[UP]
[1][TOP] >UniRef100_B1ZXF5 Fibronectin type III domain protein n=1 Tax=Opitutus terrae PB90-1 RepID=B1ZXF5_OPITP Length = 2170 Score = 74.3 bits (181), Expect = 4e-12 Identities = 46/127 (36%), Positives = 66/127 (51%), Gaps = 9/127 (7%) Frame = +2 Query: 101 ATPNPGGILAPVKLNVGGPAL-----SGYVPDGPYVTSTTYTGTIVKPVAGTSNDALYHT 265 ATP GG +++N GG + + + D Y T TY+ + +AGT++D L+ T Sbjct: 1570 ATPPSGGASTVIRVNAGGSSYVDGAGNTWSADTGYNTGGTYSVSSSTAIAGTTDDPLFRT 1629 Query: 266 FRFGKTVA----YALPLPTGTYTVSLLFAEVYTYTSAIGKRVFDIAIGDAAAAPVLLHDY 433 R+ + A Y+ +P G Y V LLFAE Y +GKRVFD+ I A A D Sbjct: 1630 ERYDASTAPELTYSFAVPNGNYLVRLLFAENYGSAKGVGKRVFDVDIEGARA----FEDV 1685 Query: 434 DLFADAG 454 D++A AG Sbjct: 1686 DIYAQAG 1692 Score = 62.0 bits (149), Expect = 2e-08 Identities = 56/161 (34%), Positives = 69/161 (42%), Gaps = 5/161 (3%) Frame = +2 Query: 47 ASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDGPYVTSTTYTGTIVK 226 AS TAS GP+ PT N GG A GY G Y S + T Sbjct: 2001 ASTATISTASSGPTL-PTIRVNAGGSSYVDSAGNTWSADHGYNTGGKYSVSGSTT----- 2054 Query: 227 PVAGTSNDALYHTFRFGKTVA----YALPLPTGTYTVSLLFAEVYTYTSAIGKRVFDIAI 394 + TS+ L+ + R+ + + Y+ +P GTY V L FAE Y G RVFDI I Sbjct: 2055 -ITNTSDPTLFRSERYDASTSPELTYSFTVPNGTYVVRLYFAENYASAKGAGLRVFDIDI 2113 Query: 395 GDAAAAPVLLHDYDLFADAGEAT-AVAKVFDVTVTSAPLII 514 A A D D+F AG A A+ VTVT L I Sbjct: 2114 EGARA----FEDVDIFVQAGGANRAMMLENTVTVTDGQLNI 2150 [2][TOP] >UniRef100_C6MS89 Fibronectin type III domain protein n=1 Tax=Geobacter sp. M18 RepID=C6MS89_9DELT Length = 435 Score = 68.2 bits (165), Expect = 3e-10 Identities = 47/134 (35%), Positives = 67/134 (50%), Gaps = 10/134 (7%) Frame = +2 Query: 143 NVGGPALSG-----YVPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVA-----Y 292 N GG A +G Y D Y T T I ++GT++D LY T+R+G T A Y Sbjct: 293 NAGGSAYTGGDRIAYKADSYYSGGTAKT--ITATISGTTDDMLYQTYRYGSTTAGSVFSY 350 Query: 293 ALPLPTGTYTVSLLFAEVYTYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVA 472 +PL G Y+V+L FA+ +GKRVFD+ + +L ++D++A AG TA Sbjct: 351 NVPLANGNYSVTLKFAD----NMGVGKRVFDVKM----EGTTVLSNFDIYAKAGNNTAYD 402 Query: 473 KVFDVTVTSAPLII 514 V+V L I Sbjct: 403 LTIPVSVADGVLNI 416 [3][TOP] >UniRef100_Q2JUL3 Putative lipoprotein n=1 Tax=Synechococcus sp. JA-3-3Ab RepID=Q2JUL3_SYNJA Length = 221 Score = 67.4 bits (163), Expect = 5e-10 Identities = 42/132 (31%), Positives = 58/132 (43%), Gaps = 5/132 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P G +P Sbjct: 80 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPAGPRITIPGLPA 139 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALY----HTFRFGKTVAYALPLPT-GTYTVSLLFAEV 346 G VT GT++ S D + T FG + +P+ G TV Sbjct: 140 GATVTIRQADGTVIATSTSVSGDVVIFPTSFTIPFGGQIRVTPAIPSPGPITVGGTTLST 199 Query: 347 YTYTSAIGKRVF 382 + T+ G + Sbjct: 200 FDNTTNPGSTTY 211 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +P TP+ +P PTPT +P P+ TPTATP P Sbjct: 44 TPTPTPTPTPVPTPTPTPTPTPTPTPTPTPTPTATPTP 81 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+P +PT TP+ +P PTPT +P P+ATPT TP P Sbjct: 48 TPTPTPVPTPTPTPTPTPTPTPTPTPTPTATPTPTPTP 85 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPTA+P P+ TPT TP P Sbjct: 55 PTPTPTPTPTPTPTPTPTPTPTATPTPTPTPTPTPTP 91 [4][TOP] >UniRef100_C6CR85 APHP domain protein n=1 Tax=Paenibacillus sp. JDR-2 RepID=C6CR85_PAESJ Length = 1297 Score = 65.5 bits (158), Expect = 2e-09 Identities = 36/89 (40%), Positives = 47/89 (52%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P SG V Sbjct: 317 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTATPTPTPTPTPTPTPPASGNVAL 376 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTF 268 G +T+++ T T VA ND T+ Sbjct: 377 GKTITASSSTFTY---VAANGNDGSTSTY 402 [5][TOP] >UniRef100_B2T117 Putative uncharacterized protein n=1 Tax=Burkholderia phytofirmans PsJN RepID=B2T117_BURPP Length = 547 Score = 65.1 bits (157), Expect = 3e-09 Identities = 31/67 (46%), Positives = 42/67 (62%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P AP+ + +G + Sbjct: 142 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSNTAPITIE----RWTGNYAN 197 Query: 182 GPYVTST 202 PYVT+T Sbjct: 198 MPYVTAT 204 Score = 60.8 bits (146), Expect = 5e-08 Identities = 49/146 (33%), Positives = 64/146 (43%), Gaps = 9/146 (6%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+P +PT TP+ +P+PTPT +P P+ TPT TP P P P + Sbjct: 102 TPTPTPMPTPTPTPAPAPKPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 161 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYA-LPLPTGTYTV--------SLL 334 P T T T T TSN A R+ T YA +P T T + Sbjct: 162 TPTPTPTP-TPTPTPTPTPTSNTAPITIERW--TGNYANMPYVTATICIPGVQGSNQCAT 218 Query: 335 FAEVYTYTSAIGKRVFDIAIGDAAAA 412 + T ++G RV A+G A AA Sbjct: 219 VDHMQLDTGSVGVRVLGSALGSALAA 244 [6][TOP] >UniRef100_Q21Y38 Cytochrome c, class I n=1 Tax=Rhodoferax ferrireducens T118 RepID=Q21Y38_RHOFD Length = 475 Score = 64.7 bits (156), Expect = 3e-09 Identities = 46/142 (32%), Positives = 65/142 (45%), Gaps = 15/142 (10%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV--------KLNVGGP 157 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P + + + P Sbjct: 274 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPAAQTITFTSPGNQTMGIATP 333 Query: 158 ALSGYVPDGPYVTST-------TYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGT 316 ALS G VT T +GT++ VA S + G T A T Sbjct: 334 ALSATSTSGLTVTFASTTPSVCTVSGTVLTLVAAGS--CTVSANQAGNTSFAAAAEVLRT 391 Query: 317 YTVSLLFAEVYTYTSAIGKRVF 382 +TV+ V ++A GK ++ Sbjct: 392 FTVAAALPPVVVASAAAGKLLY 413 [7][TOP] >UniRef100_C0UYE4 Glucose/sorbosone dehydrogenase n=1 Tax=Thermobaculum terrenum ATCC BAA-798 RepID=C0UYE4_9BACT Length = 1740 Score = 64.7 bits (156), Expect = 3e-09 Identities = 56/181 (30%), Positives = 76/181 (41%), Gaps = 18/181 (9%) Frame = +2 Query: 20 TLSPTSTPSASPEPTPTASPGPSATPTATPNP-----------GGILAPVKLNVGGPALS 166 TL PT+ + T G A NP A V + V S Sbjct: 1546 TLDPTANLEPNTTYVVTVKGGAGGITDAIGNPLATDRTWSFTTASATAFVPIRVDSGNTS 1605 Query: 167 GYVPDGPYVTS--TTYTGTIV-----KPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTV 325 Y G V S T YTG V +AGT++D LY R G +Y +P GTYTV Sbjct: 1606 SYTDTGGNVWSADTGYTGGSVTKGTTSDIAGTNDDRLYQKGRSGAPFSYRFQVPNGTYTV 1665 Query: 326 SLLFAEVYTYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAP 505 L FAE TY + G+RVF++ I + +L ++D+ TA+ + F V V+ Sbjct: 1666 RLKFAE--TYWTRAGQRVFNVNIEGSR----VLSNFDILQTVAPKTALDRTFKVEVSDGR 1719 Query: 506 L 508 L Sbjct: 1720 L 1720 [8][TOP] >UniRef100_C5C032 PA14 domain protein n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C032_BEUC1 Length = 3802 Score = 64.3 bits (155), Expect = 5e-09 Identities = 47/140 (33%), Positives = 66/140 (47%), Gaps = 13/140 (9%) Frame = +2 Query: 134 VKLNVGGPALS----GYVPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK----TVA 289 +++N GGPA++ + D +V TY V +AGT+ D LY T R T Sbjct: 3646 IRINAGGPAVTVDGVSWAADTYFVGGKTYANAQVTQIAGTTQDVLYLTERSATANLGTFG 3705 Query: 290 YALPLPTGTYTVSLLFAEVYTYTS-----AIGKRVFDIAIGDAAAAPVLLHDYDLFADAG 454 Y +P+P GTY V+L +AE+Y + GKRVF + + V + + DL A Sbjct: 3706 YDIPVPDGTYEVTLHYAEIYHGATGGGAGGTGKRVFSV---NLEGGGVEVANLDLNAVVA 3762 Query: 455 EATAVAKVFDVTVTSAPLII 514 TA VTVT L I Sbjct: 3763 PMTAYTTTHTVTVTGGNLDI 3782 [9][TOP] >UniRef100_B4BGA9 S-layer domain protein n=1 Tax=Clostridium thermocellum DSM 4150 RepID=B4BGA9_CLOTM Length = 1101 Score = 64.3 bits (155), Expect = 5e-09 Identities = 29/44 (65%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTPSPT SPT TPS +P PTPT SP PS TPT TP P P Sbjct: 571 TPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPTPTPSSTPTP 614 Score = 61.2 bits (147), Expect = 4e-08 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTPSPT SPT TPS +P PTPT +P PS+TPT P+P P Sbjct: 581 TPTPSPTPSPTPTPSPTPSPTPTPTPTPSSTPTPEPSPTSTPTP 624 Score = 55.8 bits (133), Expect = 2e-06 Identities = 32/92 (34%), Positives = 39/92 (42%), Gaps = 16/92 (17%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPAL------ 163 TP P P SPT TP P P+PT P P+ TPT PNP P+ V P L Sbjct: 713 TPEPEPEPSPTPTPEPEPSPSPTPVPTPTPTPTPAPNPAPEPVPISTPVPEPILIPTPTP 772 Query: 164 ----------SGYVPDGPYVTSTTYTGTIVKP 229 + V PY++ TG +KP Sbjct: 773 TMTPMPTPTPTLEVKSDPYLSDLVVTGAKLKP 804 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT SPT TP+ +P TPT P P++TPT P P Sbjct: 591 TPTPSPTPSPTPTPTPTPSSTPTPEPSPTSTPTPEPEP 628 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP P PTSTP+ PEP+PT +P P +PT+TP P Sbjct: 665 TPTPEPEPEPTSTPTPEPEPSPTPTPEPEPSPTSTPTP 702 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 26/38 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP P PTSTP+ PEP+PT +P P +PT TP P Sbjct: 621 TPTPEPEPEPTSTPTPEPEPSPTPTPEPEPSPTPTPEP 658 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/38 (57%), Positives = 26/38 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP P SPTSTP+ PEP PT++P P P+ TP P Sbjct: 653 TPTPEPEPSPTSTPTPEPEPEPTSTPTPEPEPSPTPTP 690 [10][TOP] >UniRef100_C6D3Q5 APHP domain protein n=1 Tax=Paenibacillus sp. JDR-2 RepID=C6D3Q5_PAESJ Length = 1293 Score = 63.5 bits (153), Expect = 8e-09 Identities = 31/86 (36%), Positives = 46/86 (53%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 +PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P + + Sbjct: 305 SPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPPATDNIAI 364 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALY 259 G +T+++ T V A +N + Y Sbjct: 365 GKTMTASSNTQAFVASNANDNNTSTY 390 [11][TOP] >UniRef100_A5FCJ0 Candidate beta-glycosidase; Glycoside hydrolase family 2 n=1 Tax=Flavobacterium johnsoniae UW101 RepID=A5FCJ0_FLAJ1 Length = 1175 Score = 63.5 bits (153), Expect = 8e-09 Identities = 38/105 (36%), Positives = 56/105 (53%), Gaps = 5/105 (4%) Frame = +2 Query: 215 TIVKPVAGTSNDALYHTFRFG-KTVAYALPLPTGTYTVSLLFAEVYTYTSA----IGKRV 379 T P+ GT + L+ +FR+G + Y P P G Y V L F E + T G R+ Sbjct: 777 TTFDPINGTKDPELFQSFRYGVDKLRYEFPAPDGEYLVELYFTEPWYGTGGGLDCKGWRL 836 Query: 380 FDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 FD+AI D V+L D+D++A+AG A+ K F V T+ ++I Sbjct: 837 FDVAINDN----VVLKDFDIWAEAGHDNALKKTFKVKSTNGKIVI 877 [12][TOP] >UniRef100_A3DIC9 S-layer-like domain containing protein n=1 Tax=Clostridium thermocellum ATCC 27405 RepID=A3DIC9_CLOTH Length = 1013 Score = 63.5 bits (153), Expect = 8e-09 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT SPT TPS +P PTPT +P PS+TPT+TP P Sbjct: 571 TPTPSPTPSPTPTPSPTPSPTPTPTPTPSSTPTSTPTP 608 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT SPT TP+ +P TPT++P P +PT+TP P Sbjct: 581 TPTPSPTPSPTPTPTPTPSSTPTSTPTPEPSPTSTPTP 618 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/44 (52%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 +PTPSPT +PT TPS++P TPT P P++TPT P+P P Sbjct: 585 SPTPSPTPTPTPTPSSTPTSTPTPEPSPTSTPTPEPSPTSTPTP 628 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/44 (52%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 +PTPSPT +P+ TPS +P PTPT S P++TPT P+P P Sbjct: 575 SPTPSPTPTPSPTPSPTPTPTPTPSSTPTSTPTPEPSPTSTPTP 618 [13][TOP] >UniRef100_C7HD87 Type 3a cellulose-binding domain protein (Fragment) n=1 Tax=Clostridium thermocellum DSM 2360 RepID=C7HD87_CLOTM Length = 662 Score = 63.5 bits (153), Expect = 8e-09 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT SPT TPS +P PTPT +P PS+TPT+TP P Sbjct: 581 TPTPSPTPSPTPTPSPTPSPTPTPTPTPSSTPTSTPTP 618 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/38 (73%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT SPT TPS +P PTPT SP PS TPT TP P Sbjct: 571 TPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPTPTP 608 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT SPT TP+ +P TPT++P P +PT+TP P Sbjct: 591 TPTPSPTPSPTPTPTPTPSSTPTSTPTPEPSPTSTPTP 628 Score = 54.7 bits (130), Expect = 4e-06 Identities = 28/67 (41%), Positives = 35/67 (52%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 +PTPSPT +PT TPS++P TPT P P++TPT P P P P + Sbjct: 595 SPTPSPTPTPTPTPSSTPTSTPTPEPSPTSTPTPEPEPEPTSTPTPEPEPEPTSTPTPEP 654 Query: 182 GPYVTST 202 P TST Sbjct: 655 EPEPTST 661 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/44 (52%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 +PTPSPT +P+ TPS +P PTPT S P++TPT P+P P Sbjct: 585 SPTPSPTPTPSPTPSPTPTPTPTPSSTPTSTPTPEPSPTSTPTP 628 [14][TOP] >UniRef100_C1RI33 Esterase/lipase n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RI33_9CELL Length = 471 Score = 63.5 bits (153), Expect = 8e-09 Identities = 33/78 (42%), Positives = 42/78 (53%), Gaps = 21/78 (26%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN---------------------PG 118 TPTP+PT SPT +P+ SP PTPT SP PS TP+ TP P Sbjct: 335 TPTPTPTTSPTPSPTDSPTPTPTFSPTPSPTPSPTPTPTPTPGTGNGCSATYRVVNAWPN 394 Query: 119 GILAPVKLNVGGPALSGY 172 G ++ VK+ GG +LSG+ Sbjct: 395 GFVSEVKVTAGGASLSGW 412 [15][TOP] >UniRef100_Q5NW24 Alkaline serine protease n=2 Tax=Archaea RepID=Q5NW24_9ARCH Length = 795 Score = 63.2 bits (152), Expect = 1e-08 Identities = 38/114 (33%), Positives = 54/114 (47%), Gaps = 3/114 (2%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 T TP+PT +PT+TP+A+P TPT +P P+ TPT TP P P P ++ V Sbjct: 409 TATPTPTPTPTATPTATPTATPTPTPTPTVTPTVTPTPTATPTPTPTPTPTPTVTPTVTP 468 Query: 182 GPYVTST-TYTGTIVKPVAGTSNDALYHTF--RFGKTVAYALPLPTGTYTVSLL 334 P T+T T T T T + TF +G + T T T +++ Sbjct: 469 TPTPTATPTATPTATPTPTPTPTPPVSKTFVSNYGSNTVSVIDQSTNTVTGTII 522 [16][TOP] >UniRef100_B9M0U3 Fibronectin type III domain protein n=1 Tax=Geobacter sp. FRC-32 RepID=B9M0U3_GEOSF Length = 575 Score = 62.8 bits (151), Expect = 1e-08 Identities = 39/115 (33%), Positives = 62/115 (53%) Frame = +2 Query: 170 YVPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVY 349 Y DG + ++ T +AGT+ND LY + R+G +Y +P G Y V+L FAE+ Sbjct: 451 YQADGRFSGGSSAKTTAT--IAGTTNDVLYQSERWGN-FSYTIPAANGNYLVTLKFAEI- 506 Query: 350 TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 Y SA G+RVF++AI ++ + D++A G+ A V VT T+ + + Sbjct: 507 -YFSAAGRRVFNVAIN----GQTVISNLDIYAKVGKNVAYDVVIPVTATNGAITV 556 Score = 58.5 bits (140), Expect = 2e-07 Identities = 39/136 (28%), Positives = 65/136 (47%), Gaps = 3/136 (2%) Frame = +2 Query: 116 GGILAPVKLNVGGPALS---GYVPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTV 286 G L N GG A + G + S + GT++D LY + R+G Sbjct: 203 GSTLKSFAANSGGAAFTDATGLIYGADSAFSGGSAAKTTAAIGGTTDDTLYQSERWGN-F 261 Query: 287 AYALPLPTGTYTVSLLFAEVYTYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATA 466 +Y++P+ G Y+++L FAE+ Y SA G+RVF + + ++ + D+FA G+ A Sbjct: 262 SYSIPVANGNYSLTLKFAEI--YFSAAGQRVFSVTVN----GQTVISNLDIFAKVGKNVA 315 Query: 467 VAKVFDVTVTSAPLII 514 V + VT+ + I Sbjct: 316 YDVVIPINVTTGAVTI 331 [17][TOP] >UniRef100_C4EPQ0 Chitinase family 18 n=1 Tax=Streptosporangium roseum DSM 43021 RepID=C4EPQ0_STRRS Length = 662 Score = 62.8 bits (151), Expect = 1e-08 Identities = 46/156 (29%), Positives = 71/156 (45%), Gaps = 12/156 (7%) Frame = +2 Query: 77 PGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD----------GPYVTSTTY-TGTIV 223 P + TA + P++ N GG AL+ D G + T+Y +G+ Sbjct: 19 PLGAVVATAPGASAAVTVPLRANAGGSALTDAAGDQWVADKAYSSGDWGYQTSYGSGSTG 78 Query: 224 KPVAGTSNDALYHTFR-FGKTVAYALPLPTGTYTVSLLFAEVYTYTSAIGKRVFDIAIGD 400 +AGT++D+LY + F Y +P GTY V+L E + +A G+R FD+ + Sbjct: 79 GAIAGTTDDSLYQNYNTFNSWGGYRFDVPNGTYQVTLKMVE--DWANAAGQRKFDVRVEG 136 Query: 401 AAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPL 508 A L +D+FA G TA + F TV+ L Sbjct: 137 VNA----LTAFDIFASCGALTACDRTFPATVSDGAL 168 [18][TOP] >UniRef100_UPI00019669B8 hypothetical protein SUBVAR_01844 n=1 Tax=Subdoligranulum variabile DSM 15176 RepID=UPI00019669B8 Length = 231 Score = 62.4 bits (150), Expect = 2e-08 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 6/94 (6%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNV----GGPALSG 169 TPTP+P+ +P+ +P+A+PEPTP A+P P+ P +TP P AP + + G A + Sbjct: 112 TPTPTPSPTPSPSPTATPEPTPIATPQPTEAPVSTPAPAPAAAPAQQDAAVADNGGAAAA 171 Query: 170 YVPDGPYVTSTTYTG--TIVKPVAGTSNDALYHT 265 P TTYT + + +AG+ N + YH+ Sbjct: 172 QAP-----ADTTYTAPQSGMVYIAGSGNGSKYHS 200 [19][TOP] >UniRef100_C5BQU7 Endo-1,4-beta-xylanase n=1 Tax=Teredinibacter turnerae T7901 RepID=C5BQU7_TERTT Length = 1051 Score = 62.0 bits (149), Expect = 2e-08 Identities = 46/155 (29%), Positives = 83/155 (53%), Gaps = 8/155 (5%) Frame = +2 Query: 14 SPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS----GYVPD 181 S + + +S S+S + ++S S++ +++ + G V +N GG A + Y D Sbjct: 474 SSSSTSSSNSSSSSSSSSSSSSSSSSSSSSSSSSGSAQLVVAINAGGNATTYNGVQYQAD 533 Query: 182 GPY----VTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVY 349 Y V+STT P+AGT+ DA++ T R+G + Y++P+ GT+++ + FAE+ Sbjct: 534 EYYNGGSVSSTT------DPIAGTTEDAVFQTERYG-SYTYSIPVTAGTFSIDMQFAEI- 585 Query: 350 TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAG 454 Y +A G R F++ I D + + + DL+ AG Sbjct: 586 -YQTAAGDRSFNLYIED----QLEMSNVDLYTLAG 615 [20][TOP] >UniRef100_Q06WK5 Dermatan-binding protein PA5541 n=1 Tax=Propionibacterium acnes RepID=Q06WK5_PROAC Length = 444 Score = 62.0 bits (149), Expect = 2e-08 Identities = 39/109 (35%), Positives = 54/109 (49%), Gaps = 4/109 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TP TP P AP P + P Sbjct: 335 TPTPTPTPTPTPTPTPTPTPTPTPAPTPAPTPAPTPTPTPTPAPTPTPTPTPTPTP-TPT 393 Query: 182 GPYVTSTTYTGTIVKPVAGTS---NDALYHTFRFGKTVAYALPLP-TGT 316 + T+ T P++ T+ N +HT + +A LP TGT Sbjct: 394 PTPTPTPTHGATTTTPISRTTDRHNLGSHHTRIAAPALIHAKALPATGT 442 [21][TOP] >UniRef100_C7I5X5 Putative uncharacterized protein (Fragment) n=1 Tax=Thiomonas intermedia K12 RepID=C7I5X5_THIIN Length = 496 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/83 (40%), Positives = 46/83 (55%), Gaps = 3/83 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPAL---SGY 172 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P PV P++ SG Sbjct: 3 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP----TPVSATCATPSVTLTSGL 58 Query: 173 VPDGPYVTSTTYTGTIVKPVAGT 241 + G + +Y + KP GT Sbjct: 59 IDYGKNLRPFSY---LAKPAKGT 78 [22][TOP] >UniRef100_Q18DZ3 Probable cell surface glycoprotein n=1 Tax=Haloquadratum walsbyi DSM 16790 RepID=Q18DZ3_HALWD Length = 1358 Score = 62.0 bits (149), Expect = 2e-08 Identities = 51/167 (30%), Positives = 77/167 (46%), Gaps = 3/167 (1%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPTA+P P TPT TP+P P P P Sbjct: 391 TPTPTPTATPTPTPTPTPSPTPTATPTP--TPTPTPSPTPTATPTATATSTPTPPSVEPT 448 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALP-LPTGTYTVSLLFAEVYTYT 358 P V + + +G+S D+ + K + P PT T T + + +E T Sbjct: 449 TP-VDTEDENESDSDSSSGSSTDSSGGSNSNNKPDKQSTPKAPTPTPTPTPIPSERPTVG 507 Query: 359 SAIGKRVFDIAIGDAAAAPVLLHDYD--LFADAGEATAVAKVFDVTV 493 S G A G+ A+ + L + + A GE+ A+ + D+ + Sbjct: 508 STAGVTTAVTANGEGASTHLELPFTEPVMSAVDGESLAIGQSVDIYI 554 Score = 61.2 bits (147), Expect = 4e-08 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT SPTSTP+ SP P+PT++P PS TP+ TP P Sbjct: 299 TPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTP 336 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/52 (55%), Positives = 32/52 (61%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP 157 TPTPSPT SPTSTP+ SP P+PT +P P AT T TP P P N P Sbjct: 311 TPTPSPTPSPTSTPTPSPTPSPTPTPTPPATATPTPTPTPSPTPAPTNTPPP 362 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT SPT TP+ +P PTP +P P+ TPT TP P Sbjct: 255 TPTPSPTPSPTPTPTQTPTPTPLPTPSPTPTPTQTPTP 292 Score = 55.8 bits (133), Expect = 2e-06 Identities = 31/80 (38%), Positives = 39/80 (48%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+ T +PT P+ SP PTPT +P P+ TPT+TP P +P P S Sbjct: 265 TPTPTQTPTPTPLPTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTP 324 Query: 182 GPYVTSTTYTGTIVKPVAGT 241 P T + T T P T Sbjct: 325 TPSPTPSP-TPTPTPPATAT 343 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/46 (56%), Positives = 32/46 (69%), Gaps = 8/46 (17%) Frame = +2 Query: 2 TPTPSPTLSPTS--------TPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT +PT+ TP+A+P PTPT +P P+ATPT TP P Sbjct: 347 TPTPSPTPAPTNTPPPTSAPTPTATPTPTPTPTPTPTATPTPTPTP 392 Score = 54.7 bits (130), Expect = 4e-06 Identities = 33/108 (30%), Positives = 45/108 (41%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 PTPSPT +PT TP+ + PT T +P P+ +PT+TP P +P P S Sbjct: 278 PTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPT 337 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVS 328 P T+T P +N + P PT T T + Sbjct: 338 PPATATPTPTPTPSPTPAPTNTPPPTSAPTPTATPTPTPTPTPTPTAT 385 Score = 53.9 bits (128), Expect = 6e-06 Identities = 31/84 (36%), Positives = 42/84 (50%), Gaps = 6/84 (7%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPS------ATPTATPNPGGILAPVKLNVGGPAL 163 T TP+PTL+PTSTP+ SP P+PT++P PS +TPT +P P P P Sbjct: 287 TQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPTPPATATPTP 346 Query: 164 SGYVPDGPYVTSTTYTGTIVKPVA 235 + P T+T + P A Sbjct: 347 TPTPSPTPAPTNTPPPTSAPTPTA 370 [23][TOP] >UniRef100_Q2JP36 Protein kinase n=1 Tax=Synechococcus sp. JA-2-3B'a(2-13) RepID=Q2JP36_SYNJB Length = 746 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/84 (38%), Positives = 39/84 (46%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +P TP+ +P PTPT +P P+ TPT TP P P P + VP Sbjct: 554 TPTPAPTPTPVPTPTPTPTPTPTPAPTPTPTPTPTPTPAPTPTPTPTLTPIPRFTPLVPR 613 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDA 253 P T T P T A Sbjct: 614 TPTPTPTPSPTPTATPAPATPTPA 637 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/53 (45%), Positives = 30/53 (56%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPA 160 TPTP+P ++P TP+ +P PTPT P P+ TPT TP P P PA Sbjct: 540 TPTPTPEVTPAPTPTPTPAPTPTPVPTPTPTPTPTPTPAPTPTPTPTPTPTPA 592 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+P +PT TP +P PTPT +P P+ TP TP P Sbjct: 532 TPTPTPEATPTPTPEVTPAPTPTPTPAPTPTPVPTPTP 569 [24][TOP] >UniRef100_Q8GAM3 Putative uncharacterized protein n=1 Tax=Arthrobacter nicotinovorans RepID=Q8GAM3_ARTNI Length = 287 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/62 (48%), Positives = 38/62 (61%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 T TP+PT S T TPSASP PTPT++P + TPT TP+P ++ + PA VP Sbjct: 91 TATPTPTASATPTPSASPTPTPTSTPSSAQTPTTTPSPSRVVTAPAASTAPPAT---VPA 147 Query: 182 GP 187 GP Sbjct: 148 GP 149 [25][TOP] >UniRef100_C1RPR7 Esterase, PHB depolymerase family n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RPR7_9CELL Length = 489 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/70 (45%), Positives = 37/70 (52%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTPSPT +PT TPS +P PTPT +P P+ TP+ATP P P P S P Sbjct: 329 TPTPSPTPTPTPTPSPTPSPTPTPTPTPTPTPSATPTPSATPTP------SPTPSPTTPA 382 Query: 182 GPYVTSTTYT 211 TYT Sbjct: 383 PSGACRVTYT 392 [26][TOP] >UniRef100_Q7U3X4 Putative uncharacterized protein n=1 Tax=Synechococcus sp. WH 8102 RepID=Q7U3X4_SYNPX Length = 2014 Score = 61.2 bits (147), Expect = 4e-08 Identities = 29/67 (43%), Positives = 38/67 (56%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTPSP+ +PT +PSA+P P+P+A+P P+ TPT TP P P P+ S Sbjct: 1605 TPTPSPSATPTPSPSATPTPSPSATPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTP 1664 Query: 182 GPYVTST 202 P T T Sbjct: 1665 SPSATPT 1671 Score = 60.1 bits (144), Expect = 9e-08 Identities = 29/67 (43%), Positives = 37/67 (55%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TPSA+P P+P+A+P PS + T TP+P P P S Sbjct: 1589 TPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPTPTPTPTPTPSATPTP 1648 Query: 182 GPYVTST 202 P T T Sbjct: 1649 SPSATPT 1655 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/83 (37%), Positives = 41/83 (49%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TPSA+P P+P+A+P PS + T TP+P P P+ S Sbjct: 1629 TPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTP 1688 Query: 182 GPYVTSTTYTGTIVKPVAGTSND 250 P T T P + D Sbjct: 1689 SPSATPTPSPSATPTPSPSATPD 1711 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/69 (44%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPT--ATPNPGGILAPVKLNVGGPALSGYV 175 TPTP+P+++PT TPSA+P PTPT +P P+ TPT ATP P P P S Sbjct: 1569 TPTPTPSVTPTPTPSATPTPTPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSA 1628 Query: 176 PDGPYVTST 202 P T T Sbjct: 1629 TPTPTPTPT 1637 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/67 (41%), Positives = 37/67 (55%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTPSP+ +PT +PSA+P PTPT +P P+ + T TP+P P P+ S Sbjct: 1613 TPTPSPSATPTPSPSATPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTP 1672 Query: 182 GPYVTST 202 P T T Sbjct: 1673 SPSATPT 1679 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/67 (41%), Positives = 37/67 (55%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTPSP+ +PT TP+ +P PTP+A+P PS + T TP+P P P+ S Sbjct: 1621 TPTPSPSATPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTP 1680 Query: 182 GPYVTST 202 P T T Sbjct: 1681 SPSATPT 1687 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/83 (34%), Positives = 42/83 (50%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+P+ +PT +PSA+P P+P+A+P PS + T TP+P P P+ S Sbjct: 1637 TPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTP 1696 Query: 182 GPYVTSTTYTGTIVKPVAGTSND 250 P T T P S++ Sbjct: 1697 SPSATPTPSPSATPDPTPTASDE 1719 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASP--GPSATPTATPNPGGILAPVKLNVGGPALSGYV 175 TPTPSP+ +PT +PSA+P P+P+A+P PSATP TP L ++G +S Sbjct: 1677 TPTPSPSATPTPSPSATPTPSPSATPTPSPSATPDPTPTASDELPVDVSDLGSDDISSLT 1736 Query: 176 PD 181 PD Sbjct: 1737 PD 1738 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/67 (40%), Positives = 37/67 (55%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+P+ +PT +PSA+P P+P+A+P PS + T TP P P P+ S Sbjct: 1597 TPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPTPTPTPTPTPSATPTPSPSATPTP 1656 Query: 182 GPYVTST 202 P T T Sbjct: 1657 SPSATPT 1663 [27][TOP] >UniRef100_Q5N1K7 Putative uncharacterized protein n=2 Tax=Synechococcus elongatus RepID=Q5N1K7_SYNP6 Length = 410 Score = 61.2 bits (147), Expect = 4e-08 Identities = 26/56 (46%), Positives = 38/56 (67%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSG 169 TP+PSPT SP+ TP+ +P P+P+ +P PS TPT TP P AP +++ ++SG Sbjct: 268 TPSPSPTPSPSPTPTPTPTPSPSPTPSPSPTPTPTPTPSPSPAPTPVSISIASISG 323 [28][TOP] >UniRef100_Q2G944 Endo alpha-1,4 polygalactosaminidase, putative n=1 Tax=Novosphingobium aromaticivorans DSM 12444 RepID=Q2G944_NOVAD Length = 313 Score = 61.2 bits (147), Expect = 4e-08 Identities = 35/83 (42%), Positives = 45/83 (54%), Gaps = 11/83 (13%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGG------ILAPVKLNVGGPAL 163 +PTP+PT++P TP+ +P PTPT +P P+ TPT TP PGG IL L PA+ Sbjct: 34 SPTPTPTVTPAPTPTPTPTPTPTPTPTPTPTPTPTPTPGGLASWDWILQSQGLPATPPAV 93 Query: 164 SGYVPDG-----PYVTSTTYTGT 217 + DG YVT GT Sbjct: 94 AYLDVDGFDTPKSYVTLAKAAGT 116 [29][TOP] >UniRef100_B9L3Q2 Putative uncharacterized protein n=1 Tax=Thermomicrobium roseum DSM 5159 RepID=B9L3Q2_THERP Length = 267 Score = 61.2 bits (147), Expect = 4e-08 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTPSPT +PT TP+A+P PTPT P P++TPTATP PG P Sbjct: 96 TPTPSPTPAPTPTPTATPSPTPT--PTPTSTPTATPTPGNDTPP 137 [30][TOP] >UniRef100_A9B1J5 PKD domain containing protein n=1 Tax=Herpetosiphon aurantiacus ATCC 23779 RepID=A9B1J5_HERA2 Length = 2706 Score = 61.2 bits (147), Expect = 4e-08 Identities = 59/172 (34%), Positives = 80/172 (46%), Gaps = 21/172 (12%) Frame = +2 Query: 62 TPTASPGPSATPTATP----------NPGGILAPVKLNVGGPALSGYVPDGPYVTSTTYT 211 T TAS G S+ T+ N GG + + A Y +G ST+ Sbjct: 2207 TVTASNGSSSVATSLQVQVLPLLTRFNAGGFSSVTTPDAVRWAADSYSQNG----STSNP 2262 Query: 212 GTIVKPVAGTSNDALYHTFRFG-----KTVAYALPLPT-GTYTVSLLFAEV-YTYTSAI- 367 G++ VA T ND LY+ RF T+ YA+P+PT G YTV L FAE+ + TS + Sbjct: 2263 GSL-GDVANTDNDVLYYDDRFATGATTATLDYAIPVPTSGQYTVRLHFAEIFFGVTSGVA 2321 Query: 368 ---GKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 GKRVFD+ + +L+DYD G A ++F V VT L I Sbjct: 2322 