 ++ P P RS R+ G PP PPPPP PPPPPP LP PP L P P Sbjct: 1380 LSTAPEASLPARSPPSRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPP 1437 [211][TOP] >UniRef100_B4LT77 GJ19953 n=1 Tax=Drosophila virilis RepID=B4LT77_DROVI Length = 609 Score = 48.1 bits (113), Expect(2) = 3e-06 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +2 Query: 206 PPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPPPP PPPPPPP + P PPP P P Sbjct: 497 PPPPPPPPPPPPPPTEPPPPPPPPPEP 523 Score = 26.6 bits (57), Expect(2) = 3e-06 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 192 DHHRCHHHHH 221 DHH HHHHH Sbjct: 484 DHHPHHHHHH 493 [212][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +2 Query: 191 RPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWA 292 RPPP PPPPP PPPPPPP P PPP P + W+ Sbjct: 26 RPPPPPPPPPPPPPPPPP---PPPPPPLPLQCWS 56 [213][TOP] >UniRef100_UPI0001552F36 PREDICTED: similar to SH3 domain binding protein n=1 Tax=Mus musculus RepID=UPI0001552F36 Length = 455 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPPL P Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPP 34 [214][TOP] >UniRef100_UPI0001552DAA PREDICTED: similar to CR16 n=1 Tax=Mus musculus RepID=UPI0001552DAA Length = 483 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPPL P Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPP 34 [215][TOP] >UniRef100_UPI00003684DA PREDICTED: fas ligand n=1 Tax=Pan troglodytes RepID=UPI00003684DA Length = 280 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +2 Query: 125 PARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPP-HSLPTPP 265 P PC ++ RR +RRPPP PPPPPLPPPPPPP LP PP Sbjct: 26 PGTVLPCPTSVPRR----PGQRRPPPPPPPPPLPPPPPPPLPPLPLPP 69 [216][TOP] >UniRef100_UPI0001B7AE60 UPI0001B7AE60 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7AE60 Length = 1992 Score = 54.7 bits (130), Expect = 4e-06 Identities = 33/98 (33%), Positives = 42/98 (42%), Gaps = 2/98 (2%) Frame = +2 Query: 182 ARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTS--RPWTAGWNATV 355 AR P PP P+PPPPPPP P PPP+ + ++K R S W + + Sbjct: 1518 ARSCVPMTRPPVPIPPPPPPPPPPPPPPPVIKPKTSSVKQERWDEDSFFGLWDTNDDQGL 1577 Query: 356 RHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 S P LP P+ P+ PP P MPP Sbjct: 1578 NSEFKRDTAAIPSAPVLPPPPVHPSIPPPGPMPMGMPP 1615 [217][TOP] >UniRef100_UPI0001B7AE51 UPI0001B7AE51 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7AE51 Length = 1377 Score = 54.7 bits (130), Expect = 4e-06 Identities = 33/98 (33%), Positives = 42/98 (42%), Gaps = 2/98 (2%) Frame = +2 Query: 182 ARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTS--RPWTAGWNATV 355 AR P PP P+PPPPPPP P PPP+ + ++K R S W + + Sbjct: 767 ARSCVPMTRPPVPIPPPPPPPPPPPPPPPVIKPKTSSVKQERWDEDSFFGLWDTNDDQGL 826 Query: 356 RHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 S P LP P+ P+ PP P MPP Sbjct: 827 NSEFKRDTAAIPSAPVLPPPPVHPSIPPPGPMPMGMPP 864 [218][TOP] >UniRef100_Q4SUB2 Chromosome 3 SCAF13974, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SUB2_TETNG Length = 692 Score = 54.7 bits (130), Expect = 4e-06 Identities = 41/117 (35%), Positives = 49/117 (41%), Gaps = 13/117 (11%) Frame = +2 Query: 194 PPPMPPPPPLP-----PPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVR 358 PPP PPPPPLP PPPPPP P PPPL P + RP ++ ++ Sbjct: 117 PPPPPPPPPLPSFTLSPPPPPP--PPPPPPLPP-------------SPRPPPPPYSYAIK 161 Query: 359 HT*TPSRTCCASHPFLPCR-PMRPTCGP-------PVNGPPRMPPRWDSAMPRCSRT 505 H P+ S P P P P+ P P+ PP PP S P C T Sbjct: 162 HAGHPAAAPPLSSPSPPSSLPPHPSALPRSSLDDLPLPPPPPPPPPL-SCFPTCPAT 217 [219][TOP] >UniRef100_B0R0R1 Novel protein similar to human Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 (RAPH1) n=1 Tax=Danio rerio RepID=B0R0R1_DANRE Length = 1486 Score = 54.7 bits (130), Expect = 4e-06 Identities = 37/108 (34%), Positives = 43/108 (39%), Gaps = 16/108 (14%) Frame = +2 Query: 194 PPPMPPPPPL---------------PPPPPPPHSLPTPPPL-APTRPWALKSLRCRRTSR 325 PPP PPPPPL PPPPPPP LP P P+ P +P L Sbjct: 987 PPPPPPPPPLAPTLPPYQHVTSTSNPPPPPPPPPLPPPAPIHLPNQPAVLPKF------- 1039 Query: 326 PWTAGWNATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 +T G+ P + S LP P+ P PP PP PP Sbjct: 1040 -FTGGF--------PPQKAPKPSCGILPVSPVVPALQPPPPPPPPPPP 1078 [220][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPPLPPPPPPP P+PPP +P P Sbjct: 205 PPPPPPPPPLPPPPPPPPP-PSPPPPSPPPP 234 Score = 54.3 bits (129), Expect = 5e-06 Identities = 37/111 (33%), Positives = 41/111 (36%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPP PPP PPP S P P P P+ P P Sbjct: 2718 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP---------------------------PP 2750 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMPRCSRTVATQSSM 526 S + P LP P P PP + PP PP S T AT S+ Sbjct: 2751 SPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPPDRTSTSGTKATIGSI 2801 Score = 53.5 bits (127), Expect = 9e-06 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = +2 Query: 194 PPPMPPPPPLPPPP-PPPHSLPTPPPLAPTRP 286 PPP+PPPPP PPPP PPP S P PPP +P P Sbjct: 211 PPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPP 242 [221][TOP] >UniRef100_Q0RP29 GDP-D-mannose dehydratase, NAD(P)-binding (Partial match) n=1 Tax=Frankia alni ACN14a RepID=Q0RP29_FRAAA Length = 493 Score = 54.7 bits (130), Expect = 4e-06 Identities = 38/98 (38%), Positives = 39/98 (39%), Gaps = 3/98 (3%) Frame = +2 Query: 173 VGRARRRPPPMPPPPPLPPPPPPPHSLPTP-PPLAPTRPWALKSLRCRRT--SRPWTAGW 343 V R PPP P PPP P PPP P P P PP PT P RRT SRP + Sbjct: 393 VAPPRSAPPPRPTPPPRPTPPPRPAPPPRPTPPSHPTPP-------TRRTLPSRPASPSH 445 Query: 344 NATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPP 457 P R SH P RP P P G P Sbjct: 446 RTLAPRPAPPPRPTPPSHRSSPDRPTAPPADAPSAGLP 483 [222][TOP] >UniRef100_Q0RJE2 Putative magnesium-chelatase subunit n=1 Tax=Frankia alni ACN14a RepID=Q0RJE2_FRAAA Length = 857 Score = 54.7 bits (130), Expect = 4e-06 Identities = 34/83 (40%), Positives = 36/83 (43%), Gaps = 13/83 (15%) Frame = +2 Query: 77 PRRGSGPGGGGGVAVLPARRWPCRSA*LRRWLVGRARRR-----------PPPMPPPPPL 223 PR G GPGG G L + C S LR L GR P PPPP Sbjct: 765 PRGGRGPGGTAGRGGLASVVVDCESGFLRLGLAGRLAHALGGITIGLDALPLLTPPPPTT 