GGTGKRVFDVNLEGTR----VLNDYDPTLAVGAKAADTRLFTVNVTDGVLNI 2369 [31][TOP] >UniRef100_A6L3S6 Glycoside hydrolase family 2, candidate beta-glycosidase n=1 Tax=Bacteroides vulgatus ATCC 8482 RepID=A6L3S6_BACV8 Length = 1426 Score = 61.2 bits (147), Expect = 4e-08 Identities = 42/117 (35%), Positives = 58/117 (49%), Gaps = 7/117 (5%) Frame = +2 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK-TVAYALPLPTGTYTVSLLFAEVY---- 349 PY S T P+ GT + L+ TFRFG+ + + P+P G Y V L F E + Sbjct: 1127 PYQASQRTTND---PIHGTRDWELFQTFRFGRHKLNFRFPVPDGEYRVELYFTEPWHGTG 1183 Query: 350 --TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 T G R+FD+A+ D VLL+D D++A+AG A KV + V L I Sbjct: 1184 GGVQTDCEGLRIFDVAVNDK----VLLNDLDVWAEAGHDGACKKVVNAVVKGGVLKI 1236 [32][TOP] >UniRef100_UPI00005CDB0F serine protease n=1 Tax=Xylella fastidiosa Temecula1 RepID=UPI00005CDB0F Length = 988 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS 166 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P L V PAL+ Sbjct: 34 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPLPVLDPALA 87 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P +L P Sbjct: 41 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPLPVLDP 84 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 39 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 76 [33][TOP] >UniRef100_Q87ET0 Serine protease n=1 Tax=Xylella fastidiosa Temecula1 RepID=Q87ET0_XYLFT Length = 967 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS 166 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P L V PAL+ Sbjct: 13 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPLPVLDPALA 66 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P +L P Sbjct: 20 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPLPVLDP 63 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 18 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 55 [34][TOP] >UniRef100_C7G355 Putative mutanase n=1 Tax=Paenibacillus humicus RepID=C7G355_9BACL Length = 1146 Score = 60.8 bits (146), Expect = 5e-08 Identities = 33/85 (38%), Positives = 45/85 (52%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 PTP+PT +PT TP+ +P PTPT +P PSATPT TP G +A G Sbjct: 176 PTPTPTPTPTPTPTPTPTPTPTVTPAPSATPTPTPPAGSNIAV----------------G 219 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALY 259 +T+++ T T V A +N + Y Sbjct: 220 KSITASSSTQTYVAANANDNNTSTY 244 [35][TOP] >UniRef100_C5ALD7 Rhs element Vgr protein n=1 Tax=Burkholderia glumae BGR1 RepID=C5ALD7_BURGB Length = 842 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGY 172 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P L P SG+ Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPPPTPLPTETPQPSGH 840 Score = 60.1 bits (144), Expect = 9e-08 Identities = 29/67 (43%), Positives = 36/67 (53%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P + P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPPP 827 Query: 182 GPYVTST 202 P T T Sbjct: 828 TPLPTET 834 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 749 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPAPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 [36][TOP] >UniRef100_C1RKY4 Cellobiohydrolase A (1,4-beta-cellobiosidase A) n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RKY4_9CELL Length = 444 Score = 60.8 bits (146), Expect = 5e-08 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 2/83 (2%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNV--GGPALSGYVP 178 P+P+P+ +P+ TP+ SP P+P+A+P P+ATP PNPGG A V LN GG + V Sbjct: 314 PSPAPSPTPSITPTPSPTPSPSATPTPTATPPPPPNPGGCTATVSLNQWNGGFVATIKVT 373 Query: 179 DGPYVTSTTYTGTIVKPVAGTSN 247 G S T + AG SN Sbjct: 374 AGSSGLSGWTTTVTLPGGAGVSN 396 [37][TOP] >UniRef100_O10341 Uncharacterized 29.3 kDa protein n=1 Tax=Orgyia pseudotsugata MNPV RepID=Y091_NPVOP Length = 279 Score = 60.8 bits (146), Expect = 5e-08 Identities = 41/117 (35%), Positives = 47/117 (40%), Gaps = 9/117 (7%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTPSPT SPT TPS +P P+PT SP PS TPT +P P P P S Sbjct: 118 TPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTP------SPTPSPTPTP 171 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKT---------VAYALPLPTGTYTV 325 P + T P D +Y G T + P P TY V Sbjct: 172 SPTPSPTPPPSPTPPPSPSPLGDPMYFPSSVGTTDQLRDYIRPLCNGWPRPRETYAV 228 Score = 60.1 bits (144), Expect = 9e-08 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT TPS +P PTPT SP PS TPT +P P Sbjct: 98 SPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTP 135 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTPSPT SPT TPS +P PTPT SP P+ +PT +P P P Sbjct: 108 TPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTP 151 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 +PTP+PT SPT TP+ SP PTPT +P P+ TPT +P P L+P Sbjct: 36 SPTPTPTPSPTPTPTPSPTPTPTPTPTPTPTPTPSPTPTPALSP 79 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPTLSPT +P+ +P PTP+ +P P+ TP+ TP+P Sbjct: 80 TPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSP 117 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 +PTPSPT +P+ TPS +P PTPT SP PS TPT +P P P Sbjct: 88 SPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTP 131 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTPSPT SPT +P+ +P PTP+ +P PS TP+ TP P P Sbjct: 94 TPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTP 137 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/46 (58%), Positives = 31/46 (67%), Gaps = 2/46 (4%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPT--PTASPGPSATPTATPNPGGILAP 133 TPTP+PT SPT TP+ SP PT PT SP PS TPT +P P +P Sbjct: 62 TPTPTPTPSPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSP 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT +PT TP+ +P PTP+ +P P+ +PT TP+P Sbjct: 48 TPTPSPTPTPTPTPTPTPTPTPSPTPTPALSPTPTPSP 85 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/44 (52%), Positives = 29/44 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT +PT TP+ SP PTP SP P+ +PT +P P P Sbjct: 54 TPTPTPTPTPTPTPTPSPTPTPALSPTPTPSPTLSPTPSPTPTP 97 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 4/48 (8%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSAS----PEPTPTASPGPSATPTATPNPGGILAP 133 +PTP+P LSPT TPS + P PTPT SP PS TP+ TP P +P Sbjct: 70 SPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSP 117 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT +P+ TPS +P P+PT SP P+ +PT TP+P Sbjct: 102 SPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSP 139 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/46 (52%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATP--TATPNPGGILAP 133 +PTP+PT SPT TP+ +P PTPT +P P+ TP + TP P L+P Sbjct: 44 SPTPTPTPSPTPTPTPTPTPTPTPTPSPTPTPALSPTPTPSPTLSP 89 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/44 (50%), Positives = 31/44 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TP+P+PT SPT +P+ +P PTP+ +P PS TPT +P P +P Sbjct: 104 TPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSP 147 [38][TOP] >UniRef100_B9MKU0 Glycoside hydrolase family 48 n=1 Tax=Anaerocellum thermophilum DSM 6725 RepID=B9MKU0_ANATD Length = 1904 Score = 60.5 bits (145), Expect = 7e-08 Identities = 43/124 (34%), Positives = 55/124 (44%), Gaps = 5/124 (4%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+ T +PT TP+ +P PTPT +P P+ATPTATP P P Sbjct: 989 TPTPTATPAPTVTPTPTPAPTPTPTPTPTATPTATPTPTPTPTPTPTAT----------- 1037 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALP----LPTGTYTVSLLFAEV- 346 P VT+T PVAG LY T P + TG+ ++ L + Sbjct: 1038 -PTVTATPTPTPSSTPVAGGQIKVLYANKETNSTTNTIRPWLKVVNTGSSSIDLSRVTIR 1096 Query: 347 YTYT 358 Y YT Sbjct: 1097 YWYT 1100 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+ T +PT TP+ +P PTPT +P P+ATPTATP P Sbjct: 1210 TPTPTATPAPTVTPTPTPAPTPTPTPTPTATPTATPTP 1247 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT+TP+A+P PTPT +P P+ATPT T P Sbjct: 1229 PTPTPTPTPTATPTATPTPTPTPTPTPTATPTVTATP 1265 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PTST + +P PTPT + P+ATPTATP P Sbjct: 786 TPTPTPTPTPTSTATPTPTPTPTPTSTPTATPTATPTP 823 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATP 109 TPTP+PT +PT TP+A+P TPT +P P+ TPTATP Sbjct: 1224 TPTPAPTPTPTPTPTATPTATPTPTPTPTPTPTATP 1259 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 T TP+PT++PT TP+ +P PTPT + P+ATPT TP P Sbjct: 1214 TATPAPTVTPTPTPAPTPTPTPTPTATPTATPTPTPTP 1251 [39][TOP] >UniRef100_C6ZB68 Glycoside hydrolase family 2 n=1 Tax=Bacteroides sp. 4_3_47FAA RepID=C6ZB68_9BACE Length = 1434 Score = 60.5 bits (145), Expect = 7e-08 Identities = 42/117 (35%), Positives = 57/117 (48%), Gaps = 7/117 (5%) Frame = +2 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK-TVAYALPLPTGTYTVSLLFAEVY---- 349 PY S T P+ GT + L+ TFRFG+ + + P+P G Y V L F E + Sbjct: 1127 PYQASQRTTND---PIHGTRDWELFQTFRFGRHKLNFRFPVPDGEYRVELYFTEPWHGTG 1183 Query: 350 --TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 T G R+FD+A+ D VLL D D++A+AG A KV + V L I Sbjct: 1184 GGVQTDCEGLRIFDVAVNDK----VLLDDLDVWAEAGHDGACKKVVNAVVKGGVLKI 1236 [40][TOP] >UniRef100_B7G6I0 Predicted protein n=1 Tax=Phaeodactylum tricornutum CCAP 1055/1 RepID=B7G6I0_PHATR Length = 1461 Score = 60.5 bits (145), Expect = 7e-08 Identities = 58/190 (30%), Positives = 84/190 (44%), Gaps = 20/190 (10%) Frame = +2 Query: 5 PTPS-PTLSPTSTPSASPEPTPTASP---GPSATPTATPNPGGI-LAPVKLNVGGPALSG 169 PTP+ PT+ PT + + E + SP P+A P P + ++ L + + Sbjct: 508 PTPAVPTMPPTISQVVNNETSTVPSPIAIAPTAAPLTQPTSNPVEVSDFSLFINAGQNNQ 567 Query: 170 YVPDGPYVT--STTYT--GTIVK-----PVAGTSNDALYHTFRF-----GKTVAYALP-L 304 V DG T S Y G + K P+ N + +R G Y +P L Sbjct: 568 DVTDGSGSTWVSDRYANRGNLFKTKLNNPILSMPNPGMEEVYRSSRWFSGTDFTYTIPSL 627 Query: 305 PTGTYTVSLLFAEVYTYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFD 484 Y V L FAEVY ++G R F++ I +PVL D+D+F +AG TA+ + F Sbjct: 628 EPALYQVRLHFAEVYQPAQSVGSRRFNVEI---QGSPVLT-DFDIFLEAGSFTALVREFT 683 Query: 485 VTVTSAPLII 514 V V S L I Sbjct: 684 VLVDSGQLAI 693 [41][TOP] >UniRef100_Q2FQH1 Putative uncharacterized protein n=1 Tax=Methanospirillum hungatei JF-1 RepID=Q2FQH1_METHJ Length = 1002 Score = 60.5 bits (145), Expect = 7e-08 Identities = 39/101 (38%), Positives = 53/101 (52%), Gaps = 7/101 (6%) Frame = +2 Query: 2 TPTPSPTLSPTSTP----SASPEPTPTASPGPSATP--TATPNPGGILAPVKLNVGGPAL 163 TPTP+PTL+PT TP + +P PTPT +P P+ TP T TP P L P + P + Sbjct: 573 TPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTPTPIPVPVV 632 Query: 164 SGYVPD-GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKT 283 +G +P+ G + YT T V G A H + G+T Sbjct: 633 TGIIPESGQAGLTINYTVTGSNFVDG----AFVHLVKEGQT 669 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 4/42 (9%) Frame = +2 Query: 2 TPTPSPTLSPTSTP----SASPEPTPTASPGPSATPTATPNP 115 TPTP+PTL+PT TP + +P PTPT +P P+ TPT TP P Sbjct: 503 TPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTP 544 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 4/42 (9%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSAS----PEPTPTASPGPSATPTATPNP 115 TPTP+PTL+PT TP+ + P PTPT +P P+ TPT TP P Sbjct: 513 TPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTP 554 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 4/42 (9%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSAS----PEPTPTASPGPSATPTATPNP 115 TPTP+PTL+PT TP+ + P PTPT +P P+ TPT TP P Sbjct: 523 TPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTP 564 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 4/42 (9%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSAS----PEPTPTASPGPSATPTATPNP 115 TPTP+PTL+PT TP+ + P PTPT +P P+ TPT TP P Sbjct: 533 TPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTP 574 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 4/42 (9%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSAS----PEPTPTASPGPSATPTATPNP 115 TPTP+PTL+PT TP+ + P PTPT +P P+ TPT TP P Sbjct: 543 TPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTP 584 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 4/42 (9%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSAS----PEPTPTASPGPSATPTATPNP 115 TPTP+PTL+PT TP+ + P PTPT +P P+ TPT TP P Sbjct: 553 TPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTPTPTPTLTPTP 594 [42][TOP] >UniRef100_UPI0001B576F5 hypothetical protein StreC_09513 n=1 Tax=Streptomyces sp. C RepID=UPI0001B576F5 Length = 411 Score = 60.1 bits (144), Expect = 9e-08 Identities = 32/67 (47%), Positives = 34/67 (50%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTPSPT SP TP+ SP PTPT SP P+ TPT TP P P P S Sbjct: 308 TPTPSPTPSPKPTPTPSPTPTPTPSPKPTPTPTPTPTPSPSTKPSPTPTPTPTPSTRPTS 367 Query: 182 GPYVTST 202 P T T Sbjct: 368 TPSPTPT 374 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT SP++ PS +P PTPT S P++TP+ TP P Sbjct: 338 TPTPTPTPSPSTKPSPTPTPTPTPSTRPTSTPSPTPTP 375 [43][TOP] >UniRef100_UPI00005CDAB7 serine protease n=1 Tax=Xylella fastidiosa 9a5c RepID=UPI00005CDAB7 Length = 1002 Score = 60.1 bits (144), Expect = 9e-08 Identities = 27/55 (49%), Positives = 35/55 (63%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS 166 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P L P+L+ Sbjct: 52 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPLPTLDPSLA 106 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 34 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 71 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 36 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 73 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 38 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 75 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 40 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 77 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 42 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 79 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 44 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 81 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 46 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 83 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 48 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 85 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 50 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 87 [44][TOP] >UniRef100_B0U200 Serine protease n=1 Tax=Xylella fastidiosa M12 RepID=B0U200_XYLFM Length = 998 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS 166 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P L PAL+ Sbjct: 43 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPLPDLDPALA 97 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 35 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 72 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 37 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 74 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 39 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 76 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 41 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 78 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 34 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 70 [45][TOP] >UniRef100_C3R5M3 Glycoside hydrolase family 2 protein n=1 Tax=Bacteroides sp. D4 RepID=C3R5M3_9BACE Length = 1423 Score = 60.1 bits (144), Expect = 9e-08 Identities = 42/117 (35%), Positives = 57/117 (48%), Gaps = 7/117 (5%) Frame = +2 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK-TVAYALPLPTGTYTVSLLFAEVY---- 349 PY S T P+ GT + L+ TFRFG+ + + P+P G Y V L F E + Sbjct: 1128 PYQASQRTTND---PIHGTRDWELFQTFRFGRHKLNFRFPVPDGEYRVELYFTEPWHGTG 1184 Query: 350 --TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 T G R+FD+A+ D VLL D D++A+AG A KV + V L I Sbjct: 1185 GGVQTDCEGLRIFDVAVNDK----VLLDDLDVWAEAGHDGACKKVVNAIVKGGVLKI 1237 [46][TOP] >UniRef100_C3PZ61 Glycoside hydrolase family 2 protein n=1 Tax=Bacteroides sp. 9_1_42FAA RepID=C3PZ61_9BACE Length = 1410 Score = 60.1 bits (144), Expect = 9e-08 Identities = 42/117 (35%), Positives = 57/117 (48%), Gaps = 7/117 (5%) Frame = +2 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK-TVAYALPLPTGTYTVSLLFAEVY---- 349 PY S T P+ GT + L+ TFRFG+ + + P+P G Y V L F E + Sbjct: 1115 PYQASQRTTND---PIHGTRDWELFQTFRFGRHKLNFRFPVPDGEYRVELYFTEPWHGTG 1171 Query: 350 --TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 T G R+FD+A+ D VLL D D++A+AG A KV + V L I Sbjct: 1172 DGVQTDCEGLRIFDVAVNDK----VLLDDLDVWAEAGHDGACKKVVNAIVKGGVLKI 1224 [47][TOP] >UniRef100_B6W2W1 Putative uncharacterized protein n=1 Tax=Bacteroides dorei DSM 17855 RepID=B6W2W1_9BACE Length = 1423 Score = 60.1 bits (144), Expect = 9e-08 Identities = 42/117 (35%), Positives = 57/117 (48%), Gaps = 7/117 (5%) Frame = +2 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK-TVAYALPLPTGTYTVSLLFAEVY---- 349 PY S T P+ GT + L+ TFRFG+ + + P+P G Y V L F E + Sbjct: 1128 PYQASQRTTND---PIHGTRDWELFQTFRFGRHKLNFRFPVPDGEYRVELYFTEPWHGTG 1184 Query: 350 --TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 T G R+FD+A+ D VLL D D++A+AG A KV + V L I Sbjct: 1185 GGVQTDCEGLRIFDVAVNDK----VLLDDLDVWAEAGHDGACKKVVNAIVKGGVLKI 1237 [48][TOP] >UniRef100_UPI00005CDB30 serine protease n=1 Tax=Xylella fastidiosa Temecula1 RepID=UPI00005CDB30 Length = 1025 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVK 139 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P L P++ Sbjct: 76 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTLPPLQ 121 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/59 (45%), Positives = 33/59 (55%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP 178 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P L P Sbjct: 64 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTLPPLQP 122 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 34 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 71 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 36 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 73 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 38 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 75 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 40 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 77 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 42 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 79 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 44 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 81 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 46 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 83 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 48 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 85 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 50 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 87 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 52 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 89 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 54 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 91 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 56 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 93 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 58 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 95 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 60 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 97 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 62 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 99 [49][TOP] >UniRef100_UPI00005CDA98 serine protease n=1 Tax=Xylella fastidiosa 9a5c RepID=UPI00005CDA98 Length = 999 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P I P+ Sbjct: 34 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPI 78 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P I P Sbjct: 38 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPIPTP 81 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 32 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 69 Score = 56.6 bits (135), Expect = 9e-07 Identities = 26/55 (47%), Positives = 33/55 (60%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS 166 TPTP+PT +PT TP+ +P PTPT +P P+ PT P P P L PAL+ Sbjct: 44 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPIPTPTPTPTPTPLPALDPALA 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/54 (48%), Positives = 32/54 (59%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPAL 163 TPTP+PT +PT TP+ +P PTPT +P P+ TPT P P P PAL Sbjct: 40 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPIPTPTPTPTPTPLPAL 93 [50][TOP] >UniRef100_Q605T1 Conserved domain protein n=1 Tax=Methylococcus capsulatus RepID=Q605T1_METCA Length = 383 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGG 121 TPTP+PT +PT+TP+ +P P PTA+P P+ATP TP P G Sbjct: 114 TPTPTPTPAPTATPAPTPTPAPTATPAPTATPAPTPTPCG 153 [51][TOP] >UniRef100_Q144D2 Putative uncharacterized protein n=1 Tax=Burkholderia xenovorans LB400 RepID=Q144D2_BURXL Length = 530 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/67 (46%), Positives = 40/67 (59%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 +P+PSP+ SPT TPS +P PTPT SP P+ TPT TP P V + + +G + Sbjct: 119 SPSPSPSPSPTPTPSPTPAPTPTPSPTPTPTPTPTPTPTTEANTVPITI--ERWTGDYAN 176 Query: 182 GPYVTST 202 PYVT T Sbjct: 177 QPYVTVT 183 Score = 56.2 bits (134), Expect = 1e-06 Identities = 41/135 (30%), Positives = 57/135 (42%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 P+PSP SP+ +PS SP P+P+ SP PS TPT +P P P P Sbjct: 100 PSPSPAPSPSPSPSPSPSPSPSPSPSPSPTPTPSPTPAPTPTPSPTPTPTPT-------- 151 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYTSA 364 P T TT T+ + + D + TV +P G + + + T + Sbjct: 152 PTPTPTTEANTVPITIERWTGDYANQPY---VTVTLCIPGVQGANQCATI-DHMLVDTGS 207 Query: 365 IGKRVFDIAIGDAAA 409 G RV A+G A A Sbjct: 208 AGVRVLASALGPALA 222 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +P+PSP+ SP+ +PS SP PTPT SP P+ TPT +P P Sbjct: 109 SPSPSPSPSPSPSPSPSPSPTPTPSPTPAPTPTPSPTP 146 [52][TOP] >UniRef100_B2JUF7 Putative uncharacterized protein n=1 Tax=Burkholderia phymatum STM815 RepID=B2JUF7_BURP8 Length = 772 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/59 (47%), Positives = 35/59 (59%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP 178 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P +P G LS P Sbjct: 132 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPSPAPSPSAGSTLSCGAP 190 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/82 (40%), Positives = 42/82 (51%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P PA S Sbjct: 128 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP----TPTPTPTPSPAPS----- 178 Query: 182 GPYVTSTTYTGTIVKPVAGTSN 247 P ST G + GT++ Sbjct: 179 -PSAGSTLSCGAPTQKAGGTAS 199 [53][TOP] >UniRef100_Q9RCG5 Chitinase Chi67 n=1 Tax=Doohwaniella chitinasigens RepID=Q9RCG5_9BURK Length = 633 Score = 59.7 bits (143), Expect = 1e-07 Identities = 36/96 (37%), Positives = 48/96 (50%), Gaps = 4/96 (4%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP PG Sbjct: 181 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPGARQV----------------- 223 Query: 182 GPYVTSTTYTG--TIVKPV--AGTSNDALYHTFRFG 277 G Y TS TG T VK + +G ++ + + FG Sbjct: 224 GSYFTSGASTGATTRVKQIETSGAASKLTFLNYAFG 259 [54][TOP] >UniRef100_Q48373 Chitinase n=1 Tax=Janthinobacterium lividum RepID=Q48373_9BURK Length = 665 Score = 59.7 bits (143), Expect = 1e-07 Identities = 35/88 (39%), Positives = 45/88 (51%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT P P+ TPT TP+P G G AL+ Sbjct: 108 TPTPTPTPTPTPTPTPTPTPTPTPEPTPTPTPTPTPSPTG---------GTCALA----- 153 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHT 265 + T Y+ AGT+ A Y T Sbjct: 154 --WAAGTAYSAGATVSYAGTNYRANYWT 179 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGG 121 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P G Sbjct: 206 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTG 245 [55][TOP] >UniRef100_Q3RE35 Outer membrane autotransporter barrel n=1 Tax=Xylella fastidiosa Dixon RepID=Q3RE35_XYLFA Length = 1029 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVK 139 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P L P++ Sbjct: 80 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTLPPLQ 125 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/59 (45%), Positives = 33/59 (55%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP 178 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P L P Sbjct: 68 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTLPPLQP 126 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 34 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 71 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 36 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 73 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 38 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 75 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 40 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 77 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 42 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 79 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 44 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 81 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 46 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 83 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 48 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 85 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 50 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 87 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 52 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 89 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 54 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 91 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 56 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 93 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 58 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 95 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 60 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 97 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 62 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 99 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 64 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 101 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 66 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 103 [56][TOP] >UniRef100_Q3R162 Outer membrane autotransporter barrel n=1 Tax=Xylella fastidiosa subsp. sandyi Ann-1 RepID=Q3R162_XYLFA Length = 1055 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVK 139 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P L P++ Sbjct: 106 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTLPPLQ 151 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/59 (45%), Positives = 33/59 (55%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP 178 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P L P Sbjct: 94 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTLPPLQP 152 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 34 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 71 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 36 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 73 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 38 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 75 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 40 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 77 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 42 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 79 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 44 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 81 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 46 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 83 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 48 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 85 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 50 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 87 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 52 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 89 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 54 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 91 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 56 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 93 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 58 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 95 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 60 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 97 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 62 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 99 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 64 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 101 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 66 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 103 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 68 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 105 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 70 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 107 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 72 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 109 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 74 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 111 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 76 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 113 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 78 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 115 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 80 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 117 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 82 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 119 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 84 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 121 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 86 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 123 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 88 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 125 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 90 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 127 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 92 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 129 [57][TOP] >UniRef100_Q3QYH5 Peptidase S8 and S53, subtilisin, kexin, sedolisin (Fragment) n=1 Tax=Xylella fastidiosa subsp. sandyi Ann-1 RepID=Q3QYH5_XYLFA Length = 822 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVK 139 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P L P++ Sbjct: 64 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTLPPLQ 109 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/59 (45%), Positives = 33/59 (55%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP 178 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P L P Sbjct: 52 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTLPPLQP 110 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 18 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 55 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 20 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 57 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 22 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 59 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 24 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 61 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 26 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 63 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 28 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 65 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 30 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 67 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 32 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 69 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 34 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 71 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 36 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 73 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 38 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 75 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 40 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 77 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 42 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 79 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 44 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 81 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 46 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 83 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 48 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 85 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 50 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 87 [58][TOP] >UniRef100_A2WE19 Putative uncharacterized protein n=1 Tax=Burkholderia dolosa AUO158 RepID=A2WE19_9BURK Length = 407 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/61 (47%), Positives = 33/61 (54%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 PTP PT SPT TPS SP PTPT +P PS +PT TP P P P+ + G Sbjct: 226 PTPGPTPSPTPTPSPSPTPTPTPTPTPSPSPTPTPTPTPTPTPTPTPTSTPSSTPTPSPG 285 Query: 185 P 187 P Sbjct: 286 P 286 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATP--TATPNPGGILAPVKLNVG 151 TPTP+PT SP+ TP+ +P PTPT +P P++TP T TP+PG P+++ G Sbjct: 245 TPTPTPTPSPSPTPTPTPTPTPTPTPTPTSTPSSTPTPSPGPEPHPLRMPAG 296 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSP+ +PT TP+ +P P+PT +P P+ TPT TP P Sbjct: 235 TPTPSPSPTPTPTPTPTPSPSPTPTPTPTPTPTPTPTP 272 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP+P+PT SP+ TP+ +P PTP+ SP P+ TPT TP P Sbjct: 231 TPSPTPTPSPSPTPTPTPTPTPSPSPTPTPTPTPTPTP 268 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/44 (52%), Positives = 29/44 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 +P+P+PT +PT TPS SP PTPT +P P+ TPT T P P Sbjct: 239 SPSPTPTPTPTPTPSPSPTPTPTPTPTPTPTPTPTSTPSSTPTP 282 [59][TOP] >UniRef100_Q649T1 Cathepsin C n=1 Tax=uncultured archaeon GZfos34G5 RepID=Q649T1_9ARCH Length = 760 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PTSTP+ +P PTPT++P P+ TPT TP P Sbjct: 623 TPTPTPTPTPTSTPTPTPTPTPTSTPTPTPTPTPTPTP 660 [60][TOP] >UniRef100_A7H9N7 Heavy metal translocating P-type ATPase n=1 Tax=Anaeromyxobacter sp. Fw109-5 RepID=A7H9N7_ANADF Length = 944 Score = 59.3 bits (142), Expect = 1e-07 Identities = 35/89 (39%), Positives = 42/89 (47%), Gaps = 1/89 (1%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT + TSTP+ +P PTPTA+P P+ TPT TP P P + Sbjct: 609 TPTPTPTPTSTSTPTPTPTPTPTATPTPTPTPTPTPTPTPTPTPTPTPTSTSTSTSTPTP 668 Query: 182 GPYVTST-TYTGTIVKPVAGTSNDALYHT 265 P TST T T T TS T Sbjct: 669 TPTPTSTPTSTPTSTSTSTSTSTSTATST 697 Score = 58.5 bits (140), Expect = 2e-07 Identities = 46/153 (30%), Positives = 62/153 (40%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT+TP+ +P PTPT +P P+ TPT+T P P P + Sbjct: 585 TPTPTPTATPTATPTPTPTPTPTPTPTPTPTPTSTSTPTPTPTPTPTATPTPTPTPTPTP 644 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYTS 361 P T T T T TS T + + P T T T + T T Sbjct: 645 TPTPTPTP-TPTPTSTSTSTSTPTPTPT---PTSTPTSTPTSTSTSTSTSTSTATSTSTP 700 Query: 362 AIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEA 460 A + + VL+ + L AD G A Sbjct: 701 TSTSTSTSTATSTSTSRAVLIGNRALLADHGIA 733 [61][TOP] >UniRef100_B5SGB4 Putative uncharacterized protein n=1 Tax=Ralstonia solanacearum IPO1609 RepID=B5SGB4_RALSO Length = 444 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/56 (50%), Positives = 35/56 (62%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSG 169 TPTPSP+ SP+ +PS SP P+P+ SP P+ TPT TP+P AP PA G Sbjct: 204 TPTPSPSPSPSPSPSPSPSPSPSPSPSPTPTPTPTPSPTPAPAPAPSPTPTPAPCG 259 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 PTP+P+ SP+ +PS SP P+P+ SP PS TPT TP P AP Sbjct: 203 PTPTPSPSPSPSPSPSPSPSPSPSPSPSPTPTPTPTPSPTPAP 245 [62][TOP] >UniRef100_A5YT41 Probable cell surface glycoprotein n=1 Tax=uncultured haloarchaeon RepID=A5YT41_9EURY Length = 1315 Score = 59.3 bits (142), Expect = 1e-07 Identities = 36/109 (33%), Positives = 46/109 (42%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 +PTPSPT +PT TP+ +P PTP+ +P PS TPT T P L P P S Sbjct: 265 SPTPSPTPTPTQTPTPTPLPTPSPTPTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTPTP 324 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVS 328 P T+T P +N + P PT T T + Sbjct: 325 TPPATATPTPTPTSSPTPAPTNTPPPTSAPTPTATPTPTPTPTPTPTAT 373 Score = 58.9 bits (141), Expect = 2e-07 Identities = 49/166 (29%), Positives = 77/166 (46%), Gaps = 2/166 (1%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT+TP+ +P PTPT +P P+AT T+TP P + ++ + D Sbjct: 361 TPTPTPTPTPTATPTPTPSPTPTTTPTPTATATSTPTPPSVEPTTPVDTEDENENESDSD 420 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYTS 361 +ST +G SN+ + GK P PT T T + +E T S Sbjct: 421 SSSGSSTDSSG------GSNSNN------KPGKQSTPKAPTPTPTPTP--IPSERPTVGS 466 Query: 362 AIGKRVFDIAIGDAAAAPVLLHDYD--LFADAGEATAVAKVFDVTV 493 G A G+ A+ + L + + A GE+ A+ + D+ + Sbjct: 467 TAGVTTAVTANGEGASTHLELPFTEPVMSAVDGESLAIGQSVDIYI 512 [63][TOP] >UniRef100_P19275 Viral protein TPX n=1 Tax=Thermoproteus tenax virus 1 (STRAIN VT3) RepID=VTP3_TTV1V Length = 474 Score = 59.3 bits (142), Expect = 1e-07 Identities = 37/107 (34%), Positives = 45/107 (42%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P + Sbjct: 287 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 346 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYT 322 P T T P + D Y F P PT T T Sbjct: 347 TPTPTPTPTPTPTPTPTPTPTYDITYVVF---DVTPSPTPTPTPTPT 390 Score = 58.9 bits (141), Expect = 2e-07 Identities = 39/108 (36%), Positives = 47/108 (43%), Gaps = 1/108 (0%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P + Sbjct: 279 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 338 Query: 182 GPYVTST-TYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYT 322 P T T T T T T T+ V P PT T T Sbjct: 339 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTYDITYVVFDVTPSPTPTPT 386 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 382 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 419 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 384 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 421 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 386 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 423 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 388 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 425 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 390 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 427 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 392 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 429 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 394 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 431 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 396 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 433 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 398 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 435 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP+P+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 378 TPSPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 415 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 380 SPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 417 [64][TOP] >UniRef100_Q7TLR4 Putative uncharacterized protein n=1 Tax=Choristoneura fumiferana MNPV RepID=Q7TLR4_NPVCF Length = 251 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 PTPSPT SPT +P+ SP P+PT SP PS TP+ATP+P P+ Sbjct: 105 PTPSPTPSPTPSPTPSPTPSPTPSPTPSPTPSATPSPTPSATPL 148 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN 112 +PTPSPT SPT +P+ SP P+PT SP PSATP+ TP+ Sbjct: 108 SPTPSPTPSPTPSPTPSPTPSPTPSPTPSATPSPTPS 144 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPTL PT +P+ P P+PT SP PS TP+ TP+P Sbjct: 89 PTPSPTLPPTPSPTPPPTPSPTPSPTPSPTPSPTPSP 125 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT PT +P+ SP P+PT SP PS TP+ TP+P Sbjct: 97 PTPSPTPPPTPSPTPSPTPSPTPSPTPSPTPSPTPSP 133 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT +P+ SP P+PT S PS TP+ATP P Sbjct: 112 SPTPSPTPSPTPSPTPSPTPSPTPSATPSPTPSATPLP 149 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = +2 Query: 2 TPTPSPTLSPTS--TPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 +PTPSPT SPT TPSA+P PTP+A+P P+++PT P P + P+ Sbjct: 120 SPTPSPTPSPTPSPTPSATPSPTPSATPLPTSSPTPPPTPSPLGEPM 166 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPTL PT +P+ P P+PT P PS TP+ TP+P Sbjct: 81 PTPSPTLPPTPSPTLPPTPSPTPPPTPSPTPSPTPSP 117 [65][TOP] >UniRef100_Q9PCD0 Serine protease n=1 Tax=Xylella fastidiosa RepID=Q9PCD0_XYLFA Length = 1000 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/59 (45%), Positives = 33/59 (55%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP 178 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P L P Sbjct: 38 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTLPSLPP 96 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 37 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 73 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/61 (40%), Positives = 33/61 (54%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 P P+PT +PT TP+ +P PTPT +P P+ TPT TP P P P + +P Sbjct: 35 PRPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTLPSL 94 Query: 185 P 187 P Sbjct: 95 P 95 [66][TOP] >UniRef100_A8HW25 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HW25_CHLRE Length = 888 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/56 (50%), Positives = 35/56 (62%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSG 169 TPTPSP+ SP PS SP PTP+ SP PSATP+ +P+P +P P+ SG Sbjct: 646 TPTPSPSPSPAPIPSPSPSPTPSPSPSPSATPSPSPSPSPSPSPSPSPSPSPSPSG 701 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTPSP+ SPT TPS SP P P SP PS TP+ +P+P +P Sbjct: 636 TPTPSPSPSPTPTPSPSPSPAPIPSPSPSPTPSPSPSPSATPSP 679 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = +2 Query: 8 TPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPSP SPT TPS SP PTPT SP PS P +P+P +P Sbjct: 628 TPSPVPSPTPTPSPSPSPTPTPSPSPSPAPIPSPSPSPTPSP 669 [67][TOP] >UniRef100_UPI00019D3D3B membrane carboxypeptidase (penicillin-binding protein) n=1 Tax=Eggerthella lenta DSM 2243 RepID=UPI00019D3D3B Length = 727 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGG 121 TPTP+PT +P TP+ +P+PTP P P+ TPT TP+PGG Sbjct: 681 TPTPTPTPTPDPTPTPTPDPTPKPDPDPTPTPTPTPDPGG 720 [68][TOP] >UniRef100_Q2JVQ6 Putative S-layer protein n=1 Tax=Synechococcus sp. JA-3-3Ab RepID=Q2JVQ6_SYNJA Length = 497 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS 166 TPTP+PT +PT TP+ +P PTPT +P P ATPTAT P PV + P+ S Sbjct: 441 TPTPTPTPTPTPTPTPTPTPTPTPTPTPEATPTATATPTPTPEPVVEPLPSPSPS 495 [69][TOP] >UniRef100_Q2JV28 Putative uncharacterized protein n=1 Tax=Synechococcus sp. JA-3-3Ab RepID=Q2JV28_SYNJA Length = 459 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+P +PT TP+ +P PTPT +P P+ TPT TPNP AP Sbjct: 326 TPTPTPNPTPTPTPTPTPTPTPTPTPTPTPTPTPTPNPTPTPAP 369 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P Sbjct: 324 TPTPTPTPNPTPTPTPTPTPTPTPTPTPTPTPTPTPTPNPTPTP 367 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 319 PTPTPTPTPTPTPNPTPTPTPTPTPTPTPTPTPTPTP 355 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT P+ +P PTPT +P P+ TPT TP P Sbjct: 320 TPTPTPTPTPTPNPTPTPTPTPTPTPTPTPTPTPTPTP 357 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +P TP+ +P PTPT +P P+ TPT TP P Sbjct: 322 TPTPTPTPTPNPTPTPTPTPTPTPTPTPTPTPTPTPTP 359 [70][TOP] >UniRef100_Q2JQ30 Putative uncharacterized protein n=1 Tax=Synechococcus sp. JA-2-3B'a(2-13) RepID=Q2JQ30_SYNJB Length = 512 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT +PT TP+ +P PTPT SP P+ TPT TP P P Sbjct: 345 TPTPTPTPTPTPTPTPAPTPTPTPSPTPTPTPTPTPTPSPTPTP 388 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 343 TPTPTPTPTPTPTPTPTPAPTPTPTPSPTPTPTPTPTP 380 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTP+PT +PT TPS +P PTPT +P PS TPT TP P Sbjct: 369 SPTPTPTPTPTPTPSPTPTPTPTPTPTPSPTPTPTPTP 406 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+P +PT TPS +P PTPT +P PS TPT TP P Sbjct: 355 TPTPTPAPTPTPTPSPTPTPTPTPTPTPSPTPTPTPTP 392 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT SPT TP+ +P PTP+ +P P+ TPT TP LAP Sbjct: 375 TPTPTPTPSPTPTPTPTPTPTPSPTPTPTPTPTPTPEATPTLAP 418 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP PT +PT TP+ +P PTPT +P P+ TPT TP+P Sbjct: 333 TPTPEPTPTPTPTPTPTPTPTPTPTPTPAPTPTPTPSP 370 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT +PT TP+ +P PTPT +P P+ TP+ TP P Sbjct: 365 TPTPSPTPTPTPTPTPTPSPTPTPTPTPTPTPSPTPTP 402 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/44 (54%), Positives = 28/44 (63%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT PT TP +P PTPT +P P+ TPT TP P P Sbjct: 323 TPTPTPTPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPAPTPTP 366 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ SP PTPT +P P+ +PT TP P Sbjct: 353 TPTPTPTPAPTPTPTPSPTPTPTPTPTPTPSPTPTPTP 390 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +P+ TP+ +P PTPT SP P+ TPT TP P Sbjct: 373 TPTPTPTPTPSPTPTPTPTPTPTPSPTPTPTPTPTPTP 410 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P P PT +P PS TPT TP P Sbjct: 341 TPTPTPTPTPTPTPTPTPTPAPTPTPTPSPTPTPTPTP 378 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT +P+ +P PTPT +P P+ TPT TP P Sbjct: 357 TPTPAPTPTPTPSPTPTPTPTPTPTPSPTPTPTPTPTP 394 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT +P+ +P PTPT +P P+ TPT TP P Sbjct: 371 TPTPTPTPTPTPSPTPTPTPTPTPTPSPTPTPTPTPTP 408 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/44 (52%), Positives = 29/44 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TP P+PT +P+ TP+ +P PTPT SP P+ TPT TP P P Sbjct: 359 TPAPTPTPTPSPTPTPTPTPTPTPSPTPTPTPTPTPTPSPTPTP 402 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP+P+PT +PT TP+ SP PTPT +P P+ +PT TP P Sbjct: 367 TPSPTPTPTPTPTPTPSPTPTPTPTPTPTPSPTPTPTP 404 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/51 (47%), Positives = 30/51 (58%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP 157 P P+PT +PT P+ +PEPTPT +P P+ TPT TP P AP P Sbjct: 320 PQPTPTPTPTPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPAPTPTPTPSP 370 Score = 53.9 bits (128), Expect = 6e-06 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+PT +PT TP+ +P PTPT +P P+ TPT +P P Sbjct: 335 TPEPTPTPTPTPTPTPTPTPTPTPTPAPTPTPTPSPTP 372 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/37 (56%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TP+ TP P Sbjct: 338 PTPTPTPTPTPTPTPTPTPTPTPAPTPTPTPSPTPTP 374 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTP +P P+ +PT TP P Sbjct: 339 TPTPTPTPTPTPTPTPTPTPTPAPTPTPTPSPTPTPTP 376 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/55 (41%), Positives = 33/55 (60%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS 166 TPTP+P+ +PT TP+ +P P+PT +P P+ TPT +P P P P L+ Sbjct: 363 TPTPTPSPTPTPTPTPTPTPSPTPTPTPTPTPTPSPTPTPTPTPTPTPEATPTLA 417 [71][TOP] >UniRef100_B9MKU5 Glycoside hydrolase family 9 n=1 Tax=Anaerocellum thermophilum DSM 6725 RepID=B9MKU5_ANATD Length = 1369 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN 112 TPTP+PT +PT TP+A+P PTPT +P P+ATPT TP+ Sbjct: 866 TPTPAPTPTPTPTPTATPTPTPTPTPTPTATPTPTPS 902 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPG--PSATPTATPNP 115 TPTP+PTL+PT T +A+P PTPT +P P+ATPTATP P Sbjct: 647 TPTPTPTLTPTPTSTATPTPTPTPTPTSTPTATPTATPTP 686 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+ T +PT TP+ +P PTPT +P P+ATPT TP P Sbjct: 852 TPTPTATPAPTVTPTPTPAPTPTPTPTPTATPTPTPTP 889 [72][TOP] >UniRef100_C8WKD8 Glycosyl transferase family 51 n=1 Tax=Eggerthella lenta DSM 2243 RepID=C8WKD8_9ACTN Length = 750 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGG 121 TPTP+PT +P TP+ +P+PTP P P+ TPT TP+PGG Sbjct: 704 TPTPTPTPTPDPTPTPTPDPTPKPDPDPTPTPTPTPDPGG 743 [73][TOP] >UniRef100_A4AT33 Putative secreted protein n=1 Tax=Flavobacteriales bacterium HTCC2170 RepID=A4AT33_9FLAO Length = 3828 Score = 58.5 bits (140), Expect = 2e-07 Identities = 46/136 (33%), Positives = 67/136 (49%), Gaps = 11/136 (8%) Frame = +2 Query: 140 LNVGGPAL----SGYVPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFG--KTVAYALP 301 +N GG + + +V D +V T YT P A + +Y T R KT Y++P Sbjct: 908 INAGGVLIDQNGTTFVADEHFVGGTPYTN----PSALVPD--MYKTERSSPSKTFQYSIP 961 Query: 302 LPTGTYTVSLLFAEVYTYTS-----AIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATA 466 + G YTV L FAE+Y + G+RVFD+ + ++L +YD+F++ G A Sbjct: 962 ITDGDYTVVLHFAEIYWGATGGGPGGSGQRVFDVTV----EGNLVLDNYDIFSEVGAEVA 1017 Query: 467 VAKVFDVTVTSAPLII 514 K FDVTV L I Sbjct: 1018 QQKSFDVTVNDGSLNI 1033 [74][TOP] >UniRef100_B5E0E8 GA24203 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5E0E8_DROPS Length = 139 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKL 142 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P ++ Sbjct: 89 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTRTRTPTRI 135 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 9 TPTPTPTPTPTPTPTPTPTPTPTPTPNPTPTPTPTPTP 46 Score = 57.4 bits (137), Expect = 6e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 17 TPTPTPTPTPTPTPTPTPNPTPTPTPTPTPTPTPTPTP 54 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/46 (52%), Positives = 31/46 (67%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVK 139 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P + Sbjct: 83 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTR 128 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 7 TPTPTPTPTPTPTPTPTPTPTPTPTPTPNPTPTPTPTP 44 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 11 TPTPTPTPTPTPTPTPTPTPTPTPNPTPTPTPTPTPTP 48 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 19 TPTPTPTPTPTPTPTPNPTPTPTPTPTPTPTPTPTPTP 56 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 21 TPTPTPTPTPTPTPNPTPTPTPTPTPTPTPTPTPTPTP 58 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 27 TPTPTPTPNPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 64 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 31 TPTPNPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 68 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 37 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 74 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 39 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 76 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 41 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 78 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 43 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 80 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 45 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 82 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 47 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 84 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 49 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 86 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 51 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 88 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 53 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 90 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 55 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 92 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 57 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 94 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 59 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 96 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 61 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 98 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 63 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 100 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 65 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 102 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 67 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 104 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 69 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 106 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 71 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 108 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 73 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 110 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 75 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 112 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 77 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 114 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 79 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 116 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 81 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 118 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTP +P P+ TPT TP P Sbjct: 13 TPTPTPTPTPTPTPTPTPTPTPNPTPTPTPTPTPTPTP 50 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P P PT +P P+ TPT TP P Sbjct: 15 TPTPTPTPTPTPTPTPTPTPNPTPTPTPTPTPTPTPTP 52 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT P+ +P PTPT +P P+ TPT TP P Sbjct: 23 TPTPTPTPTPTPNPTPTPTPTPTPTPTPTPTPTPTPTP 60 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +P TP+ +P PTPT +P P+ TPT TP P Sbjct: 25 TPTPTPTPTPNPTPTPTPTPTPTPTPTPTPTPTPTPTP 62 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+P +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 29 TPTPTPNPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 66 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 33 TPNPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 70 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 36 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 72 [75][TOP] >UniRef100_UPI0001BB5791 predicted protein n=1 Tax=Acinetobacter calcoaceticus RUH2202 RepID=UPI0001BB5791 Length = 538 Score = 58.2 bits (139), Expect = 3e-07 Identities = 39/124 (31%), Positives = 56/124 (45%), Gaps = 1/124 (0%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP- 178 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P V + ++ Sbjct: 37 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTTVADRFVGSWLAG 96 Query: 179 DGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYT 358 G + + ++K V+ S T R+ TG S AE ++ Sbjct: 97 KGACINGSALKMNVIK-VSDNSVRFASETVRYENEANC-----TGNIVASYRQAEDFSLV 150 Query: 359 SAIG 370 S IG Sbjct: 151 SNIG 154 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 29 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 66 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 31 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 68 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 33 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 70 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 35 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 72 [76][TOP] >UniRef100_UPI000185CDDA dermatan-binding protein n=1 Tax=Propionibacterium acnes SK137 RepID=UPI000185CDDA