824 Query: 224 PPPP--PPPHSLPTPPPLAPTRP 286 PPPP PPP + P PP PT P Sbjct: 825 PPPPTTPPPPTTPPPPTTRPTPP 847 [223][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = +2 Query: 164 RWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWA 292 R+ G PPP PPPPP PPPPPPP P PPP P +P A Sbjct: 235 RYAFGAEPAAPPPPPPPPPPPPPPPPPP--PPPPPPPPAKPAA 275 [224][TOP] >UniRef100_Q016J6 Far upstream element binding protein 2 (ISS) n=1 Tax=Ostreococcus tauri RepID=Q016J6_OSTTA Length = 561 Score = 54.7 bits (130), Expect = 4e-06 Identities = 36/73 (49%), Positives = 40/73 (54%), Gaps = 6/73 (8%) Frame = -2 Query: 267 GGGVGRE*GGGGG--GGSGGGGGIGGGRRRARPTSQRRN*AERHGQRRAG----NTATPP 106 GGG GRE GG GG GG G GG GGG R + P +RR+ ER G R G + PP Sbjct: 52 GGGRGRESGGRGGRGGGRWGNGGRGGG-RGSGPREERRDDRERGGADRWGPPRDDRRAPP 110 Query: 105 PPPGPEPRRGPRR 67 PP G RR RR Sbjct: 111 PPSGGWDRRDDRR 123 [225][TOP] >UniRef100_C1E755 Putative uncharacterized protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E755_9CHLO Length = 336 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = +2 Query: 188 RRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 R+PPP PPPPP PPP PPP P PPP +P P Sbjct: 45 RQPPPPPPPPPPPPPQPPPPPRPPPPPRSPPPP 77 [226][TOP] >UniRef100_Q5CID8 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis RepID=Q5CID8_CRYHO Length = 1922 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPT 280 PP PPPPP PPPPPPP S P+PPP PT Sbjct: 1291 PPHSPPPPPPPPPPPPPSSPPSPPPSPPT 1319 [227][TOP] >UniRef100_C5K928 Merozoite surface protein 2, putative (Fragment) n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5K928_9ALVE Length = 57 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -2 Query: 312 RQRSDFSAHGRVGASGGGVGRE*GGGGGGGSGGGGGIGGG 193 RQ++ SAHG G GGG G GGGGGGG GGGGG GGG Sbjct: 9 RQKASPSAHGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 48 [228][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLR 307 PPP PPPPP PPPPPPP P PPP P P +S R Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFR 59 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 [229][TOP] >UniRef100_B4M7B5 GJ16487 n=1 Tax=Drosophila virilis RepID=B4M7B5_DROVI Length = 880 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/49 (46%), Positives = 29/49 (59%) Frame = +2 Query: 182 ARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRP 328 A+ +PPP PPPPP PPPPPPP LP PP P + S + + + P Sbjct: 803 AQSKPPPPPPPPPPPPPPPPPPPLPLPPQPLPLSSASSSSSQSGQVTAP 851 [230][TOP] >UniRef100_P0CB49 YLP motif-containing protein 1 n=1 Tax=Rattus norvegicus RepID=YLPM1_RAT Length = 1376 Score = 54.7 bits (130), Expect = 4e-06 Identities = 33/98 (33%), Positives = 42/98 (42%), Gaps = 2/98 (2%) Frame = +2 Query: 182 ARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTS--RPWTAGWNATV 355 AR P PP P+PPPPPPP P PPP+ + ++K R S W + + Sbjct: 766 ARSCVPMTRPPVPIPPPPPPPPPPPPPPPVIKPKTSSVKQERWDEDSFFGLWDTNDDQGL 825 Query: 356 RHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 S P LP P+ P+ PP P MPP Sbjct: 826 NSEFKRDTAAIPSAPVLPPPPVHPSIPPPGPMPMGMPP 