Length = 426 Score = 58.2 bits (139), Expect = 3e-07 Identities = 38/109 (34%), Positives = 51/109 (46%), Gaps = 4/109 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P Sbjct: 331 TPTPTPTPAPTPTPTPAPTPTPTPAPTPAPTPTPTPAPTPTPTPTPTPTPTP-------- 382 Query: 182 GPYVTSTTYTGTIVKPVAGTS---NDALYHTFRFGKTVAYALPLP-TGT 316 T+ T P++ T+ N +HT + +A LP TGT Sbjct: 383 -------THGATTTTPISRTTDRHNLGSHHTRIAAPALIHAKALPATGT 424 [77][TOP] >UniRef100_B0C9D0 Putative uncharacterized protein n=1 Tax=Acaryochloris marina MBIC11017 RepID=B0C9D0_ACAM1 Length = 247 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKL 142 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P K+ Sbjct: 174 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPPPTKPPEKV 220 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 172 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 209 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVK 139 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P K Sbjct: 171 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPPPTK 215 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYV 175 TPTP+PT +PT TP+ +P PTPT +P P+ TPT P P + G + G + Sbjct: 178 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPPPTKPPEKVPEPSTMAGLLIGGAI 235 [78][TOP] >UniRef100_C1WNA6 Putative uncharacterized protein n=1 Tax=Kribbella flavida DSM 17836 RepID=C1WNA6_9ACTO Length = 825 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/45 (53%), Positives = 32/45 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 TPTP+PT +PT TP+ +P PTPT +P P+ TPT+TP P + V Sbjct: 232 TPTPTPTPTPTPTPTLTPTPTPTPTPTPTPTPTSTPTPPACVTAV 276 [79][TOP] >UniRef100_B1Q2N7 Putative glycosidase n=1 Tax=Paenibacillus sp. KSM-M35 RepID=B1Q2N7_9BACL Length = 1280 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPG 118 PTP+PT +PT TP+A+P PTPT + P+ TPTATP PG Sbjct: 311 PTPTPTPTPTPTPTATPTPTPTPTATPTPTPTATPTPG 348 Score = 56.6 bits (135), Expect = 9e-07 Identities = 45/144 (31%), Positives = 65/144 (45%), Gaps = 18/144 (12%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP- 178 TPTP+PT +PT T + +P PTPTA+P P+ T T TP G LA K ++ +V Sbjct: 312 TPTPTPTPTPTPTATPTPTPTPTATPTPTPTATPTPGTGSNLALNKSITASSSVFTFVQT 371 Query: 179 ---DGPYVT-----STTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPT-------- 310 DG T +Y T+ + G++ D + + A++ T Sbjct: 372 NANDGDVTTYWEGAGGSYPNTLTVNL-GSNADVTSVVLKLNPSSAWSTRTQTIQVLGHNQ 430 Query: 311 -GTYTVSLLFAEVYTYTSAIGKRV 379 T SL+ A VYT+ A G V Sbjct: 431 NTTAFTSLVPATVYTFNPASGNTV 454 [80][TOP] >UniRef100_Q55F23 DNA2/NAM7 helicase family protein n=1 Tax=Dictyostelium discoideum RepID=Q55F23_DICDI Length = 2314 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKL 142 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P +L Sbjct: 575 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSTPKEL 621 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 571 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 608 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 573 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 610 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 TPTP+PT +PT TP+ +P PTPT +P P+ TPT T P +L+ + Sbjct: 581 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSTPKELLSNI 625 [81][TOP] >UniRef100_Q55CH1 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q55CH1_DICDI Length = 1432 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/73 (41%), Positives = 37/73 (50%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+ T +PT TPS +P PTPT +P P+ TPT TP P P P + Sbjct: 683 TPTPTQTSTPTQTPSQTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTQTPTPTQTPTPTQ 742 Query: 182 GPYVTSTTYTGTI 220 P T + T TI Sbjct: 743 TPTPTINSLTPTI 755 Score = 55.8 bits (133), Expect = 2e-06 Identities = 33/111 (29%), Positives = 53/111 (47%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TP+ +PT +PT TP+ +P PTPT +P P+ TPT T P P P ++ P Sbjct: 695 TPSQTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTQTPTPTQTPTPTQTPTPTINSLTPT 754 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLL 334 + S T T T+ +P S+ ++ ++ +L + +SLL Sbjct: 755 ---INSLTPTLTLQQPPNSLSSSMSSNSSISSTNISPSLSIAHKLSDISLL 802 [82][TOP] >UniRef100_Q0W6D4 Putative uncharacterized protein n=1 Tax=uncultured methanogenic archaeon RC-I RepID=Q0W6D4_UNCMA Length = 427 Score = 58.2 bits (139), Expect = 3e-07 Identities = 42/113 (37%), Positives = 53/113 (46%), Gaps = 4/113 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLN--VGGPALSGYV 175 T TP+PT +PT TP+ + PTPTA+P P+ATPT TP P P P + V Sbjct: 146 TVTPTPTATPTVTPTPTVTPTPTATPTPTATPTVTPTPTATPTPTATPTVTPTPTATPTV 205 Query: 176 PDGPYVTST-TYTGTIVKPVAGTSNDALYHTFRFGKTVAYAL-PLPTGTYTVS 328 P VT T T T T T+ + T T + P PT T TV+ Sbjct: 206 TPTPTVTPTPTPTATPTVTPTPTATPTVTPTPTATPTATPTVTPTPTATPTVT 258 Score = 56.2 bits (134), Expect = 1e-06 Identities = 47/178 (26%), Positives = 63/178 (35%), Gaps = 8/178 (4%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 T TP+ T +PT+TP+ +P PT T +P P+ATPT TP P P + V Sbjct: 190 TATPTVTPTPTATPTVTPTPTVTPTPTPTATPTVTPTPTATPTVTPTPTATPTATPTVTP 249 Query: 182 GPYVTST-----TYTGTIVKPVAGTSNDALYHTFRFGKTVA---YALPLPTGTYTVSLLF 337 P T T T T T+ T + T TV P PT T TV+ Sbjct: 250 TPTATPTVTPTPTVTPTVTPTPTVTPTPTVTPTVTPTPTVTPTQTVTPTPTATPTVTPTA 309 Query: 338 AEVYTYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLI 511 T T + V P + + E + T T P + Sbjct: 310 TPTVTPTPTVTPTVTPTPTATPRGNPATIDMSAFYVRVTEVPSPTPTVTPTPTPEPTV 367 Score = 54.3 bits (129), Expect = 5e-06 Identities = 40/123 (32%), Positives = 54/123 (43%), Gaps = 1/123 (0%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 T TP+PT++PT T + + PTPT +P P+ATPT T P + P P + V Sbjct: 140 TVTPTPTVTPTPTATPTVTPTPTVTPTPTATPTPTATP--TVTPTPTATPTPTATPTVTP 197 Query: 182 GPYVTST-TYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYT 358 P T T T T T+ T+ + T TV P PT T T + T T Sbjct: 198 TPTATPTVTPTPTVTPTPTPTATPTVTPTPTATPTVT---PTPTATPTATPTVTPTPTAT 254 Query: 359 SAI 367 + Sbjct: 255 PTV 257 [83][TOP] >UniRef100_Q0W3C3 Putative uncharacterized protein n=1 Tax=uncultured methanogenic archaeon RC-I RepID=Q0W3C3_UNCMA Length = 630 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/57 (50%), Positives = 36/57 (63%), Gaps = 6/57 (10%) Frame = +2 Query: 2 TPTPSPTLSPTSTP------SASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGG 154 TPTP+PT +PT TP + +P P PTA+P P+ TPTATP P IL P + V G Sbjct: 458 TPTPAPTSTPTVTPKPTLAPTPTPTPKPTATPKPTVTPTATPAPTPILTPTPVPVPG 514 [84][TOP] >UniRef100_A5YT33 Subtilisin-like serine protease n=1 Tax=uncultured haloarchaeon RepID=A5YT33_9EURY Length = 752 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/76 (39%), Positives = 40/76 (52%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P P + P+ Sbjct: 526 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PN 582 Query: 182 GPYVTSTTYTGTIVKP 229 + + T T V P Sbjct: 583 SDITVTRSDTATEVTP 598 [85][TOP] >UniRef100_Q3M8E3 Putative uncharacterized protein n=1 Tax=Anabaena variabilis ATCC 29413 RepID=Q3M8E3_ANAVT Length = 624 Score = 57.8 bits (138), Expect = 4e-07 Identities = 37/104 (35%), Positives = 50/104 (48%), Gaps = 19/104 (18%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLN------------ 145 TPTP+PT PT TP+ +P PTPT +P P+ TPT TP P P+ L Sbjct: 387 TPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPTPKPINLKDIGNHWAAPFIR 446 Query: 146 --VGGPALSGYVPDGPY-----VTSTTYTGTIVKPVAGTSNDAL 256 V +SG+ PDG + +T Y +VK + N A+ Sbjct: 447 ELVQQGIVSGF-PDGTFKPDATMTRAQYAALLVKAFNPSPNRAV 489 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/52 (48%), Positives = 31/52 (59%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP 157 TPTP+PT +PT TP+ +P PTPT +P P TPT P P I P + P Sbjct: 293 TPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPTPIPTPTPIPTPTPIPTPTP 344 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/49 (48%), Positives = 32/49 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNV 148 TPTP+PT +P TP+ +P PTPT +P P+ TPT TP P P +N+ Sbjct: 385 TPTPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPTPKPINL 433 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/45 (53%), Positives = 29/45 (64%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 TPTP PT +PT TP+ P PTPT +P P+ TPT TP P P+ Sbjct: 379 TPTPIPTPTPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPTPTPI 423 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/76 (38%), Positives = 36/76 (47%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 PTP+P +PT TP+ +P PTPT +P P TPT TP P I P P + Sbjct: 356 PTPTPIPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPTPIPTPTPTPTPTPTPTPTPTPT 415 Query: 185 PYVTSTTYTGTIVKPV 232 P T T KP+ Sbjct: 416 PTPTPTPIPTPTPKPI 431 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 357 TPTPIPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPTP 394 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP +P PTPT +P P+ TPT TP P Sbjct: 369 TPTPTPTPTPTPTPIPTPTPTPTPTPIPTPTPTPTPTP 406 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ P PTPT +P P TPT TP P Sbjct: 367 TPTPTPTPTPTPTPTPIPTPTPTPTPTPIPTPTPTPTP 404 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/67 (40%), Positives = 34/67 (50%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTP +P P TPT P P I P + P + Sbjct: 299 TPTPTPTPTPTPTPTPTPTPTPIPTPTPIPTPTPIPTPTPIPTPTPTPIPTPTPTPIPTP 358 Query: 182 GPYVTST 202 P T T Sbjct: 359 TPIPTPT 365 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP PT +PT P+ +P PTPT +P P+ TPT TP P I P Sbjct: 343 TPTPIPTPTPTPIPTPTPIPTPTPTPTPTPTPTPTPTPTPIPTP 386 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/52 (46%), Positives = 31/52 (59%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP 157 TPTP+P +PT TP+ +P PTPT +P P+ TPT TP P P + P Sbjct: 377 TPTPTPIPTPTPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPTP 428 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ PT TP P Sbjct: 365 TPTPTPTPTPTPTPTPTPIPTPTPTPTPTPIPTPTPTP 402 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/52 (46%), Positives = 30/52 (57%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP 157 TPTP+PT PT TP+ +P P PT +P P+ TPT TP P P + P Sbjct: 375 TPTPTPTPIPTPTPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTP 426 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT P+ +P PTPT P P+ TPT TP P Sbjct: 371 TPTPTPTPTPTPIPTPTPTPTPTPIPTPTPTPTPTPTP 408 [86][TOP] >UniRef100_Q2JUL1 Putative lipoprotein n=1 Tax=Synechococcus sp. JA-3-3Ab RepID=Q2JUL1_SYNJA Length = 580 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/49 (51%), Positives = 32/49 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNV 148 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P + V Sbjct: 185 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPAQFYV 233 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 183 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 220 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 182 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 218 [87][TOP] >UniRef100_Q01RD0 Putative uncharacterized protein n=1 Tax=Candidatus Solibacter usitatus Ellin6076 RepID=Q01RD0_SOLUE Length = 508 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/96 (35%), Positives = 55/96 (57%), Gaps = 5/96 (5%) Frame = +2 Query: 230 VAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYTSAIGK-----RVFDIAI 394 V GT + L+ + R+G +Y P+P+G Y + LLFAE + GK R+F++A Sbjct: 392 VGGTPDPELFLSQRYGN-FSYRFPVPSGRYALRLLFAETFFGPHNRGKGGPGSRIFNVAS 450 Query: 395 GDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSA 502 G +LLH++++F +AGE ++ KVF V +A Sbjct: 451 GGV----ILLHNFEIFKEAGERRSIEKVFHGLVPNA 482 [88][TOP] >UniRef100_B9M9D3 Putative uncharacterized protein n=1 Tax=Geobacter sp. FRC-32 RepID=B9M9D3_GEOSF Length = 213 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/56 (50%), Positives = 34/56 (60%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSG 169 TPTP P+ +PT TP+A+P P PTA+P P+ TPT TP P P PA SG Sbjct: 107 TPTPKPSPTPTPTPTATPTPAPTATPTPTPTPTPTPTP----TPKPTPTPTPAASG 158 Score = 57.4 bits (137), Expect = 6e-07 Identities = 33/92 (35%), Positives = 40/92 (43%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TP+P P +SPT P SP PTPT +P P+ATPT P+P P P + Sbjct: 79 TPSPKPVVSPT--PKPSPTPTPTPTPTPTATPTPKPSPTPTPTPTATPTPAPTATPTPTP 136 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFG 277 P T T P S LY T+ G Sbjct: 137 TPTPTPTPTPKPTPTPTPAASGATLYQTYCSG 168 [89][TOP] >UniRef100_B9L3Q3 Autotransporter-associated beta strand repeat protein, putative n=1 Tax=Thermomicrobium roseum DSM 5159 RepID=B9L3Q3_THERP Length = 479 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILA 130 TP+P+PT +PT+TPS +P PTPT +P P+ATPT P P + A Sbjct: 316 TPSPTPTPTPTATPSPTPTPTPTPTPTPTATPTPVPTPTPLAA 358 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPT +P+ +PT TP+A+P PTPT +P P+ TPTATP P Sbjct: 312 TPTATPSPTPTPTPTATPSPTPTPTPTPTPTPTATPTP 349 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/49 (48%), Positives = 31/49 (63%) Frame = +2 Query: 11 PSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP 157 P+PT +PT+TPS +P PTPTA+P P+ TPT TP P P + P Sbjct: 307 PTPTSTPTATPSPTPTPTPTATPSPTPTPTPTPTPTPTATPTPVPTPTP 355 [90][TOP] >UniRef100_B2TDY7 Putative uncharacterized protein n=1 Tax=Burkholderia phytofirmans PsJN RepID=B2TDY7_BURPP Length = 748 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/39 (58%), Positives = 30/39 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPG 118 TPTP+PT +PT TP+ +P PTPT +P P+ TPT +P PG Sbjct: 118 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPSPTPG 156 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/48 (52%), Positives = 32/48 (66%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLN 145 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P +P N Sbjct: 110 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPSPTPGN 157 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 108 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 145 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/58 (39%), Positives = 33/58 (56%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYV 175 TPTP+PT +PT TP+ +P PTPT +P P+ TP+ TP + G +G + Sbjct: 120 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPSPTPGNATMSCSTPTQTAGGTANGVI 177 [91][TOP] >UniRef100_Q3RD14 Peptidase S8 and S53, subtilisin, kexin, sedolisin (Fragment) n=1 Tax=Xylella fastidiosa Dixon RepID=Q3RD14_XYLFA Length = 666 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS 166 TPTP+PT +PT TP+ +P P PT +P P+ TPT TP P P L PAL+ Sbjct: 49 TPTPTPTPTPTPTPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPTPLPDLDPALA 103 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 43 TPTPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPTP 80 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P TPT TP P Sbjct: 41 TPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTP 78 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT P P+ TPT TP P Sbjct: 45 TPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPTPTP 82 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT P P Sbjct: 35 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTP 72 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TP TP P Sbjct: 37 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPTP 74 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ PT TP P Sbjct: 39 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTP 76 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 34 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIP 70 [92][TOP] >UniRef100_Q06WK6 Host cell-surface attachment protein PA25957 n=1 Tax=Propionibacterium acnes RepID=Q06WK6_PROAC Length = 432 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P+PTPT +P P+ TPT TP P Sbjct: 338 TPTPTPTPTPTPTPTPTPKPTPTPTPKPTPTPTPTPTP 375 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P TPT TP P Sbjct: 328 TPTPTPTPTPTPTPTPTPTPTPTPTPTPKPTPTPTPKP 365 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ P PTPT P P+ TPT TP P Sbjct: 340 TPTPTPTPTPTPTPTPKPTPTPTPKPTPTPTPTPTPTP 377 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT +PT TP +P PTP +P P+ TPT TP P AP Sbjct: 342 TPTPTPTPTPTPTPKPTPTPTPKPTPTPTPTPTPTPKPKPTPAP 385 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT P P Sbjct: 330 TPTPTPTPTPTPTPTPTPTPTPTPTPKPTPTPTPKPTP 367 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT P P+ TP TP P Sbjct: 332 TPTPTPTPTPTPTPTPTPTPTPTPKPTPTPTPKPTPTP 369 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P P PT +P P TPT TP P Sbjct: 336 TPTPTPTPTPTPTPTPTPTPKPTPTPTPKPTPTPTPTP 373 [93][TOP] >UniRef100_C9KWU0 Beta-galactosidase n=1 Tax=Bacteroides finegoldii DSM 17565 RepID=C9KWU0_9BACE Length = 1399 Score = 57.8 bits (138), Expect = 4e-07 Identities = 39/117 (33%), Positives = 57/117 (48%), Gaps = 7/117 (5%) Frame = +2 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK-TVAYALPLPTGTYTVSLLFAEVY---- 349 PY+ S T P+ GT + L+ FRFG+ + Y P+ GTY + L F E + Sbjct: 1104 PYLASQRTTND---PIRGTRDWTLFQHFRFGRHQLEYRFPVADGTYRIELYFTEPWHGTG 1160 Query: 350 --TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 T G R+FD+A+ D+ V+L D D++A++G KV TV L I Sbjct: 1161 GSASTDCEGLRIFDVAVNDS----VVLDDLDIWAESGHDGVCKKVVYATVKGGMLKI 1213 [94][TOP] >UniRef100_C4E422 Chitinase n=1 Tax=Streptosporangium roseum DSM 43021 RepID=C4E422_STRRS Length = 507 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = +2 Query: 8 TPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGY 172 TPSP SPT TP+ +P PTPT +P P+ TPT TP P G PVK G L GY Sbjct: 155 TPSP--SPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-GTTCPVKSRPTGKVLHGY 206 [95][TOP] >UniRef100_C3QD30 Beta-galactosidase n=1 Tax=Bacteroides sp. D1 RepID=C3QD30_9BACE Length = 1403 Score = 57.8 bits (138), Expect = 4e-07 Identities = 39/117 (33%), Positives = 57/117 (48%), Gaps = 7/117 (5%) Frame = +2 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK-TVAYALPLPTGTYTVSLLFAEVY---- 349 PY+ S T P+ GT + L+ FRFG+ + Y P+ GTY + L F E + Sbjct: 1108 PYLASQRTTND---PIRGTRDWTLFQHFRFGRHQLEYRFPVADGTYRIELYFTEPWHGTG 1164 Query: 350 --TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 T G R+FD+A+ D+ V+L D D++A++G KV TV L I Sbjct: 1165 GSASTDCEGLRIFDVAVNDS----VVLDDLDIWAESGHDGVCKKVVYATVKGGMLKI 1217 [96][TOP] >UniRef100_C1RNC6 Cellobiohydrolase A (1,4-beta-cellobiosidase A) n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RNC6_9CELL Length = 832 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 22/79 (27%) Frame = +2 Query: 2 TPTPSPTLSPTSTP----SASPEPTPTASPGPSATPTATP----NPG------------- 118 TPTPSPT++PT TP + +P PTPT SP PS TP+ TP NPG Sbjct: 682 TPTPSPTVTPTPTPTPTVTPTPTPTPTVSPTPSPTPSPTPSPTQNPGGACTVSYTANAWN 741 Query: 119 -GILAPVKLNVGGPALSGY 172 G A V++ G ALSG+ Sbjct: 742 TGFTASVRVTNKGAALSGW 760 Score = 54.7 bits (130), Expect = 4e-06 Identities = 28/64 (43%), Positives = 36/64 (56%), Gaps = 7/64 (10%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSAS----PEPTPTASPGPSATPTATPNPGGILAPV---KLNVGGPA 160 TPTP+PT++PT TPS + P PTPT +P P+ TPT +P P +P N GG Sbjct: 672 TPTPTPTVTPTPTPSPTVTPTPTPTPTVTPTPTPTPTVSPTPSPTPSPTPSPTQNPGGAC 731 Query: 161 LSGY 172 Y Sbjct: 732 TVSY 735 [97][TOP] >UniRef100_Q54MZ1 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q54MZ1_DICDI Length = 519 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 T TPSPT SPT +P+ SP P+PT SP PS TPT TP+P Sbjct: 205 TETPSPTKSPTPSPTPSPTPSPTPSPTPSPTPTTTPSP 242 [98][TOP] >UniRef100_Q54D31 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q54D31_DICDI Length = 644 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLN 145 TPTPSPT +PT +P+ SP P+PT SP PS TP+ TP P +P N Sbjct: 228 TPTPSPTQTPTPSPTPSPTPSPTPSPTPSPTPSPTPTPFPTPSPTPNN 275 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT TP+ SP P+PT SP PS T T TP+P Sbjct: 196 SPTPSPTPSPTQTPTLSPTPSPTPSPTPSPTQTPTPSP 233 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT TP+ SP TPT SP PS TP+ TP+P Sbjct: 216 SPTPSPTPSPTQTPTPSPTQTPTPSPTPSPTPSPTPSP 253 Score = 57.0 bits (136), Expect = 7e-07 Identities = 25/59 (42%), Positives = 35/59 (59%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP 178 +PTPSPT +PT +P+ +P P+PT SP PS TP+ TP+P P P + +P Sbjct: 220 SPTPSPTQTPTPSPTQTPTPSPTPSPTPSPTPSPTPSPTPSPTPTPFPTPSPTPNNPIP 278 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT +P+ SP TPT SP PS TP+ TP+P Sbjct: 188 SPTPSPTPSPTPSPTPSPTQTPTLSPTPSPTPSPTPSP 225 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT +P+ +P P+PT +P PS TP+ TP+P Sbjct: 212 SPTPSPTPSPTPSPTQTPTPSPTQTPTPSPTPSPTPSP 249 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT TP+ + P+PT +P P+ +PT TPNP Sbjct: 422 SPTPSPTPSPTRTPTPTRTPSPTRTPSPTPSPTPTPNP 459 [99][TOP] >UniRef100_Q63P41 Putative uncharacterized protein n=1 Tax=Burkholderia pseudomallei RepID=Q63P41_BURPS Length = 899 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/52 (48%), Positives = 32/52 (61%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP 157 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P P + P Sbjct: 777 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPMPTPTP 828 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 745 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 782 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 747 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 784 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 749 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 786 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 751 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 788 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 753 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 790 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 755 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 792 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 757 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 794 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 759 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 796 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 761 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 798 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 763 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 800 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 765 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 802 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 767 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 804 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 769 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 806 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 771 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 808 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 773 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 810 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 775 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 812 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 825 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 862 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 827 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 864 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 829 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 866 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 831 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 868 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 833 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 870 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 835 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 872 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 837 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 874 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 839 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 876 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 841 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 878 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 843 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 880 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 845 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 882 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 847 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 884 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 849 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 886 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 851 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 888 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 853 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 890 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 855 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 892 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 857 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 894 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 797 TPTPTPTPTPTPTPTPTPTPTPTPTPMPTPTPTPTPTP 834 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 805 TPTPTPTPTPTPTPTPTPMPTPTPTPTPTPTPTPTPTP 842 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P TPT TP P Sbjct: 795 TPTPTPTPTPTPTPTPTPTPTPTPTPTPMPTPTPTPTP 832 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT P P+ TPT TP P Sbjct: 799 TPTPTPTPTPTPTPTPTPTPTPTPMPTPTPTPTPTPTP 836 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ P PTPT +P P+ TPT TP P Sbjct: 807 TPTPTPTPTPTPTPTPMPTPTPTPTPTPTPTPTPTPTP 844 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP +P PTPT +P P+ TPT TP P Sbjct: 809 TPTPTPTPTPTPTPMPTPTPTPTPTPTPTPTPTPTPTP 846 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 815 TPTPTPTPMPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 852 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 819 TPTPMPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 856 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 780 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 824 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 860 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ PT TP P Sbjct: 793 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPMPTPTPTP 830 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTP +P P+ TPT TP P Sbjct: 801 TPTPTPTPTPTPTPTPTPTPTPMPTPTPTPTPTPTPTP 838 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P P PT +P P+ TPT TP P Sbjct: 803 TPTPTPTPTPTPTPTPTPTPMPTPTPTPTPTPTPTPTP 840 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT P+ +P PTPT +P P+ TPT TP P Sbjct: 811 TPTPTPTPTPTPMPTPTPTPTPTPTPTPTPTPTPTPTP 848 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +P TP+ +P PTPT +P P+ TPT TP P Sbjct: 813 TPTPTPTPTPMPTPTPTPTPTPTPTPTPTPTPTPTPTP 850 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+P +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 817 TPTPTPMPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 854 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 821 TPMPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 858 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 859 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 899 [100][TOP] >UniRef100_Q21HU1 Putative alginate lyase n=1 Tax=Saccharophagus degradans 2-40 RepID=Q21HU1_SACD2 Length = 524 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 3/62 (4%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP---GGILAPVKLNVGGPALSGY 172 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P L+ + + GY Sbjct: 32 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPVECTPALSTISSAFDDGSNDGY 91 Query: 173 VP 178 VP Sbjct: 92 VP 93 [101][TOP] >UniRef100_B9MKT9 Glycoside hydrolase family 5 n=1 Tax=Anaerocellum thermophilum DSM 6725 RepID=B9MKT9_ANATD Length = 1294 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+ T +PT TP+A+P PTPT +P P+ATPT TP P Sbjct: 511 TPTPTATPAPTVTPTATPAPTPTPTPTPTATPTPTPTP 548 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN 112 T TP+PT +PT TP+A+P PTPT +P P+ATPT TP+ Sbjct: 525 TATPAPTPTPTPTPTATPTPTPTPTPTPTATPTPTPS 561 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 T TP+PT++PT+TP+ +P PTPT + P+ TPT TP P P Sbjct: 515 TATPAPTVTPTATPAPTPTPTPTPTATPTPTPTPTPTPTATPTP 558 [102][TOP] >UniRef100_B9MKT7 Glycoside hydrolase family 48 n=1 Tax=Anaerocellum thermophilum DSM 6725 RepID=B9MKT7_ANATD Length = 1478 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+ T +PT TP+ +P PTPT +P P+ATPTATP P Sbjct: 784 TPTPTATPAPTVTPTPTPAPTPTPTPTPTATPTATPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT+TP+A+P PTPT +P P+ATPT T P Sbjct: 803 PTPTPTPTPTATPTATPTPTPTPTPTPTATPTVTATP 839 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATP 109 TPTP+PT +PT TP+A+P TPT +P P+ TPTATP Sbjct: 798 TPTPAPTPTPTPTPTATPTATPTPTPTPTPTPTATP 833 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 T TP+PT++PT TP+ +P PTPT + P+ATPT TP P Sbjct: 788 TATPAPTVTPTPTPAPTPTPTPTPTATPTATPTPTPTP 825 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PTL+PT TP+ +P TPTA+ P+ATPT TP P Sbjct: 388 TPTPTPTLTPTPTPTPTPTSTPTAT--PTATPTPTPTP 423 [103][TOP] >UniRef100_A8M6R1 NLP/P60 protein n=1 Tax=Salinispora arenicola CNS-205 RepID=A8M6R1_SALAI Length = 501 Score = 57.4 bits (137), Expect = 6e-07 Identities = 32/80 (40%), Positives = 40/80 (50%), Gaps = 9/80 (11%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN--PGGILAPVKLNVG-------G 154 TPTPS T PT PSA+P P+ T +P P+ TPT+TP+ P P G Sbjct: 417 TPTPSATPKPTPPPSATPSPSATGTPSPTTTPTSTPSPTPSPTSTPTTTPTGTPPPATSA 476 Query: 155 PALSGYVPDGPYVTSTTYTG 214 PA + P P T+ T TG Sbjct: 477 PASTSAAPTSPAPTTPTATG 496 [104][TOP] >UniRef100_A4T104 Conserved hypothetical proline rich protein n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4T104_MYCGI Length = 617 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/59 (47%), Positives = 35/59 (59%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP 178 TPTP+PT P+STP+ +P PTPT +P P+ TPT TP P P + P S VP Sbjct: 518 TPTPTPT--PSSTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSTPAPTSTPPPVTSQPVP 574 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPS T +PT TPS++P PTPT +P P+ TPT TP P Sbjct: 512 TPTPSSTPTPTPTPSSTPTPTPTPTPTPTPTPTPTPTP 549 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+P+ +PT TPS++P PTPT S P+ TPT TP P Sbjct: 502 TPTPTPSSTPTPTPSSTPTPTPTPSSTPTPTPTPTPTP 539 Score = 53.9 bits (128), Expect = 6e-06 Identities = 29/67 (43%), Positives = 36/67 (53%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT P+STP+ +P TPT +P PS+TPT TP P P P + Sbjct: 500 TPTPTPT--PSSTPTPTPSSTPTPTPTPSSTPTPTPTPTPTPTPTPTPTPTPTPTPTPTS 557 Query: 182 GPYVTST 202 P TST Sbjct: 558 TPAPTST 564 [105][TOP] >UniRef100_A0LSI0 Glycoside hydrolase, family 48 n=1 Tax=Acidothermus cellulolyticus 11B RepID=A0LSI0_ACIC1 Length = 1121 Score = 57.4 bits (137), Expect = 6e-07 Identities = 42/122 (34%), Positives = 57/122 (46%), Gaps = 2/122 (1%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 P+ SP+ +P+ TP++SP PTP++SP TP+ +P+P G P VP G Sbjct: 866 PSGSPSPTPSPTPTSSPSPTPSSSP----TPSPSPSPTGDTTPPS-----------VPTG 910 Query: 185 PYVTSTTYTGTIVKPVAGTSN--DALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYT 358 VT TT + + A T N A Y+ +R G V P T L YTYT Sbjct: 911 LQVTGTTTSSVSLSWTASTDNVGVAHYNVYRNGTLVGQ--PTATSFTDTGLAAGTSYTYT 968 Query: 359 SA 364 A Sbjct: 969 VA 970 [106][TOP] >UniRef100_UPI0001B4102B Rhs element Vgr protein n=1 Tax=Burkholderia thailandensis E264 RepID=UPI0001B4102B Length = 856 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 730 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 767 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 732 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 805 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 770 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 807 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 772 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 809 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 774 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 811 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 776 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 813 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 778 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 815 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 780 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 817 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 782 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 819 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 786 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 788 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 825 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 790 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 827 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 792 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 829 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 794 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 831 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 796 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 833 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 798 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 835 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 800 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 837 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 802 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 839 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 804 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 841 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 806 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 843 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 808 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 845 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 810 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 847 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 812 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 849 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 814 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 851 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 724 TPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 761 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 729 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 765 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 726 TPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 763 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 816 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 856 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP PT +P TP+ +P PTPT +P P+ TPT TP P Sbjct: 718 TPTPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTP 755 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+PT PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 720 TPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 757 [107][TOP] >UniRef100_UPI00016ACA4F Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei 14 RepID=UPI00016ACA4F Length = 776 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 718 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 755 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 720 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 757 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 722 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 759 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 724 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 761 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 726 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 763 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 728 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 765 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 730 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 767 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 732 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 717 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 753 [108][TOP] >UniRef100_UPI00016A88CC Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei DM98 RepID=UPI00016A88CC Length = 788 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 718 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 755 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 720 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 757 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 722 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 759 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 717 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 753 [109][TOP] >UniRef100_UPI00016A8058 Rhs element Vgr protein n=1 Tax=Burkholderia thailandensis Bt4 RepID=UPI00016A8058 Length = 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 730 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 767 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 732 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 724 TPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 761 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 729 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 765 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 726 TPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 763 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP PT +P TP+ +P PTPT +P P+ TPT TP P Sbjct: 718 TPTPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTP 755 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+PT PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 720 TPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 757 [110][TOP] >UniRef100_A7IUD9 Putative uncharacterized protein M409R n=1 Tax=Paramecium bursaria chlorella virus MT325 RepID=A7IUD9_PBCVM Length = 469 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 49 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 86 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 51 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 88 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 53 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 90 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 55 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 92 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 57 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 94 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 59 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 96 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 61 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 98 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 63 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 100 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 65 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 102 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 67 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 104 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 69 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 106 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 71 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 108 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 73 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPKP 110 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT P P Sbjct: 75 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPKPTP 112 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TP TP P Sbjct: 77 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPKPTPTP 114 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ PT TP P Sbjct: 79 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPKPTPTPKP 116 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TP TP P Sbjct: 83 TPTPTPTPTPTPTPTPTPTPTPTPTPKPTPTPKPTPKP 120 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P+PTPT P P TP TP P Sbjct: 91 TPTPTPTPTPTPTPTPTPKPTPTPKPTPKPTPKPTPKP 128 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P TPT P P Sbjct: 81 TPTPTPTPTPTPTPTPTPTPTPTPTPTPKPTPTPKPTP 118 [111][TOP] >UniRef100_Q3JI33 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei 1710b RepID=Q3JI33_BURP1 Length = 858 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 805 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 770 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 807 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 772 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 809 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 774 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 811 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 776 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 813 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 778 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 815 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 780 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 817 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 782 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 819 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 786 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 788 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 825 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 790 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 827 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 792 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 829 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 794 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 831 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 796 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 833 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 798 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 835 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 800 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 837 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 802 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 839 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 804 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 841 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 806 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 843 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 808 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 845 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 810 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 847 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 812 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 849 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 814 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 851 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 816 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 853 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 733 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 818 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 858 [112][TOP] >UniRef100_Q2T918 Rhs element Vgr protein n=1 Tax=Burkholderia thailandensis E264 RepID=Q2T918_BURTA Length = 872 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 805 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 770 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 807 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 772 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 809 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 774 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 811 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 776 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 813 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 778 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 815 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 780 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 817 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 782 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 819 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 786 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 788 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 825 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 790 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 827 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 792 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 829 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 794 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 831 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 796 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 833 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 798 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 835 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 800 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 837 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 802 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 839 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 804 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 841 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 806 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 843 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 808 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 845 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 810 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 847 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 812 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 849 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 814 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 851 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 816 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 853 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 818 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 855 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 820 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 857 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 822 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 859 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 824 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 861 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 826 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 863 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 828 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 865 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 830 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 867 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 745 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 832 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 872 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP PT +P TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+PT PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 [113][TOP] >UniRef100_Q13LA5 Putative uncharacterized protein n=1 Tax=Burkholderia xenovorans LB400 RepID=Q13LA5_BURXL Length = 761 Score = 57.0 bits (136), Expect = 7e-07 Identities = 30/85 (35%), Positives = 39/85 (45%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P P PT +P P+ PT TP P P P Sbjct: 117 TPTPAPTPTPTPTPTPTPTPIPTPAPAPTPAPTPTPTPTPTPTPAPAPAPAPG------- 169 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDAL 256 TST T + GT+N + Sbjct: 170 ----TSTMSCSTPTQTAGGTANGVI 190 [114][TOP] >UniRef100_C5BID0 Putative uncharacterized protein n=1 Tax=Teredinibacter turnerae T7901 RepID=C5BID0_TERTT Length = 890 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TP+PSPT SP+ TPS SP P+PT SP P+ +P+ TP+P +P Sbjct: 188 TPSPSPTPSPSPTPSPSPTPSPTPSPSPTPSPSPTPSPSPTPSP 231 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 TP+PSPT SPT +PS +P P+PT SP P+ +P+ TP+P P+ Sbjct: 200 TPSPSPTPSPTPSPSPTPSPSPTPSPSPTPSPSPTPSPSPTPPPI 244 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/44 (52%), Positives = 32/44 (72%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TP+PSPT SP+ TPS +P P+PT SP P+ +P+ TP+P +P Sbjct: 194 TPSPSPTPSPSPTPSPTPSPSPTPSPSPTPSPSPTPSPSPTPSP 237 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/44 (52%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TP PSPT SP+ TPS SP P+P+ +P PS TP+ +P P +P Sbjct: 170 TPPPSPTPSPSPTPSMSPTPSPSPTPSPSPTPSPSPTPSPTPSP 213 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/44 (52%), Positives = 31/44 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TP+PSPT S + TPS SP P+P+ +P PS TP+ TP+P +P Sbjct: 176 TPSPSPTPSMSPTPSPSPTPSPSPTPSPSPTPSPTPSPSPTPSP 219 [115][TOP] >UniRef100_B2J7D2 Putative uncharacterized protein n=1 Tax=Nostoc punctiforme PCC 73102 RepID=B2J7D2_NOSP7 Length = 543 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 293 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 330 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 295 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 332 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 297 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 334 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 299 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 336 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 301 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 338 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 303 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 340 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 305 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 342 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 307 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 344 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 309 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 346 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 311 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 348 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 313 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 350 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 292 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 328 [116][TOP] >UniRef100_A7HCF6 DNA polymerase III, alpha subunit n=1 Tax=Anaeromyxobacter sp. Fw109-5 RepID=A7HCF6_ANADF Length = 1197 Score = 57.0 bits (136), Expect = 7e-07 Identities = 35/88 (39%), Positives = 44/88 (50%), Gaps = 5/88 (5%) Frame = +2 Query: 8 TPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD-- 181 TP+PT +PT+TP+A+P TPTA+P P+ATPTATP P V P P+ Sbjct: 337 TPTPTATPTATPTATPTATPTATPTPTATPTATPTATPTATPTATPV-PPGKEAAHPERS 395 Query: 182 ---GPYVTSTTYTGTIVKPVAGTSNDAL 256 S T T + P G S AL Sbjct: 396 DSASAEARSRGTTSTPIDPADGVSGMAL 423 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 TPT +PT +PT+TP+A+P TPT + P+ATPTATP PV Sbjct: 339 TPTATPTATPTATPTATPTATPTPTATPTATPTATPTATPTATPV 383 Score = 53.5 bits (127), Expect = 8e-06 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 4/44 (9%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPT--PTASPG--PSATPTATPNPGG 121 TPT +PT +PT+TP+A+P PT PTA+P P+ATPTATP P G Sbjct: 343 TPTATPTATPTATPTATPTPTATPTATPTATPTATPTATPVPPG 386 [117][TOP] >UniRef100_A3NFQ1 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei 668 RepID=A3NFQ1_BURP6 Length = 930 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 805 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 770 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 807 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 772 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 809 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 774 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 811 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 776 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 813 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 778 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 815 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 780 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 817 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 782 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 819 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 786 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 788 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 825 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 790 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 827 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 792 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 829 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 794 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 831 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 796 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 833 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 798 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 835 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 800 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 837 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 802 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 839 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 804 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 841 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 806 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 843 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 808 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 845 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 810 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 847 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 812 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 849 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 814 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 851 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 816 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 853 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 818 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 855 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 820 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 857 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 822 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 859 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 824 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 861 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 826 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 863 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 828 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 865 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 830 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 867 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 832 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 869 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 834 