863 [231][TOP] >UniRef100_P0C7L0-2 Isoform 2 of WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=P0C7L0-2 Length = 451 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPPL P Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPP 34 [232][TOP] >UniRef100_P0C7L0 WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=WIPF3_MOUSE Length = 485 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPPL P Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPP 34 [233][TOP] >UniRef100_Q9BDN1 Tumor necrosis factor ligand superfamily member 6, soluble form n=1 Tax=Cercocebus torquatus atys RepID=TNFL6_CERTO Length = 280 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +2 Query: 125 PARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPP-HSLPTPP 265 P PC ++ RR +RRPPP PPPPPLPPPPPPP LP PP Sbjct: 26 PGTVLPCPTSVPRR----PGQRRPPPPPPPPPLPPPPPPPLPPLPLPP 69 [234][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 173 VGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAP 277 VG PPP+PPPPP PPPPPPP P PPP P Sbjct: 52 VGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP +P P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPP 93 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P+PPP P P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 70 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 [235][TOP] >UniRef100_B5DWL9 GA27313 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DWL9_DROPS Length = 574 Score = 49.3 bits (116), Expect(2) = 4e-06 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPP H PP+ P P Sbjct: 145 PPPPPPPPPPPPPPPPHHHHHPHPPIIPPPP 175 Score = 25.0 bits (53), Expect(2) = 4e-06 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +3 Query: 75 GPVGVPALVAAAE*PYCPPGAGRVALLSCGAGSSGGRGGDHHRCHHHH 218 GP G+P P PPG + GDH HHHH Sbjct: 113 GPPGLPG-------PIGPPGPSKYR-------------GDHDHHHHHH 140 [236][TOP] >UniRef100_UPI0001B4B1B1 M20/M25/M40 family peptidase n=1 Tax=Streptomyces hygroscopicus ATCC 53653 RepID=UPI0001B4B1B1 Length = 467 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/67 (41%), Positives = 39/67 (58%) Frame = +1 Query: 325 AVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLEN 504 AV +++ H LD L LRIPS+SA + A DVR + EW A++ T+ GF E+ E Sbjct: 10 AVRAFVDDHYAAFLDDLGAWLRIPSVSADPARAGDVRRSAEWLASHLTATGFPEVEIWET 69 Query: 505 GGHPVVY 525 G P V+ Sbjct: 70 PGAPAVF 76 [237][TOP] >UniRef100_UPI0001AED349 peptidase n=1 Tax=Streptomyces albus J1074 RepID=UPI0001AED349 Length = 467 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/67 (41%), Positives = 35/67 (52%) Frame = +1 Query: 325 AVDGWLERHRPTHLDALKDLLRIPSISALSSHAPDVRAAGEWTAAYATSLGFRNAEVLEN 504 AV ++E HR LD L + LRIPS+SA H DV + EW AA GF E+ Sbjct: 8 AVRTYIENHRAAFLDDLAEWLRIPSVSAQPEHGADVLRSAEWLAAKLRETGFPVVEIWPT 67 Query: 505 GGHPVVY 525 G P V+ Sbjct: 68 DGAPAVF 74 [238][TOP] >UniRef100_UPI00017C32AF PREDICTED: similar to YLP motif containing 1 n=1 Tax=Bos taurus RepID=UPI00017C32AF Length = 2096 Score = 54.3 bits (129), Expect = 5e-06 Identities = 37/111 (33%), Positives = 46/111 (41%), Gaps = 2/111 (1%) Frame = +2 Query: 182 ARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTS--RPWTAGWNATV 355 AR P PP P+PPPPPPP P PPP+ + A++ R S W + Sbjct: 1531 ARSSVPVTRPPIPIPPPPPPPPPPPPPPPVIKPQTSAVEQERWDEDSFYGLWDTNDEQGL 1590 Query: 356 RHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPPRWDSAMPRCSRTV 508 S P LP P+ P+ PP P MPP S P +TV Sbjct: 1591 NSEFKSEPAAIPSAPVLPPPPVHPSIPPPGPMPMGMPPM--SKPPPVQQTV 1639 [239][TOP] >UniRef100_UPI0000E24D2B PREDICTED: SET binding protein 1 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E24D2B Length = 1596 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = +2 Query: 170 LVGRARRRPP-PMPPPPPLPPPPPPPHSLPTPPPLAPT 280 ++ AR PP P PPPPPLPPPPPPP LP PPPL T Sbjct: 1512 VIHMAREAPPLPPPPPPPLPPPPPPP--LPPPPPLPKT 1547 [240][TOP] >UniRef100_UPI0000E22531 PREDICTED: hypothetical protein n=1 Tax=Pan troglodytes RepID=UPI0000E22531 Length = 256 Score = 54.3 bits (129), Expect = 5e-06 Identities = 38/93 (40%), Positives = 41/93 (44%), Gaps = 3/93 (3%) Frame = -2 Query: 327 GREVRRQRSDFSAHGRVGASGGGVGRE*GGGGGGGSGGGGGIGGGRRRARPTSQRRN*AE 148 GR S VG GGG GR GG GGG GGGGG GG R P Sbjct: 14 GRRSAAAASRAPERSHVGCRGGGTGRGGGGDGGGEGGGGGGDGG---RGAP--------- 61 Query: 147 RHGQRRAGNTATPPPPP--GPEPR-RGPRR*GR 58 G+ AG+ PP PP P PR PR+ GR Sbjct: 62 -RGRAPAGHAPPPPQPPRAPPAPRENSPRKPGR 93 [241][TOP] >UniRef100_UPI0000E20C65 PREDICTED: similar to Family with sequence similarity 44, member B n=1 Tax=Pan troglodytes RepID=UPI0000E20C65 Length = 282 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P+PPPL P P Sbjct: 37 PPPPPPPPPSPPPPPPP---PSPPPLPPWGP 64 [242][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 54.3 bits (129), Expect = 5e-06 Identities = 36/102 (35%), Positives = 45/102 (44%), Gaps = 10/102 (9%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTP----PPLAPTRPWALKSLRCRRTSRP---WTAGW--- 343 PPP PPPPP PPPPPPP P P PP P++ L ++ P W W Sbjct: 387 PPPAPPPPP-PPPPPPPRPPPPPAIVRPPAEPSKEVLLSTVVLLLMLVPVLLWWVWWLCC 445 Query: 344 NATVRHT*TPSRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 + V+ P+ SH P + +P PP PP PP Sbjct: 446 RSPVKARPAPAPQPKVSHSLYPEKKEKP---PPPVPPPTPPP 484 [243][TOP] >UniRef100_UPI0000D9B773 PREDICTED: similar to CG5514-PB, isoform B n=1 Tax=Macaca mulatta RepID=UPI0000D9B773 Length = 283 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = +2 Query: 170 LVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 L+ ++ PPP PPPPP P PPPPP P+PPPL P P Sbjct: 27 LLSQSWPSPPPPPPPPPPPSPPPPPPPPPSPPPLPPWGP 65 [244][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = +2 Query: 188 RRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 R PP+PPPPP PPPPPPP P PPP P P Sbjct: 1469 RETPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 1501 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 1478 PPPPPPPPPPPPPPPPPPPPPPPPPPLPRTP 1508 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 PPP PPPPP PPPPPPP P PPP P P Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 1505 Score = 53.5 bits (127), Expect = 