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 871 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 836 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 873 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 838 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 875 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 840 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 877 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 842 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 879 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 844 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 881 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 846 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 883 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 848 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 885 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 850 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 887 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 852 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 889 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 854 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 891 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 856 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 893 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 858 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 895 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 860 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 897 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 862 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 899 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 864 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 901 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 866 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 903 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 868 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 905 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 870 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 907 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 872 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 909 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 874 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 911 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 876 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 913 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 878 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 915 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 880 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 917 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 882 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 919 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 884 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 921 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 886 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 923 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 888 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 925 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 733 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 890 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 930 [118][TOP] >UniRef100_A0LR95 Glycoside hydrolase, family 10 n=1 Tax=Acidothermus cellulolyticus 11B RepID=A0LR95_ACIC1 Length = 678 Score = 57.0 bits (136), Expect = 7e-07 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 24/109 (22%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN-------------PGGILAPVKL 142 +PTPSP+ +P+ +PS SP P+P+ SP PS +P+++P+ PGG A V + Sbjct: 544 SPTPSPSPTPSPSPSPSPSPSPSPSPSPSPSPSSSPSSGCVASMRVDSSWPGGFTATVTV 603 Query: 143 -NVGGPALSGYV-----PDGPYVTS-----TTYTGTIVKPVAGTSNDAL 256 N GG + SG+ P G + + + TGT V+ V + N + Sbjct: 604 SNTGGVSTSGWQVGWSWPSGDSLVNAWNAVVSVTGTSVRAVNASYNGVI 652 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/52 (44%), Positives = 35/52 (67%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP 157 +P+PSP+ SP+ +PS SP P+P+ SP PS +P+++P GG+ K N P Sbjct: 352 SPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSSSPVSGGVKVQYKNNDSAP 403 [119][TOP] >UniRef100_A0LR94 Esterase, PHB depolymerase family n=1 Tax=Acidothermus cellulolyticus 11B RepID=A0LR94_ACIC1 Length = 656 Score = 57.0 bits (136), Expect = 7e-07 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 24/109 (22%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN-------------PGGILAPVKL 142 +PTPSP+ +P+ +PS SP P+P+ SP PS +P+++P+ PGG A V + Sbjct: 522 SPTPSPSPTPSPSPSPSPSPSPSPSPSPSPSPSSSPSSGCVASMRVDSSWPGGFTATVTV 581 Query: 143 -NVGGPALSGYV-----PDGPYVTS-----TTYTGTIVKPVAGTSNDAL 256 N GG + SG+ P G + + + TGT V+ V + N + Sbjct: 582 SNTGGVSTSGWQVGWSWPSGDSLVNAWNAVVSVTGTSVRAVNASYNGVI 630 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/52 (44%), Positives = 35/52 (67%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP 157 +P+PSP+ SP+ +PS SP P+P+ SP PS +P+++P GG+ K N P Sbjct: 330 SPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSSSPVSGGVKVQYKNNDSAP 381 [120][TOP] >UniRef100_A3P1H6 Rhs element Vgr protein n=2 Tax=Burkholderia pseudomallei RepID=A3P1H6_BURP0 Length = 896 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 805 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 770 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 807 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 772 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 809 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 774 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 811 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 776 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 813 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 778 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 815 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 780 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 817 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 782 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 819 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 786 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 788 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 825 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 790 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 827 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 792 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 829 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 794 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 831 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 796 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 833 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 798 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 835 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 800 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 837 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 802 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 839 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 804 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 841 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 806 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 843 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 808 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 845 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 810 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 847 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 812 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 849 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 814 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 851 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 816 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 853 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 818 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 855 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 820 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 857 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 822 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 859 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 824 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 861 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 826 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 863 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 828 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 865 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 830 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 867 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 832 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 869 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 834 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 871 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 836 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 873 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 838 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 875 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 840 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 877 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 842 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 879 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 844 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 881 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 846 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 883 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 848 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 885 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 850 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 887 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 852 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 889 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 854 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 891 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 733 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 856 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 896 [121][TOP] >UniRef100_C4I5F4 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei MSHR346 RepID=C4I5F4_BURPS Length = 860 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 805 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 770 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 807 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 772 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 809 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 774 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 811 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 776 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 813 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 778 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 815 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 780 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 817 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 782 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 819 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 786 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 788 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 825 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 790 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 827 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 792 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 829 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 794 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 831 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 796 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 833 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 798 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 835 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 800 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 837 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 802 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 839 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 804 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 841 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 806 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 843 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 808 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 845 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 810 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 847 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 812 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 849 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 814 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 851 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 816 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 853 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 818 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 855 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 733 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 820 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 860 [122][TOP] >UniRef100_C1RP15 Cellobiohydrolase A (1,4-beta-cellobiosidase A) n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RP15_9CELL Length = 634 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/43 (55%), Positives = 33/43 (76%), Gaps = 2/43 (4%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTP--TASPGPSATPTATPNPGGI 124 TP+P+P+++P+ TPS +P PTP T SP PS TP+ T NPGG+ Sbjct: 490 TPSPTPSVTPSPTPSVTPSPTPSPTVSPTPSPTPSPTQNPGGV 532 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/57 (40%), Positives = 37/57 (64%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGY 172 TP+P+P+++P+ TPS +P PTP+ +P P+ +PT +P P +P + N GG Y Sbjct: 482 TPSPTPSVTPSPTPSVTPSPTPSVTPSPTPSPTVSPTPSPTPSPTQ-NPGGVCTVSY 537 [123][TOP] >UniRef100_C1RP14 Endoglucanase n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RP14_9CELL Length = 592 Score = 57.0 bits (136), Expect = 7e-07 Identities = 28/68 (41%), Positives = 40/68 (58%), Gaps = 11/68 (16%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP-----------GGILAPVKLNV 148 TPTP+P+++PT TPS +P PTP+A+P P+ATPT+ G+ V+L Sbjct: 453 TPTPTPSVTPTPTPSVTPTPTPSATPTPTATPTSAAGACTVTFSGNAWNSGMTGAVRLTN 512 Query: 149 GGPALSGY 172 G LSG+ Sbjct: 513 TGSTLSGW 520 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTP--TASPGPSATPTATPNPGGILAPVKLNVGGPALSGYV 175 TPTP+P+++PT TPS +P PTP T +P PSATPT T P + G A + + Sbjct: 445 TPTPTPSVTPTPTPSVTPTPTPSVTPTPTPSATPTPTATPTSAAGACTVTFSGNAWNSGM 504 Query: 176 PDGPYVTSTTYT 211 +T+T T Sbjct: 505 TGAVRLTNTGST 516 [124][TOP] >UniRef100_C1RHA1 Cellulose 1,4-beta-cellobiosidase n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RHA1_9CELL Length = 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TPSA+P PTP SP PS TPT TP+P Sbjct: 612 TPTPTPTPTPTPTPSATPSPTP--SPTPSVTPTPTPSP 647 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPS T SPT +P+ S PTPT SP PSATP+ TP+P Sbjct: 622 TPTPSATPSPTPSPTPSVTPTPTPSPTPSATPSPTPSP 659 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTP--TASPGPSATPTATPNP 115 TPTP+PT +P++TPS +P PTP T +P PS TP+ATP+P Sbjct: 616 TPTPTPTPTPSATPSPTPSPTPSVTPTPTPSPTPSATPSP 655 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT S T TP+ SP P+ T SP PS TP+ATP+P Sbjct: 630 SPTPSPTPSVTPTPTPSPTPSATPSPTPSPTPSATPSP 667 [125][TOP] >UniRef100_C0YC76 Rhs element Vgr protein n=5 Tax=Burkholderia pseudomallei RepID=C0YC76_BURPS Length = 844 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 718 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 755 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 720 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 757 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 722 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 759 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 724 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 761 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 726 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 763 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 728 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 765 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 730 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 767 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 732 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 805 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 770 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 807 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 772 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 809 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 774 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 811 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 776 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 813 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 778 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 815 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 780 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 817 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 782 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 819 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 786 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 788 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 825 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 790 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 827 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 792 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 829 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 794 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 831 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 796 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 833 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 798 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 835 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 800 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 837 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 802 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 839 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 717 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 753 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 804 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 844 [126][TOP] >UniRef100_C0VBQ5 Endo-1,4-beta-xylanase (Glycosyl hydrolase family 10) n=1 Tax=Xylanimonas cellulosilytica DSM 15894 RepID=C0VBQ5_9MICO Length = 465 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 329 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 366 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 331 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 368 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 333 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 370 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKL 142 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP G A + + Sbjct: 335 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSGPCTATMTI 381 [127][TOP] >UniRef100_B7CT47 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei 576 RepID=B7CT47_BURPS Length = 872 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 805 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 770 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 807 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 772 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 809 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 774 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 811 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 776 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 813 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 778 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 815 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 780 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 817 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 782 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 819 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 786 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 788 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 825 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 790 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 827 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 792 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 829 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 794 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 831 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 796 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 833 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 798 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 835 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 800 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 837 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 802 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 839 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 804 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 841 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 806 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 843 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 808 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 845 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 810 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 847 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 812 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 849 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 814 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 851 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 816 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 853 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 818 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 855 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 820 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 857 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 822 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 859 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 824 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 861 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 826 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 863 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 828 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 865 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 830 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 867 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 733 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 832 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 872 [128][TOP] >UniRef100_B1HC61 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei S13 RepID=B1HC61_BURPS Length = 878 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 805 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 770 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 807 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 772 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 809 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 774 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 811 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 776 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 813 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 778 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 815 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 780 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 817 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 782 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 819 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 786 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 788 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 825 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 790 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 827 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 792 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 829 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 794 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 831 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 796 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 833 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 798 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 835 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 800 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 837 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 802 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 839 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 804 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 841 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 806 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 843 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 808 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 845 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 810 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 847 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 812 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 849 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 814 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 851 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 816 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 853 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 818 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 855 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 820 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 857 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 822 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 859 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 824 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 861 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 826 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 863 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 828 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 865 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 830 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 867 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 832 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 869 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 834 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 871 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 836 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 873 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 733 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 838 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 