9e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = +2 Query: 170 LVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 ++ AR PP PPPPP PPPPPPP P PPP P P Sbjct: 1464 VIHMARETPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1502 [245][TOP] >UniRef100_Q6DII2 Splicing factor, arginine/serine-rich 1 n=2 Tax=Xenopus (Silurana) tropicalis RepID=SFRS1_XENTR Length = 267 Score = 54.3 bits (129), Expect = 5e-06 Identities = 33/70 (47%), Positives = 37/70 (52%), Gaps = 10/70 (14%) Frame = -2 Query: 342 QPAVHGRE----------VRRQRSDFSAHGRVGASGGGVGRE*GGGGGGGSGGGGGIGGG 193 + AV+GR+ V RS A GR G GGG G GGGGGGG GGGGG G Sbjct: 68 EDAVYGRDGYDYDGYRLRVEFPRSGRGAGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGAP 127 Query: 192 RRRARPTSQR 163 R R P S+R Sbjct: 128 RGRYGPPSRR 137 [246][TOP] >UniRef100_UPI0001B7C13A Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C13A Length = 4226 Score = 54.3 bits (129), Expect = 5e-06 Identities = 33/92 (35%), Positives = 35/92 (38%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PP +P P K + T V T Sbjct: 1494 PPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKKKLAVAATVTSTTIVTTHVDALTTV 1553 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 LP M T PPV P P Sbjct: 1554 EAAAARRSNGLPATKMCATAPPPVPPKPSQIP 1585 [247][TOP] >UniRef100_UPI0001B7C139 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C139 Length = 4330 Score = 54.3 bits (129), Expect = 5e-06 Identities = 33/92 (35%), Positives = 35/92 (38%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PP +P P K + T V T Sbjct: 1490 PPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKKKLAVAATVTSTTIVTTHVDALTTV 1549 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 LP M T PPV P P Sbjct: 1550 EAAAARRSNGLPATKMCATAPPPVPPKPSQIP 1581 [248][TOP] >UniRef100_UPI0001B7C138 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C138 Length = 4129 Score = 54.3 bits (129), Expect = 5e-06 Identities = 33/92 (35%), Positives = 35/92 (38%) Frame = +2 Query: 194 PPPMPPPPPLPPPPPPPHSLPTPPPLAPTRPWALKSLRCRRTSRPWTAGWNATVRHT*TP 373 PPP PPPPP PPPPPPP P PP +P P K + T V T Sbjct: 1490 PPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKKKLAVAATVTSTTIVTTHVDALTTV 1549 Query: 374 SRTCCASHPFLPCRPMRPTCGPPVNGPPRMPP 469 LP M T PPV P P Sbjct: 1550 EAAAARRSNGLPATKMCATAPPPVPPKPSQIP 1581 [249][TOP] >UniRef100_UPI00015DEA40 brain-specific angiogenesis inhibitor 1 n=1 Tax=Mus musculus RepID=UPI00015DEA40 Length = 541 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/58 (43%), Positives = 30/58 (51%) Frame = +2 Query: 113 VAVLPARRWPCRSA*LRRWLVGRARRRPPPMPPPPPLPPPPPPPHSLPTPPPLAPTRP 286 +++ P +P RS R G PP PPPPP PPPPPP +P PP L P P Sbjct: 337 LSMAPDASFPTRSPPAREPPGGAPPEVPPVQPPPPPPPPPPPPQQPIPPPPTLEPAPP 394 [250][TOP] >UniRef100_Q9Y6X0 SET-binding protein n=2 Tax=Homo sapiens RepID=SETBP_HUMAN Length = 1542 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = +2 Query: 170 LVGRARRRPP-PMPPPPPLPPPPPPPHSLPTPPPLAPT 280 ++ AR PP P PPPPPLPPPPPPP LP PPPL T Sbjct: 1458 VIHMAREAPPLPPPPPPPLPPPPPPP--LPPPPPLPKT 1493