878 [129][TOP] >UniRef100_A4LM22 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei 305 RepID=A4LM22_BURPS Length = 868 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 734 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 771 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 736 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 773 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 738 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 775 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 740 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 777 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 742 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 779 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 744 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 781 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 746 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 783 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 748 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 785 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 750 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 787 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 752 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 789 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 754 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 791 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 756 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 793 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 758 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 795 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 760 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 797 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 762 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 799 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 764 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 801 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 766 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 803 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 768 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 805 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 770 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 807 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 772 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 809 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 774 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 811 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 776 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 813 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 778 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 815 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 780 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 817 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 782 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 819 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 784 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 821 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 786 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 788 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 825 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 790 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 827 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 792 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 829 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 794 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 831 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 796 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 833 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 798 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 835 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 800 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 837 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 802 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 839 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 804 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 841 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 806 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 843 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 808 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 845 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 810 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 847 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 812 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 849 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 814 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 851 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 816 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 853 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 818 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 855 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 820 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 857 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 822 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 859 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 824 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 861 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 826 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 863 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 733 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 769 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP I Sbjct: 828 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI 868 [130][TOP] >UniRef100_A4S6G3 Predicted protein (Fragment) n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S6G3_OSTLU Length = 2146 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT +P+ SP P+PT +P PS TPT TP P Sbjct: 1868 SPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTP 1905 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATP 109 +PTPSPT SPT +P+ SP PTPT SP P+ TPT TP Sbjct: 1872 SPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTPTP 1907 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/69 (44%), Positives = 37/69 (53%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 +P+P PT SPT +P+ SP P+PT SP PS TPT TP+P P P S P Sbjct: 1860 SPSPPPTPSPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTPT---PPTESSPTPP 1916 Query: 182 GPYVTSTTY 208 P S TY Sbjct: 1917 AP--DSATY 1923 [131][TOP] >UniRef100_Q54VD6 Dynactin 150 kDa subunit n=1 Tax=Dictyostelium discoideum RepID=Q54VD6_DICDI Length = 1539 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TP TPNP Sbjct: 273 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIITPNP 310 [132][TOP] >UniRef100_A2HGA4 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2HGA4_TRIVA Length = 394 Score = 57.0 bits (136), Expect = 7e-07 Identities = 29/73 (39%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSAT--PTATPNPGGILAPVKLNVGGPALSGYV 175 TPTP+PT +PT P+ +P PTPT +P P+ T PT P P +AP P + V Sbjct: 239 TPTPTPTPTPTVAPTPTPTPTPTVAPTPTPTPEPTVAPTPTPTVAPTPEPTVAPTPTPTV 298 Query: 176 PDGPYVTSTTYTG 214 P +T T + G Sbjct: 299 APTPTLTPTAHAG 311 [133][TOP] >UniRef100_Q605T2 Putative uncharacterized protein n=1 Tax=Methylococcus capsulatus RepID=Q605T2_METCA Length = 416 Score = 56.6 bits (135), Expect = 9e-07 Identities = 28/67 (41%), Positives = 35/67 (52%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ + P PTA+P P+ATP T P P + P S Sbjct: 118 TPTPTPTPAPTVTPAPTATPAPTATPAPTATPAPTATPAPTATPAPTSSPAPTPSPAPTA 177 Query: 182 GPYVTST 202 P TST Sbjct: 178 SPAPTST 184 [134][TOP] >UniRef100_Q21PD3 Cellulose-binding protein n=1 Tax=Saccharophagus degradans 2-40 RepID=Q21PD3_SACD2 Length = 933 Score = 56.6 bits (135), Expect = 9e-07 Identities = 47/145 (32%), Positives = 76/145 (52%), Gaps = 5/145 (3%) Frame = +2 Query: 68 TASPGPSATPTATPNPGGILAPVKLNVGGPALS----GYVPDGPYVTSTTYTGTIVKPVA 235 ++S G S++ +++ + GG + +N GG A S +V D + +T G+ +A Sbjct: 340 SSSSGSSSSSSSSSSSGGNELVIAINAGGGATSLDGVNFVADVHSLGGST--GSTTDSIA 397 Query: 236 GTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYTSAIGKRVFDIAI-GDAAAA 412 G ++ LY T R+G + +YA+P+ TY++ L FAE+Y +T A G R F++A+ G A Sbjct: 398 GATSSTLYQTERYG-SYSYAVPVTNATYSLKLHFAEIY-HTEA-GARSFNLAVEGQQEMA 454 Query: 413 PVLLHDYDLFADAGEATAVAKVFDV 487 V L Y L G T F V Sbjct: 455 SVDL--YSLSGHDGAYTYEVNDFPV 477 [135][TOP] >UniRef100_Q5SFC4 Putative uncharacterized protein ORF16 n=1 Tax=Streptomyces bikiniensis RepID=Q5SFC4_STRBI Length = 1066 Score = 56.6 bits (135), Expect = 9e-07 Identities = 29/71 (40%), Positives = 38/71 (53%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT P P A + + GYV Sbjct: 811 TPTPTPTPTPTPTPTPTPTPTPTRTPTPTPTPTRPPQPPAPKAGPGVRITVQPEPGYVGG 870 Query: 182 GPYVTSTTYTG 214 VT + G Sbjct: 871 RVVVTYSVRNG 881 [136][TOP] >UniRef100_C6Y1M3 Beta-galactosidase n=1 Tax=Pedobacter heparinus DSM 2366 RepID=C6Y1M3_PEDHD Length = 1171 Score = 56.6 bits (135), Expect = 9e-07 Identities = 36/101 (35%), Positives = 53/101 (52%), Gaps = 5/101 (4%) Frame = +2 Query: 227 PVAGTSNDALYHTFRFGKT-VAYALPLPTGTYTVSLLFAEVYTYT----SAIGKRVFDIA 391 PV GT++ L+ +FR+G+ ++Y P+P G Y V L F E + T A G R+FD+A Sbjct: 779 PVKGTADWPLFQSFRYGRDQLSYHFPVPDGEYLVELYFIEPWLGTGGGMDAKGMRLFDVA 838 Query: 392 IGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 I LL D D++A AG A+ K V L++ Sbjct: 839 IN----GNTLLKDVDIWAAAGHDAALKKTVKARVKGGTLLL 875 [137][TOP] >UniRef100_C1RLV1 Beta-1,4-xylanase n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RLV1_9CELL Length = 690 Score = 56.6 bits (135), Expect = 9e-07 Identities = 31/71 (43%), Positives = 39/71 (54%), Gaps = 14/71 (19%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPG--------------GILAPVK 139 TPT +PT +PT T + +P PTPT SP PS TP+ T NPG G A V+ Sbjct: 548 TPTVTPTPTPTPTVTPTPTPTPTVSPTPSPTPSPTQNPGGACTVSYTANAWNTGFTASVR 607 Query: 140 LNVGGPALSGY 172 + G ALSG+ Sbjct: 608 VTNKGAALSGW 618 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/57 (43%), Positives = 35/57 (61%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGY 172 T TP+PT++PT T + +P PTPT +P P+ TPT +P P +P + N GG Y Sbjct: 538 TVTPTPTVTPTPTVTPTPTPTPTVTPTPTPTPTVSPTPSPTPSPTQ-NPGGACTVSY 593 [138][TOP] >UniRef100_B4B950 Filamentous haemagglutinin family outer membrane protein n=1 Tax=Cyanothece sp. PCC 7822 RepID=B4B950_9CHRO Length = 1786 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT P+ +PEPTPT P P+ TPT TP P Sbjct: 1111 TPTPTPTPTPTPEPTPTPEPTPTPEPTPTPTPTPTPTP 1148 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/44 (54%), Positives = 28/44 (63%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT PT TP +P P PT +P P+ TPT TP P L P Sbjct: 1115 TPTPTPTPEPTPTPEPTPTPEPTPTPTPTPTPTPTPTPEPKLTP 1158 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP +P P PT +P P+ TPT TP P Sbjct: 1109 TPTPTPTPTPTPTPEPTPTPEPTPTPEPTPTPTPTPTP 1146 [139][TOP] >UniRef100_A9V278 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V278_MONBE Length = 1916 Score = 56.6 bits (135), Expect = 9e-07 Identities = 48/155 (30%), Positives = 73/155 (47%), Gaps = 15/155 (9%) Frame = +2 Query: 95 PTATPNP-----GGILAPVKLNVGG-----PALSGYVPDGPYVTSTTYTGTIVKPVAGTS 244 P + P P G ++ V+LN GG PA + + DG + + +A T Sbjct: 1578 PGSLPRPSLSAYGAVI--VRLNCGGSRYIDPAGNTWQSDGLFNGGLEAVSPS-QAIARTV 1634 Query: 245 NDALYHTFRFGK----TVAYALPLPT-GTYTVSLLFAEVYTYTSAIGKRVFDIAIGDAAA 409 ND LY T R+ + Y +P+PT G Y V L FAE Y + +G RVFD+ + +A A Sbjct: 1635 NDELYWTERWRSGQDGPLVYEIPVPTAGLYHVRLHFAETYAPHTNMGDRVFDVLLENAIA 1694 Query: 410 APVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 L D+D+ + +A+ + F V V L + Sbjct: 1695 ----LDDFDMLVETTTTSAILRSFSVVVLDGALTL 1725 Score = 54.3 bits (129), Expect = 5e-06 Identities = 49/149 (32%), Positives = 68/149 (45%), Gaps = 12/149 (8%) Frame = +2 Query: 98 TATPNPGGILAPV--KLNVGGPALSGYVPDGPYVTSTTYTGT------IVKPVAGTSNDA 253 ++T PG PV ++N GG A DG + Y I VAG +N Sbjct: 1754 SSTAGPGASAGPVIHRINCGGSAFVH--TDGNLWGADNYFSNSGGFYQISTAVAGHTN-T 1810 Query: 254 LYHTFRFGK----TVAYALPLPTGTYTVSLLFAEVYTYTSAIGKRVFDIAIGDAAAAPVL 421 +Y + R+G T+ Y LPLP G Y V L FAE+ + +A+G+RVF + + VL Sbjct: 1811 MYQSERYGAVGGATLKYDLPLPAGEYIVRLHFAEI--FATAVGERVFGVKV----QGTVL 1864 Query: 422 LHDYDLFADAGEATAVAKVFDVTVTSAPL 508 + DL A AG + VTS L Sbjct: 1865 MEALDLVAVAGPLVPFVLEHRLNVTSTSL 1893 [140][TOP] >UniRef100_A2GQZ2 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2GQZ2_TRIVA Length = 340 Score = 56.6 bits (135), Expect = 9e-07 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPG-GILAPVK 139 TP+P+P+ SP+ TPS SP P+P+ SP PS TP+ +P+P I APV+ Sbjct: 79 TPSPTPSPSPSPTPSPSPSPSPSPSPSPSPTPSPSPSPSPSIAAPVR 125 [141][TOP] >UniRef100_Q605T0 Putative uncharacterized protein n=1 Tax=Methylococcus capsulatus RepID=Q605T0_METCA Length = 429 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 4/48 (8%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPT----PTASPGPSATPTATPNPGGILAP 133 TPTP+PT +PT PSA+P PT PTA+P P+ TP TP P AP Sbjct: 151 TPTPAPTATPTPAPSATPAPTTTPAPTATPAPTGTPAPTPKPSPTPAP 198 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/45 (55%), Positives = 32/45 (71%), Gaps = 2/45 (4%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSAT--PTATPNPGGILAP 133 PTP+PT +PT P+A+P P P+A+P P+ T PTATP P G AP Sbjct: 144 PTPAPTATPTPAPTATPTPAPSATPAPTTTPAPTATPAPTGTPAP 188 [142][TOP] >UniRef100_Q1J335 Glycosyl hydrolase family 98, putative carbohydrate binding module n=1 Tax=Deinococcus geothermalis DSM 11300 RepID=Q1J335_DEIGD Length = 970 Score = 56.2 bits (134), Expect = 1e-06 Identities = 48/163 (29%), Positives = 74/163 (45%), Gaps = 34/163 (20%) Frame = +2 Query: 128 APVKLNVGGPALSGYVPDGPYVTSTTYTGT-----------------IVKP-------VA 235 AP+ +NVGGPA + PDG T+ Y+ T I +P + Sbjct: 798 APILINVGGPAFTD--PDGNVWTADKYSYTDQNGAQRTYTYYTPSNAISQPSSPTSVDIL 855 Query: 236 GTSNDALYHTFRFG--------KTVAYALPLPTGTYTVSLLFAEVYTYTSAIGKRVFDIA 391 T+ND LY T+R + + + +P+ GTY V L FAE+ Y + GKR+FD++ Sbjct: 856 NTTNDVLYRTYRHNTLDTPLDSRVMIFDIPVNNGTYQVKLHFAEL--YWNEPGKRLFDVS 913 Query: 392 IGDAAAAPVLLHDYDLFADAG--EATAVAKVFDVTVTSAPLII 514 + L ++D++A AG V + +V V L I Sbjct: 914 VEGVPK----LTNFDIWAQAGGKNTALVVPINNVQVADGRLTI 952 [143][TOP] >UniRef100_A7HDP1 SpoIID/LytB domain n=1 Tax=Anaeromyxobacter sp. Fw109-5 RepID=A7HDP1_ANADF Length = 675 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/86 (38%), Positives = 43/86 (50%), Gaps = 3/86 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASP--GPSATPTATPNPGGILAPVKLNVGGP-ALSGY 172 TPT +PT +PT+TP+A+P TPTA+P P+ATPTATP P P A + Sbjct: 37 TPTATPTATPTATPTATPTATPTATPTATPTATPTATPTATPTATPTATATATPTATTTA 96 Query: 173 VPDGPYVTSTTYTGTIVKPVAGTSND 250 +TT T T T+ D Sbjct: 97 TTTATTTATTTATATATTTATPTATD 122 [144][TOP] >UniRef100_A5CQA6 Putative uncharacterized protein n=1 Tax=Clavibacter michiganensis subsp. michiganensis NCPPB 382 RepID=A5CQA6_CLAM3 Length = 1152 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/106 (33%), Positives = 47/106 (44%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT++PT P +P PTPT +P + TPT TP P +AP P P Sbjct: 302 TPTPTPTVAPTQAP--TPTPTPTVAPTQAPTPTPTPTPTPTVAPTTAPTPAPTTPAAAP- 358 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTY 319 +T +AGT+ + R G P PT +Y Sbjct: 359 --------FTAAATPTIAGTARVGFTLSARAGVWT----PWPTFSY 392 [145][TOP] >UniRef100_A0LUX0 Chitinase. Glycosyl Hydrolase family 18 n=1 Tax=Acidothermus cellulolyticus 11B RepID=A0LUX0_ACIC1 Length = 460 Score = 56.2 bits (134), Expect = 1e-06 Identities = 45/127 (35%), Positives = 67/127 (52%), Gaps = 4/127 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPA--LSGYV 175 +P+PSP+ SP+ +PS SP P+P+ASP PSA+P+ +P+ A + +N G +SG+ Sbjct: 289 SPSPSPSPSPSPSPSPSPSPSPSASPSPSASPSPSPS-ASPSAGLAVNGGFETGDVSGWS 347 Query: 176 PDGP--YVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVY 349 P V S ++G +AG + T + +TV+ A P TYTVS Y Sbjct: 348 CQAPDAVVGSPVHSGRYA--LAGVPTGST--TGQCTQTVSVA---PNTTYTVSAWVNGSY 400 Query: 350 TYTSAIG 370 Y A G Sbjct: 401 VYLGANG 407 [146][TOP] >UniRef100_O52374 Family 10 xylanase n=1 Tax=Caldicellulosiruptor sp. Rt69B.1 RepID=O52374_9FIRM Length = 1779 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/75 (41%), Positives = 40/75 (53%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +P T + +P PT TA+P P+ TPTATP P P P + V Sbjct: 1045 TPTPTPTTTPAPTSAPTPSPTVTATPTPTPTPTATPTP----TPTTTPTPTPTPTVTVTP 1100 Query: 182 GPYVTSTTYTGTIVK 226 P T T TG+ +K Sbjct: 1101 TPTPTGTPGTGSGLK 1115 Score = 55.1 bits (131), Expect = 3e-06 Identities = 31/74 (41%), Positives = 37/74 (50%), Gaps = 2/74 (2%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPT--PTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYV 175 TP P+PT +PT TP+ +P PT PT SP +ATPT TP P P P + V Sbjct: 1037 TPAPTPTSTPTPTPTTTPAPTSAPTPSPTVTATPTPTPTPTATPTPTPTTTPTPTPTPTV 1096 Query: 176 PDGPYVTSTTYTGT 217 P T T GT Sbjct: 1097 TVTPTPTPTGTPGT 1110 [147][TOP] >UniRef100_C4EJ71 Subtilisin-like serine protease n=1 Tax=Streptosporangium roseum DSM 43021 RepID=C4EJ71_STRRS Length = 1170 Score = 56.2 bits (134), Expect = 1e-06 Identities = 41/107 (38%), Positives = 51/107 (47%) Frame = +2 Query: 188 YVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYTSAI 367 YV S T T T K + GT+ L+ R +P GTYTV L FAE T Sbjct: 1043 YVGSGTRTHTSSKAIKGTTEQELFKRARESMLEYRFDQVPNGTYTVELDFAE--TRAMRE 1100 Query: 368 GKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPL 508 G+RVFD+ + A P L DL +AG TAV + + V VT L Sbjct: 1101 GRRVFDVLVEGQLAIPAL----DLALEAGTYTAVTRQYTVKVTDGQL 1143 [148][TOP] >UniRef100_C1WSZ4 Chitinase n=1 Tax=Kribbella flavida DSM 17836 RepID=C1WSZ4_9ACTO Length = 582 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATP 109 TPTP+PT +PT TP+ +P PTPT +P P+ TPTATP Sbjct: 498 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTATP 533 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP+PT +PT TP+ +P PTPT +P P+ TPT TP P Sbjct: 493 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 529 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATP 109 TPTP+PT +PT TP+ +P PTPT +P P+ TPT TP Sbjct: 494 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 529 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +P PTPT +P P+ TPT T P Sbjct: 496 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTATP 533 [149][TOP] >UniRef100_C0UYC8 Putative uncharacterized protein n=1 Tax=Thermobaculum terrenum ATCC BAA-798 RepID=C0UYC8_9BACT Length = 858 Score = 56.2 bits (134), Expect = 1e-06 Identities = 41/119 (34%), Positives = 59/119 (49%), Gaps = 4/119 (3%) Frame = +2 Query: 170 YVPDGPYVTSTTYTGTIVK----PVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLF 337 Y P +ST+ G I K + GT +D +Y R+G Y +P+P G Y V L F Sbjct: 591 YAFSAPGNSSTSMAGKITKGTTSDIKGTRDDEIYQQGRYGD-FDYHIPVPNGEYKVVLKF 649 Query: 338 AEVYTYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 AE T+ S G+R+FD+ + +LH +D+ AG TAV + F+ V L I Sbjct: 650 AE--TFHSEPGQRLFDVYL----EGERVLHRFDIAQVAGPLTAVDRSFETEVKDKSLDI 702 [150][TOP] >UniRef100_A4CK29 Ring canal kelch-like protein n=1 Tax=Robiginitalea biformata HTCC2501 RepID=A4CK29_9FLAO Length = 3144 Score = 56.2 bits (134), Expect = 1e-06 Identities = 56/167 (33%), Positives = 76/167 (45%), Gaps = 2/167 (1%) Frame = +2 Query: 20 TLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS-GYVPDGPYVT 196 T S + P E A+ AT T TP+P +N G ++ G VP T Sbjct: 1258 TASNDADPKTWDEDQAVANANAGAT-TGTPSP-------YVNSGAEDVTYGVVPLPAGFT 1309 Query: 197 STT-YTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYTSAIGK 373 +TT Y I + Y+T + + P+P G YTV+LLFAE++T G Sbjct: 1310 NTTGYPDAIFQTER-------YNTLAVPDNMQWDFPVPNGDYTVNLLFAEIWTGAQDPGI 1362 Query: 374 RVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 RVFD+ I PVL ++D A G ATA + F VTV+ L I Sbjct: 1363 RVFDVQI---EGNPVLT-NFDQTAAYGWATAGVESFPVTVSDGNLDI 1405 [151][TOP] >UniRef100_A4AUK4 Putative uncharacterized protein n=1 Tax=Flavobacteriales bacterium HTCC2170 RepID=A4AUK4_9FLAO Length = 1506 Score = 56.2 bits (134), Expect = 1e-06 Identities = 44/130 (33%), Positives = 65/130 (50%), Gaps = 10/130 (7%) Frame = +2 Query: 134 VKLNVGGPAL----SGYVPDGPYVTSTTYT-GTIVKPVAGTSNDALYHTFRFGKTVAYAL 298 +++N GGP + + + D YV +Y G P S HT T Y + Sbjct: 905 IRINSGGPQVVHDGNIFNADQHYVGGQSYVNGNAQVPELFQSE----HTSS-SLTFDYQI 959 Query: 299 PLPTGTYTVSLLFAEVYTYTS-----AIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEAT 463 P+ G YTV L FAE+Y + A G RVFD+++ + ++L DYD++ D G T Sbjct: 960 PVQNGDYTVILHFAEIYWGATGGGSGATGIRVFDVSLEGS----LVLDDYDIYDDVGAET 1015 Query: 464 AVAKVFDVTV 493 V+K FD+TV Sbjct: 1016 EVSKSFDITV 1025 [152][TOP] >UniRef100_A0ZKX5 Putative uncharacterized protein n=1 Tax=Nodularia spumigena CCY9414 RepID=A0ZKX5_NODSP Length = 618 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP +L+PT TP ASP PTP SP P A+PT TP P Sbjct: 432 TPTPEASLTPTPTPEASPTPTPEISPTPEASPTPTPTP 469 [153][TOP] >UniRef100_C8S976 Putative uncharacterized protein n=1 Tax=Ferroglobus placidus DSM 10642 RepID=C8S976_FERPL Length = 376 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/83 (42%), Positives = 42/83 (50%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTPS T +PT TPS +P P PT +P P+ TPT TP P AP P + P Sbjct: 150 TPTPSTTPTPTPTPSPTPTPAPTPTPTPTPTPTPTPTP----AP----DNPPTVKITSPH 201 Query: 182 GPYVTSTTYTGTIVKPVAGTSND 250 YV T +K VA S+D Sbjct: 202 DGYVCITHSNACRMKIVADASDD 224 [154][TOP] >UniRef100_UPI00018742AE autotransporter n=1 Tax=Pseudomonas syringae pv. tomato T1 RepID=UPI00018742AE Length = 1016 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+P +PT TP+ +P PTPT P P+ TPT TP P AP Sbjct: 592 TPTPTPEPTPTPTPTPTPTPTPTPEPVPTPTPTPTPEPAPTPAP 635 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT PT TP+ +P PTPT +P P TPT TP P Sbjct: 590 TPTPTPTPEPTPTPTPTPTPTPTPTPEPVPTPTPTPTP 627 [155][TOP] >UniRef100_Q91GH4 Putative uncharacterized protein n=1 Tax=Epiphyas postvittana NPV RepID=Q91GH4_NPVEP Length = 234 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/55 (49%), Positives = 31/55 (56%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS 166 TP+PSPT SPT PS +P PTP SP PS TP+ TP P +P P S Sbjct: 51 TPSPSPTPSPTPPPSPTPSPTPPPSPTPSPTPSPTPPPSPTPSPTPSPTPSPTPS 105 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/54 (44%), Positives = 34/54 (62%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPAL 163 +PTP P+ +P+ TPS +P P+PT SP PS TP+ TP+P + +P P L Sbjct: 69 SPTPPPSPTPSPTPSPTPPPSPTPSPTPSPTPSPTPSPSPLPSPTPSPTPSPTL 122 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/55 (47%), Positives = 33/55 (60%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS 166 +PTPSPT P+ TPS +P PTP SP PS TP+ TP+P +P+ P S Sbjct: 65 SPTPSPTPPPSPTPSPTPSPTPPPSPTPSPTPSPTPSPTPSPSPLPSPTPSPTPS 119 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/53 (45%), Positives = 31/53 (58%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPA 160 +PTPSPT P+ TPS +P P+PT SP PS TP +P P +P P+ Sbjct: 55 SPTPSPTPPPSPTPSPTPPPSPTPSPTPSPTPPPSPTPSPTPSPTPSPTPSPS 107 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/54 (44%), Positives = 31/54 (57%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPAL 163 TP+P+P SPT +P+ SP P+PT SP P +PT +P P L P P L Sbjct: 81 TPSPTPPPSPTPSPTPSPTPSPTPSPSPLPSPTPSPTPSPTLWPTPSPTPSPTL 134 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/44 (52%), Positives = 29/44 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 +PTPSPT SPT +PS P PTP+ +P P+ PT +P P L P Sbjct: 93 SPTPSPTPSPTPSPSPLPSPTPSPTPSPTLWPTPSPTPSPTLWP 136 [156][TOP] >UniRef100_Q6VTQ5 Putative uncharacterized protein n=1 Tax=Choristoneura fumiferana DEF MNPV RepID=Q6VTQ5_NPVCD Length = 218 Score = 55.8 bits (133), Expect = 2e-06 Identities = 32/85 (37%), Positives = 42/85 (49%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 PTP PT SPT +P+ SP P+PT SP P TP+ TP P P +G P Y P Sbjct: 84 PTPLPTPSPTPSPTPSPTPSPTPSPTPPPTPSPTPTPSPTPPPSPEPLGEPM---YFP-- 138 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALY 259 +T+ V+P+ +S Y Sbjct: 139 AEITTVEQLQDFVRPLCRSSGRTTY 163 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT P+ P P+PT SP PS TP+ TP+P Sbjct: 72 PTPSPTPSPTPPPTPLPTPSPTPSPTPSPTPSPTPSP 108 [157][TOP] >UniRef100_Q8YV91 Alr2090 protein n=1 Tax=Nostoc sp. PCC 7120 RepID=Q8YV91_ANASP Length = 602 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKL 142 TP P+PT +PT TP+ +P PTPT +P P+ TPT TP P I P+ + Sbjct: 319 TPIPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPIPTPIPTPIPI 365 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 TPTP+P +PT TP+ +P PTPT +P P+ PT TP P I P+ Sbjct: 315 TPTPTPIPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPIPTPI 359 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/52 (48%), Positives = 31/52 (59%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP 157 TPTP PT +PT TP+ +P PTPT +P P TPT TP P P + + P Sbjct: 317 TPTPIPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPIPTPIPTPIPIPTP 368 Score = 54.7 bits (130), Expect = 4e-06 Identities = 29/77 (37%), Positives = 37/77 (48%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+P +PT TP +P PTPT +P P+ TPT TP P P + P + Sbjct: 307 TPTPTPIPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPIPTPIPTPIPIP 366 Query: 182 GPYVTSTTYTGTIVKPV 232 P T T I P+ Sbjct: 367 TPIPTPTPIPTPIPTPI 383 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 PTP+PT PT TP+ P PTPT +P P+ TPT TP P I P Sbjct: 306 PTPTPTPIPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPIPTP 348 [158][TOP] >UniRef100_Q888X2 Autotransporter, putative n=1 Tax=Pseudomonas syringae pv. tomato RepID=Q888X2_PSESM Length = 1016 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/53 (49%), Positives = 30/53 (56%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPA 160 TPTP+PT +PT TP +P PTPT +P P PT TP P AP PA Sbjct: 588 TPTPTPTPTPTPTPEPTPTPTPTPTPTPEPVPTPTPTPTPEPAPTPAPEPAPA 640 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ +PEPTPT +P P+ TP P P Sbjct: 584 TPTPTPTPTPTPTPTPTPEPTPTPTPTPTPTPEPVPTP 621 [159][TOP] >UniRef100_C5BSD3 Putative lipoprotein n=1 Tax=Teredinibacter turnerae T7901 RepID=C5BSD3_TERTT Length = 709 Score = 55.8 bits (133), Expect = 2e-06 Identities = 39/94 (41%), Positives = 49/94 (52%), Gaps = 10/94 (10%) Frame = +2 Query: 2 TPTPSPTLSPTSTPS------ASPEPT----PTASPGPSATPTATPNPGGILAPVKLNVG 151 TPTP+PTLSPT TPS ASPEP+ P+ASP PSA+P TP+P +P Sbjct: 70 TPTPTPTLSPTPTPSVTPTTAASPEPSASPEPSASPEPSASPGPTPSPEPSASPGPTPSP 129 Query: 152 GPALSGYVPDGPYVTSTTYTGTIVKPVAGTSNDA 253 P S P TT ++ P+ G S+ A Sbjct: 130 EPTPSAEPTVAPLQPDTTADPSL--PLPGDSDYA 161 [160][TOP] >UniRef100_B9MKU7 Glycoside hydrolase family 48 n=1 Tax=Anaerocellum thermophilum DSM 6725 RepID=B9MKU7_ANATD Length = 1759 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+ T +PT TP+ +P PTPT +P P+ATPT TP P P Sbjct: 1071 TPTPTATPAPTVTPTPTPAPTPTPTPTPTATPTPTPTPTPTATP 1114 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT + T TP+ +P TPT +P P+ATPTATP P Sbjct: 669 TPTPTPTSTATPTPTPTPTVTPTPTPTPTATPTATPTP 706 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+A+P PTPT +P + T TATP P Sbjct: 1085 TPTPAPTPTPTPTPTATPTPTPTPTPTATPTVTATPTP 1122 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN 112 PTP+PT +PT+TP+ +P PTPTA+P +ATPT TP+ Sbjct: 1090 PTPTPTPTPTATPTPTPTPTPTATPTVTATPTPTPS 1125 [161][TOP] >UniRef100_A4XIF5 Glycoside hydrolase, family 48 n=1 Tax=Caldicellulosiruptor saccharolyticus DSM 8903 RepID=A4XIF5_CALS8 Length = 1751 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/58 (46%), Positives = 36/58 (62%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYV 175 TPTP+ T +PT TP+ +P PT TA+P P+ TPT+TP + P V PA SG + Sbjct: 663 TPTPTATPTPTPTPTVTPTPTVTATPTPTPTPTSTPT----VTPTPTPVSTPATSGQI 716 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+ T +PT TP+ +P PTPTA+P P+ TPT TP P Sbjct: 1071 TPAPTVTPTPTVTPTPTPAPTPTATPTPTPTPTVTPTP 1108 [162][TOP] >UniRef100_A0LVL3 Glycoside hydrolase, family 9 n=1 Tax=Acidothermus cellulolyticus 11B RepID=A0LVL3_ACIC1 Length = 1137 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/76 (34%), Positives = 44/76 (57%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 +P+PSP+ SP+ +PS+SP P+P+ SP PS +P+++P+P +P P+ S Sbjct: 666 SPSPSPSASPSPSPSSSPSPSPSPSPRPSPSPSSSPSPSPSPSPSPSRSPSPSASPSPSS 725 Query: 182 GPYVTSTTYTGTIVKP 229 P +S+ + I P Sbjct: 726 SPSPSSSPSSSPIPSP 741 [163][TOP] >UniRef100_A0LUX2 Chitinase. Glycosyl Hydrolase family 18 n=1 Tax=Acidothermus cellulolyticus 11B RepID=A0LUX2_ACIC1 Length = 763 Score = 55.8 bits (133), Expect = 2e-06 Identities = 43/125 (34%), Positives = 65/125 (52%), Gaps = 2/125 (1%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 +P+PSP+ SP+ +PS SP P+P+ SP PS +P+A+P+ G++ G +SG+ Sbjct: 596 SPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSASPS-AGLVVNGGFETGD--VSGWSCQ 652 Query: 182 GP--YVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTY 355 P V S ++G +AG + T + +TV+ A P TYTVS Y Y Sbjct: 653 APDAVVGSPVHSGRYA--LAGVPTGST--TGQCTQTVSVA---PNTTYTVSAWVNGSYVY 705 Query: 356 TSAIG 370 A G Sbjct: 706 LGANG 710 [164][TOP] >UniRef100_Q9L8L8 Beta-1,4-xylanase XynA n=1 Tax=Caldibacillus cellulovorans RepID=Q9L8L8_9BACL Length = 921 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/44 (52%), Positives = 31/44 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT +PT T + +P PTPT++P P+ TPT+TP P P Sbjct: 718 TPTPTPTPTPTPTSTPTPTPTPTSTPTPTPTPTSTPTPTATPTP 761 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/42 (57%), Positives = 31/42 (73%), Gaps = 4/42 (9%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSAS----PEPTPTASPGPSATPTATPNP 115 TPTP+PT +PT TP+ + P PTPT++P P+ATPT TP P Sbjct: 724 TPTPTPTSTPTPTPTPTSTPTPTPTPTSTPTPTATPTPTPTP 765 Score = 53.5 bits (127), Expect = 8e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGIL 127 TPTP+PT +PT TP+ + PTPTA+P P TPT TP+ GG L Sbjct: 734 TPTPTPTSTPTPTPTPTSTPTPTATPTP--TPTPTPSAGGNL 773 [165][TOP] >UniRef100_Q0WYG9 Alpha-1,3-glucanase n=1 Tax=Bacillus circulans RepID=Q0WYG9_BACCI Length = 1293 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+ T +PT TP+ +P PTPT +P P+ TPTATP P Sbjct: 318 TPTPTSTPTPTPTPTPTPTPTPTPTPTPTPTPTATPTP 355 Score = 55.5 bits (132), Expect = 2e-06 Identities = 36/105 (34%), Positives = 50/105 (47%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P PTPT +P P+ TPT T P P + Sbjct: 316 TPTPTPTSTPTPTPTPTPTPTPTPTPTPTPTPTPTATP------------TPPPGSNIAV 363 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGT 316 G +T+++ T T VA +ND T+ G L L G+ Sbjct: 364 GKPITASSSTFTF---VAANANDNSTDTYWEGGGNPSTLTLDLGS 405 [166][TOP] >UniRef100_C1RQ70 Putative cellulose binding protein n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RQ70_9CELL Length = 439 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTP+P + PT +P+ SP P+PT SP PSATP+ TP+P Sbjct: 154 SPTPTPVVDPTPSPTPSPTPSPTPSPTPSATPSPTPSP 191 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 5/90 (5%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TP+P+P+ +P+ TPS +P PTP+ +P P+ +PT P+PGG G A +G P Sbjct: 176 TPSPTPSATPSPTPSPTPSPTPSPTPSPTPSPTPRPDPGGCSG--AFCDGFEAQTGTSPA 233 Query: 182 GPYVT-----STTYTGTIVKPVAGTSNDAL 256 P+ S T T +I VA + + +L Sbjct: 234 APWSVVHPDCSGTGTASIDSSVARSGSRSL 263 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT +P+ S P+PT SP PS TP+ TP+P Sbjct: 166 SPTPSPTPSPTPSPTPSATPSPTPSPTPSPTPSPTPSP 203 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT + + SP P+PT SP PS TP+ TP+P Sbjct: 170 SPTPSPTPSPTPSATPSPTPSPTPSPTPSPTPSPTPSP 207 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT +P+ SP P+ T SP PS TP+ TP+P Sbjct: 163 PTPSPTPSPTPSPTPSPTPSATPSPTPSPTPSPTPSP 199 [167][TOP] >UniRef100_C1RNB1 Uncharacterized conserved protein n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RNB1_9CELL Length = 400 Score = 55.8 bits (133), Expect = 2e-06 Identities = 50/176 (28%), Positives = 76/176 (43%), Gaps = 5/176 (2%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TP+P+P+++PT TP+ SP P+ T SP PS TPT TP P +P P L+ Sbjct: 235 TPSPTPSVTPTRTPTPSPTPSVTPSPTPSVTPTPTPTPTPTPSPT------PTLT----V 284 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAE----VY 349 P T T+ G V + ++ A F+ TV A P + VS F Sbjct: 285 TPTPTPTSVPGDSVCELEVDTSSAWPGGFQGTVTVFNATMEPVNGWQVSWKFTNGETIAQ 344 Query: 350 TYTSAIGKRVFDIAIGDAAAAPVLLHDYDL-FADAGEATAVAKVFDVTVTSAPLII 514 +++ + + + +A + H + F G T A V D T+ P I+ Sbjct: 345 SWSGVTSQSGSTVTVKNADWNSTIAHHNAVNFGFIGSGTPKA-VTDATLNGKPCIV 399 [168][TOP] >UniRef100_C0V8X6 Polysaccharide deacetylase n=1 Tax=Xylanimonas cellulosilytica DSM 15894 RepID=C0V8X6_9MICO Length = 1053 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGIL 127 +PTP+PT +PT TP+ +P PTPT +P P+ TPT TP+ GG+L Sbjct: 812 SPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPD-GGVL 852 [169][TOP] >UniRef100_B4V800 Secreted protein n=1 Tax=Streptomyces sp. Mg1 RepID=B4V800_9ACTO Length = 333 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/76 (38%), Positives = 38/76 (50%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TP+P+PT +P++ P+ SP PTPT P P+ TPT TP P P P+ + Sbjct: 215 TPSPTPTPTPSTKPTPSPTPTPTPKPKPTPTPTPTPTPTPTPTPTPSTTPTPSPTPTPST 274 Query: 182 GPYVTSTTYTGTIVKP 229 P T T T KP Sbjct: 275 KPTPTPTPATTPSPKP 290 Score = 55.5 bits (132), Expect = 2e-06 Identities = 39/109 (35%), Positives = 43/109 (39%), Gaps = 4/109 (3%) Frame = +2 Query: 2 TPTPS--PTLSPTSTPSASPEPTPTASPGPSATPTAT--PNPGGILAPVKLNVGGPALSG 169 TPTPS PT SPT TPS +P PTP+ P PS TPT T P P P P + Sbjct: 201 TPTPSTKPTPSPTPTPSPTPTPTPSTKPTPSPTPTPTPKPKPTPTPTPTPTPTPTPTPTP 260 Query: 170 YVPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGT 316 P T T T P T+ K P PT T Sbjct: 261 STTPTPSPTPTPSTKPTPTPTPATTPSPKPSPTASAKPTPSTTPSPTST 309 [170][TOP] >UniRef100_B1Q2N9 Putative glycosidase n=1 Tax=Paenibacillus sp. KSM-M126 RepID=B1Q2N9_9BACL Length = 1304 Score = 55.8 bits (133), Expect = 2e-06 Identities = 44/144 (30%), Positives = 65/144 (45%), Gaps = 18/144 (12%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP- 178 T TP+PT++PT TP+ +P PTPT +P P+ T T TP G L K ++ +VP Sbjct: 336 TVTPTPTVTPTPTPTVTPTPTPTVTPTPTPTVTPTPGAGSNLGLNKSINASSSVFTFVPT 395 Query: 179 ---DGPYVT-----STTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPT-------- 310 DG T +Y T+ + G++ D + + A++ T Sbjct: 396 NANDGDVTTYWEGAGGSYPNTLSVNL-GSNADITSIVLKLNPSSAWSTRTQTIQVLGHNQ 454 Query: 311 -GTYTVSLLFAEVYTYTSAIGKRV 379 T SL+ A VYT+ A G V Sbjct: 455 NTTAFTSLVPATVYTFNPATGNTV 478 [171][TOP] >UniRef100_A8I1E4 Hydroxyproline-rich cell wall protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8I1E4_CHLRE Length = 398 Score = 55.8 bits (133), Expect = 2e-06 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 5/81 (6%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPS----ATPTATPNPGGILAPVKLNVGGPALSG 169 +P+PSPT SP ++PS SP P+P ASP PS A+P+ TP+P +P P+ S Sbjct: 275 SPSPSPTPSPKASPSPSPTPSPKASPSPSPSPKASPSPTPSPKASPSPTPSPKASPSPSP 334 Query: 170 YVPDGPYVTST-TYTGTIVKP 229 P V+ T + GT KP Sbjct: 335 SPSTSPKVSPTPSPAGTAPKP 355 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/44 (52%), Positives = 31/44 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 +PTPSP SP+ TP+ SP P+P ASP PS +P A+P+P +P Sbjct: 241 SPTPSPKASPSPTPTPSPTPSPKASPSPSPSPKASPSPSPTPSP 284 [172][TOP] >UniRef100_Q54WQ8 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q54WQ8_DICDI Length = 672 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPSPT SPT +P+ SP +PT SP PS TP+ TP+P Sbjct: 172 TPTPSPTQSPTPSPTQSPTQSPTQSPTPSPTPSPTPSP 209 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT +P+ SP P+PT SP S TP+ TP+P Sbjct: 204 SPTPSPTQSPTQSPTQSPTPSPTQSPTQSPTPSPTPSP 241 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PTPSPT SPT +P+ SP P+PT SP PS TP+ T +P Sbjct: 220 SPTPSPTQSPTQSPTPSPTPSPTPSPTPSPTPSPTQSP 257 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 +PT SPT SPT +P+ SP P+PT SP PS TP+ TP+P Sbjct: 216 SPTQSPTPSPTQSPTQSPTPSPTPSPTPSPTPSPTPSP 253 [173][TOP] >UniRef100_C8SB49 PKD domain containing protein n=1 Tax=Ferroglobus placidus DSM 10642 RepID=C8SB49_FERPL Length = 386 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/85 (41%), Positives = 43/85 (50%), Gaps = 13/85 (15%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPS-------------ATPTATPNPGGILAPVKL 142 TPTP+PT +PT TP+A+PE TPT +P P+ TPT TP P P Sbjct: 207 TPTPTPTPTPTPTPTATPEVTPTPTPTPTPMETVTPTPTPAEETPTPTPTPTPTPTPTSS 266 Query: 143 NVGGPALSGYVPDGPYVTSTTYTGT 217 GG + SG G Y T+ T T T Sbjct: 267 TSGGFSGSG-GGGGSYTTTPTPTPT 290 [174][TOP] >UniRef100_P22534 Endoglucanase A n=1 Tax=Caldicellulosiruptor saccharolyticus RepID=GUNA_CALSA Length = 1742 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/58 (46%), Positives = 36/58 (62%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYV 175 TPTP+ T +PT TP+ +P PT TA+P P+ TPT+TP + P V PA SG + Sbjct: 654 TPTPTATPTPTPTPTVTPTPTVTATPTPTPTPTSTPT----VTPTPTPVSTPATSGQI 707 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+ T +PT TP+ +P PTPTA+P P+ TPT TP P Sbjct: 1062 TPAPTVTPTPTVTPTPTPAPTPTATPTPTPTPTVTPTP 1099 [175][TOP] >UniRef100_Q8A921 Beta-galactosidase n=1 Tax=Bacteroides thetaiotaomicron RepID=Q8A921_BACTN Length = 1418 Score = 55.5 bits (132), Expect = 2e-06 Identities = 38/117 (32%), Positives = 57/117 (48%), Gaps = 7/117 (5%) Frame = +2 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK-TVAYALPLPTGTYTVSLLFAEVY---- 349 PY+ S T P+ G+ + L+ FRFG+ + Y P+ GTY + L F E + Sbjct: 1123 PYLASQRTTND---PIRGSRDWKLFQHFRFGRHQLEYNFPVADGTYRIELYFTEPWHGTG 1179 Query: 350 --TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 T G R+FD+A+ D+ V+L D D++A++G KV TV L I Sbjct: 1180 GSASTDCEGLRIFDVAVNDS----VVLDDLDIWAESGHDGVCKKVVYATVKGGVLKI 1232 [176][TOP] >UniRef100_P74375 Slr0442 protein n=1 Tax=Synechocystis sp. PCC 6803 RepID=P74375_SYNY3 Length = 611 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/49 (46%), Positives = 35/49 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNV 148 +P+PSP+ SP+ +PS SP P+P+ SP PS +P+ +P+P PV +NV Sbjct: 536 SPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPTPVTVNV 584 [177][TOP] >UniRef100_B9MKU6 Mannan endo-1,4-beta-mannosidase., Cellulase n=1 Tax=Anaerocellum thermophilum DSM 6725 RepID=B9MKU6_ANATD Length = 1414 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN 112 T TP+PT +PT TP+A+P PTPT +P P+ATPT TP+ Sbjct: 541 TATPAPTPTPTPTPTATPTPTPTPTPTPTATPTPTPS 577 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN 112 T TP+PT +PT TP+A+P PTPT +P P+ATPT TP+ Sbjct: 742 TATPAPTPTPTPTPTATPTPTPTPTPTPTATPTPTPS 778 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/60 (43%), Positives = 36/60 (60%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+ T +PT TP+A+P PTPT +P +ATPT TP P + P+ P + + D Sbjct: 939 TPTPTATPAPTVTPTATPAPTPTPTPTVTATPTPTPTPVQTVIPMPTVTPNPTSTPSILD 998 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATP 109 TPTP+PT +PT+TP+ + PTPT +P P++TPTATP Sbjct: 330 TPTPTPTATPTATPTPTLTPTPTPTPTPTSTPTATP 365 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 TPTP+ T +PT TP+ +P TPT +P P+ TPTATP P PV Sbjct: 537 TPTPTATPAPTPTPTPTPTATPTPTPTPTPTPTATPTPTPSSTPV 581 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 TPTP+ T +PT TP+ +P TPT +P P+ TPTATP P PV Sbjct: 738 TPTPTATPAPTPTPTPTPTATPTPTPTPTPTPTATPTPTPSSTPV 782 [178][TOP] >UniRef100_B1H0S9 Putative uncharacterized protein n=1 Tax=uncultured Termite group 1 bacterium phylotype Rs-D17 RepID=B1H0S9_UNCTG Length = 173 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/59 (45%), Positives = 31/59 (52%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVP 178 TPTP+P PT TP+ PEPTPT +P P TPT TP P P + PA P Sbjct: 60 TPTPTPVPEPTPTPTPVPEPTPTPTPVPEPTPTPTPVPEPTPTPTPVPEPTPAFMDCFP 118 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+P PT TP+ PEPTPT +P P TPT TP P Sbjct: 50 TPTPTPAPEPTPTPTPVPEPTPTPTPVPEPTPTPTPVP 87 [179][TOP] >UniRef100_A7NPH2 Conserved repeat domain n=1 Tax=Roseiflexus castenholzii DSM 13941 RepID=A7NPH2_ROSCS Length = 453 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/84 (36%), Positives = 42/84 (50%), Gaps = 2/84 (2%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP--ALSGYV 175 TP P+PT +P TP+ +P+PTPT +P P+ TPT T P P + P ++ V Sbjct: 266 TPQPTPTFTPQPTPTFTPQPTPTFTPQPTETPTPTFTPQPTPTPTETPTPAPNVQVTKSV 325 Query: 176 PDGPYVTSTTYTGTIVKPVAGTSN 247 P T T TI GT+N Sbjct: 326 SSNPVQVGQTVTWTINVLNTGTTN 349 Score = 53.9 bits (128), Expect = 6e-06 Identities = 35/111 (31%), Positives = 50/111 (45%), Gaps = 1/111 (0%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TP P+PT +P TP+ +P+PTPT +P P TPT TP P P P + Sbjct: 250 TPQPTPTFTPQPTPTFTPQPTPTFTPQP--TPTFTPQPTPTFTPQPTETPTPTFT----- 302 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYAL-PLPTGTYTVSL 331 P T T P + + + G+TV + + L TGT V++ Sbjct: 303 -PQPTPTPTETPTPAPNVQVTKSVSSNPVQVGQTVTWTINVLNTGTTNVTI 352 [180][TOP] >UniRef100_A4XIG4 Type 3a, cellulose-binding domain protein n=1 Tax=Caldicellulosiruptor saccharolyticus DSM 8903 RepID=A4XIG4_CALS8 Length = 931 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGG 121 TPTP+PT++PT TP+ +P TPT +P P+ TP +TP GG Sbjct: 790 TPTPTPTVTPTPTPTPTPTSTPTVTPTPTPTPVSTPATGG 829 [181][TOP] >UniRef100_A4XC59 NLP/P60 protein n=1 Tax=Salinispora tropica CNB-440 RepID=A4XC59_SALTO Length = 517 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/42 (59%), Positives = 32/42 (76%), Gaps = 4/42 (9%) Frame = +2 Query: 2 TPTPSPTLS----PTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT S PTS PSASP P+ T++P PS +PT+TP+P Sbjct: 405 TPTPTPTASATPKPTSPPSASPSPSATSTPSPSTSPTSTPSP 446 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 2/40 (5%) Frame = +2 Query: 2 TPTPSPTLSPTSTPS--ASPEPTPTASPGPSATPTATPNP 115 T TPSPT SPT+TPS SP P PT++P P+ +PT TP+P Sbjct: 441 TSTPSPTTSPTNTPSPTTSPSPPPTSTPSPTTSPTNTPSP 480 [182][TOP] >UniRef100_A0LWJ5 Chitinase. Glycosyl Hydrolase family 18 n=1 Tax=Acidothermus cellulolyticus 11B RepID=A0LWJ5_ACIC1 Length = 591 Score = 55.5 bits (132), Expect = 2e-06 Identities = 41/139 (29%), Positives = 61/139 (43%), Gaps = 16/139 (11%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS----- 166 +P+PSP+ SP+ +PS SP P+P+ SP PS +P+ +P+P +P P+ S Sbjct: 402 SPSPSPSPSPSPSPSPSPSPSPSGSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSA 461 Query: 167 GYVPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRF-----------GKTVAYALPLPTG 313 G V +G + T + P A + H+ R+ G+ P Sbjct: 462 GLVVNGGFETGDVSGWSCQAPDAVVGSPV--HSGRYALAGVPTGSTTGQCTQTVSVAPNT 519 Query: 314 TYTVSLLFAEVYTYTSAIG 370 TYTVS Y Y A G Sbjct: 520 TYTVSAWVNGSYVYLGANG 538 [183][TOP] >UniRef100_A0LSI1 Cellulose-binding, family II n=1 Tax=Acidothermus cellulolyticus 11B RepID=A0LSI1_ACIC1 Length = 1298 Score = 55.5 bits (132), Expect = 2e-06 Identities = 39/123 (31%), Positives = 61/123 (49%), Gaps = 2/123 (1%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPE--PTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYV 175 +PTPSPT SPT +PS SP P+P+ SP PS +P+ +P+P +P P+ SG Sbjct: 1141 SPTPSPTPSPTPSPSPSPSLSPSPSPSPSPSPSPSLSPSPSTSPSPSPSPTPSPSSSGVG 1200 Query: 176 PDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTY 355 YV ++ + V T+ + + G TVA++ G TV+ + + T Sbjct: 1201 CRATYVVNSDWGSGFTATVTVTNTGSRATS---GWTVAWSF---GGNQTVTNYWNTLLTQ 1254 Query: 356 TSA 364 + A Sbjct: 1255 SGA 1257 [184][TOP] >UniRef100_C6IFU9 Beta-galactosidase n=1 Tax=Bacteroides sp. 1_1_6 RepID=C6IFU9_9BACE Length = 1413 Score = 55.5 bits (132), Expect = 2e-06 Identities = 38/117 (32%), Positives = 57/117 (48%), Gaps = 7/117 (5%) Frame = +2 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK-TVAYALPLPTGTYTVSLLFAEVY---- 349 PY+ S T P+ G+ + L+ FRFG+ + Y P+ GTY + L F E + Sbjct: 1118 PYLASQRTTND---PIRGSRDWKLFQHFRFGRHQLEYNFPVADGTYRIELYFTEPWHGTG 1174 Query: 350 --TYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPLII 514 T G R+FD+A+ D+ V+L D D++A++G KV TV L I Sbjct: 1175 GSASTDCEGLRIFDVAVNDS----VVLDDLDIWAESGHDGVCKKVVYATVKGGVLKI 1227 [185][TOP] >UniRef100_B5S8N0 Putative uncharacterized protein n=1 Tax=Ralstonia solanacearum RepID=B5S8N0_RALSO Length = 456 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/44 (52%), Positives = 31/44 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TP+P+PT +P+ +PS SP P+P+ SP PS TPT +P P AP Sbjct: 198 TPSPAPTSTPSLSPSPSPSPSPSPSPSPSPTPTPSPTPAPAPAP 241 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 P P+P+ +PTSTPS SP P+P+ SP PS +P+ TP P AP Sbjct: 195 PGPTPSPAPTSTPSLSPSPSPSPSPSPSPSPSPTPTPSPTPAP 237 [186][TOP] >UniRef100_B4B673 Putative uncharacterized protein n=1 Tax=Cyanothece sp. PCC 7822 RepID=B4B673_9CHRO Length = 209 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVG 151 TPTP+ T+ PT TP A+P PTP A+P P ATPT TP P ++ + +N G Sbjct: 53 TPTPTLTILPTPTPIATPTPTPIATPTPIATPTPTPTP---ISDIDINWG 99 [187][TOP] >UniRef100_A2GVH9 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2GVH9_TRIVA Length = 526 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/61 (42%), Positives = 36/61 (59%), Gaps = 6/61 (9%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSAT------PTATPNPGGILAPVKLNVGGPAL 163 TPTP+PT++PT TP+ +P PTPT +P P+ T PT TP P +AP P + Sbjct: 194 TPTPTPTVAPTPTPTPTPTPTPTVAPTPTPTPTPTVAPTPTPTPTPTVAPTPTPTPTPTV 253 Query: 164 S 166 + Sbjct: 254 A 254 [188][TOP] >UniRef100_A2ETH9 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2ETH9_TRIVA Length = 1144 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 3/47 (6%) Frame = +2 Query: 8 TPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPG---GILAPVK 139 TPSPT SP+ +PS SP PTP+ SP PS +PT +P+P I APV+ Sbjct: 703 TPSPTPSPSPSPSPSPSPTPSPSPSPSPSPTPSPSPSPSPSIAAPVR 749 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 389 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 425 [189][TOP] >UniRef100_Q0W057 Putative uncharacterized protein n=1 Tax=uncultured methanogenic archaeon RC-I RepID=Q0W057_UNCMA Length = 819 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 1/84 (1%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGG-ILAPVKLNVGGPALSGYVPD 181 PTPSPT +PT P+ +P PTPT P P+ TPT +P PG + + + G + Sbjct: 438 PTPSPTPTPTPGPNPTPTPTPTPGPNPTPTPTPSPEPGSYAVGLISMFAHYKGQMGSIER 497 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDA 253 TT + T++ G+++DA Sbjct: 498 FQVAPGTTVSQTMMIVNTGSASDA 521 [190][TOP] >UniRef100_Q6A5P9 Putative uncharacterized protein n=1 Tax=Propionibacterium acnes RepID=Q6A5P9_PROAC Length = 463 Score = 55.1 bits (131), Expect = 3e-06 Identities = 36/109 (33%), Positives = 49/109 (44%), Gaps = 4/109 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT TP+ +P P PT +P P+ PT TP P P P Sbjct: 368 TPTPTPTPTPTPTPAPTPTPAPTPTPAPTPAPTPTPAPTPTPTPTPTPTPTP-------- 419 Query: 182 GPYVTSTTYTGTIVKPVAGTS---NDALYHTFRFGKTVAYALPLP-TGT 316 T+ T P++ T+ N +HT + +A LP TGT Sbjct: 420 -------THGATTTTPISRTTDRHNLGSHHTRIAAPALIHAKALPATGT 461 [191][TOP] >UniRef100_Q608J7 Cellulose-binding domain protein n=1 Tax=Methylococcus capsulatus RepID=Q608J7_METCA Length = 1055 Score = 55.1 bits (131), Expect = 3e-06 Identities = 30/86 (34%), Positives = 42/86 (48%), Gaps = 15/86 (17%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP---------------GGILAPV 136 TP+P PT +P+ P+ASP P PT +P P+++P+ TP P G A V Sbjct: 213 TPSPIPTPTPSPAPTASPSPAPTPTPAPTSSPSPTPAPTGPCQADYQVTAQWNDGFTANV 272 Query: 137 KLNVGGPALSGYVPDGPYVTSTTYTG 214 K+ G AL G+ + T TG Sbjct: 273 KVRNNGTALDGWTVAWTMPSGQTVTG 298 [192][TOP] >UniRef100_Q2JXX5 Endonuclease/exonuclease/phosphatase family protein n=1 Tax=Synechococcus sp. JA-3-3Ab RepID=Q2JXX5_SYNJA Length = 635 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPV 136 TPTP+ T +PT TP+ +P PTPT +P P+ TPT TP P + P+ Sbjct: 428 TPTPTSTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPPPVNLPL 472 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/57 (43%), Positives = 35/57 (61%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGY 172 TPT +PT +PT TP+ +P PTPT +P P+ TPT TP P + + PA +G+ Sbjct: 430 TPTSTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPPPVNLPLTEDFDNCNPAPAGW 486 [193][TOP] >UniRef100_C5C0Q5 Putative uncharacterized protein n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C0Q5_BEUC1 Length = 201 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/40 (55%), Positives = 28/40 (70%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGG 121 TP PSP+ SP+ P+ +P P PTA+P P+ TPT TP P G Sbjct: 158 TPEPSPSPSPSPEPTPTPSPEPTATPSPTTTPTPTPTPSG 197 [194][TOP] >UniRef100_B0BZP0 Putative uncharacterized protein n=1 Tax=Acaryochloris marina MBIC11017 RepID=B0BZP0_ACAM1 Length = 988 Score = 55.1 bits (131), Expect = 3e-06 Identities = 33/83 (39%), Positives = 41/83 (49%), Gaps = 7/83 (8%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPN------PGGILAP-VKLNVGGPA 160 TP PSPT PT TP +PEP PT +P P TP TP PG I P + GPA Sbjct: 812 TPEPSPTPEPTPTPQPTPEPVPTPAPSPEPTPGPTPEPTPGSPPGTIPGPTIPQPTPGPA 871 Query: 161 LSGYVPDGPYVTSTTYTGTIVKP 229 S V P ++ +G+ +P Sbjct: 872 PSPDVTPVPQPSTDPPSGSTSQP 894 [195][TOP] >UniRef100_A1VTQ3 Putative uncharacterized protein n=1 Tax=Polaromonas naphthalenivorans CJ2 RepID=A1VTQ3_POLNA Length = 412 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 33/57 (57%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGY 172 TPTP+PT PT TP+ +P PTPT +P P+ TPT TP P + GP S Y Sbjct: 84 TPTPTPT--PTPTPTPTPTPTPTPTPTPTPTPTPTPTPPATTSSRGFPTAGPWASFY 138 [196][TOP] >UniRef100_A0LTI3 Glycoside hydrolase, family 9 n=1 Tax=Acidothermus cellulolyticus 11B RepID=A0LTI3_ACIC1 Length = 894 Score = 55.1 bits (131), Expect = 3e-06 Identities = 32/83 (38%), Positives = 40/83 (48%), Gaps = 2/83 (2%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGP--ALSGYV 175 TP+PSPT +P+ TP+ SP PT T +P PS++PT TP P P G YV Sbjct: 734 TPSPSPTPTPSPTPTPSPTPTRTPTPSPSSSPTPTPTPTRTATPTPTPSSGALRCTVRYV 793 Query: 176 PDGPYVTSTTYTGTIVKPVAGTS 244 + T TI GTS Sbjct: 794 KQSEWQNGATINVTITN--GGTS 814 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 +P PS T +PT TPS SP PTP+ +P PS TPT TP P +P Sbjct: 722 SPAPSSTPTPTPTPSPSPTPTPSPTPTPSPTPTRTPTPSPSSSP 765 [197][TOP] >UniRef100_A0LSH9 Cellulose-binding, family II n=1 Tax=Acidothermus cellulolyticus 11B RepID=A0LSH9_ACIC1 Length = 763 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/73 (36%), Positives = 43/73 (58%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TP+PSPT SP+ +P+ SP +P+ SP PS +PT +P+P +P + G + YV + Sbjct: 614 TPSPSPTPSPSPSPTPSPSSSPSPSPSPSPSPTPSPSPSPSPSPSVSSSGVGCRATYVVN 673 Query: 182 GPYVTSTTYTGTI 220 + + T T T+ Sbjct: 674 SDWGSGFTATVTV 686 [198][TOP] >UniRef100_B4L4Q5 GI15809 n=1 Tax=Drosophila mojavensis RepID=B4L4Q5_DROMO Length = 1342 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/65 (36%), Positives = 33/65 (50%) Frame = +2 Query: 8 TPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDGP 187 TP+P +PT TP+A+P PTPT +P P+ TPT TP P P + + G Sbjct: 374 TPTPAATPTPTPAATPTPTPTPTPTPTPTPTRTPTPASASVPASTPIESTPTGSSIVAGS 433 Query: 188 YVTST 202 +T Sbjct: 434 AAAAT 438 [199][TOP] >UniRef100_A9VD51 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VD51_MONBE Length = 682 Score = 55.1 bits (131), Expect = 3e-06 Identities = 50/176 (28%), Positives = 73/176 (41%), Gaps = 9/176 (5%) Frame = +2 Query: 8 TPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSG-----Y 172 T + T S S++ P T++P P+ T+ P G + ++N GG + S + Sbjct: 349 TATQTQDVASASSSASLPAATSAPAPTTVSTSQSTPAGSIL-YRINAGGHSYSAASGAEW 407 Query: 173 VPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGK---TVAYALPLPT-GTYTVSLLFA 340 D + T T V + +Y + R G V Y +P+P G +TV L FA Sbjct: 408 QEDNHFGTGVANVQTSAS-VPSATEPGIYQSARVGDGLHDVVYQVPIPIRGIFTVELYFA 466 Query: 341 EVYTYTSAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSAPL 508 E + IG RVF + + A L DL A AG + A V VT L Sbjct: 467 ETCDCATHIGDRVFGVTVEGLQVASRL----DLVAAAGWSRAFVLSVMVEVTDGML 518 [200][TOP] >UniRef100_Q6A720 Putative uncharacterized protein n=1 Tax=Propionibacterium acnes RepID=Q6A720_PROAC Length = 466 Score = 54.7 bits (130), Expect = 4e-06 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPG---GILAPVKLNVGGP----- 157 +P P+PT +PT TP+ +P PTPT +P P+ TPT TP A VG P Sbjct: 289 SPAPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTVDVKVTTTADQTAEVGKPFGDTA 348 Query: 158 ALSGYVPDGPYVT 196 ++G VP+G ++T Sbjct: 349 HITGTVPEGAHIT 361 [201][TOP] >UniRef100_Q48NE9 Autotransporter, putative n=1 Tax=Pseudomonas syringae pv. phaseolicola 1448A RepID=Q48NE9_PSE14 Length = 1005 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAP 133 TPTP+PT +P TP+ +PEPTPT P P+ TP TP P AP Sbjct: 585 TPTPTPTPTPEPTPTPTPEPTPTPEPTPTPTPEPTPTPTPEPAP 628 [202][TOP] >UniRef100_B8HQ54 Putative uncharacterized protein n=1 Tax=Cyanothece sp. PCC 7425 RepID=B8HQ54_CYAP4 Length = 468 Score = 54.7 bits (130), Expect = 4e-06 Identities = 29/82 (35%), Positives = 45/82 (54%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 +P+P P+ SP+ +PS SP P+P+ SP PS +P+ +P+P +P P+ S P Sbjct: 309 SPSPGPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPPP 368 Query: 182 GPYVTSTTYTGTIVKPVAGTSN 247 T T TG + V+G+ N Sbjct: 369 AGACTINTPTGNFPR-VSGSGN 389 [203][TOP] >UniRef100_B2UFP0 Putative uncharacterized protein n=1 Tax=Ralstonia pickettii 12J RepID=B2UFP0_RALPJ Length = 404 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/59 (44%), Positives = 35/59 (59%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 PTP+PT SP +PS +P P+PT SP P+ PT TP+P + +P GG G+ D Sbjct: 198 PTPAPTPSPGPSPSPTPSPSPTPSPTPTPAPTPTPSPSPVPSPCGSCHGGGHHHGHDHD 256 [204][TOP] >UniRef100_A9B5K8 Putative uncharacterized protein n=1 Tax=Herpetosiphon aurantiacus ATCC 23779 RepID=A9B5K8_HERA2 Length = 675 Score = 54.7 bits (130), Expect = 4e-06 Identities = 35/107 (32%), Positives = 45/107 (42%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPT PT + T P+A+ P PTA+ P+AT T TP P PV P + Sbjct: 286 TPTTEPTATSTPLPTATNTPVPTATSTPTATATNTPVPTATNTPVPTATSTPTATATNTP 345 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYT 322 P T+T P A ++ L A + PLPT T T Sbjct: 346 VPTATNTPVPTATSTPTATATSTPLPTATSTPLPTATSTPLPTATNT 392 [205][TOP] >UniRef100_A7HA91 Putative uncharacterized protein n=1 Tax=Anaeromyxobacter sp. Fw109-5 RepID=A7HA91_ANADF Length = 252 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+PT + TSTP+A+P PTPT + ++TPTATP P Sbjct: 166 TPTPTPTSTSTSTPTATPTPTPTPTSTSTSTPTATPTP 203 [206][TOP] >UniRef100_A1VRY2 Putative uncharacterized protein n=1 Tax=Polaromonas naphthalenivorans CJ2 RepID=A1VRY2_POLNA Length = 446 Score = 54.7 bits (130), Expect = 4e-06 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 16/98 (16%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTAT-----------PNPGGILAPVK--- 139 TPTP+PT +PT TP+ +P PTPT +P P+ T ++T NPG AP + Sbjct: 65 TPTPTPTPTPTPTPTPTPTPTPTPTPAPAPTSSSTNNYYVATTGSDTNPGTQAAPFRTIK 124 Query: 140 --LNVGGPALSGYVPDGPYVTSTTYTGTIVKPVAGTSN 247 +V P+ + +V G TY TI V GT++ Sbjct: 125 KAASVVKPSTTVHVAPG------TYAETITSTVNGTAS 156 [207][TOP] >UniRef100_C1WPW6 Putative uncharacterized protein n=1 Tax=Kribbella flavida DSM 17836 RepID=C1WPW6_9ACTO Length = 490 Score = 54.7 bits (130), Expect = 4e-06 Identities = 31/78 (39%), Positives = 42/78 (53%), Gaps = 6/78 (7%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGG------ILAPVKLNVGGPAL 163 TPTP+PT PT TP+ +P PTPT +P P+ TPT TP P G P + P+ Sbjct: 401 TPTPTPT--PTPTPTPTPTPTPTPTPTPTPTPTDTPTPCGPNETPPTADPTQTPAPVPSC 458 Query: 164 SGYVPDGPYVTSTTYTGT 217 + P G T + +TG+ Sbjct: 459 TA-TPSGQQSTQSEHTGS 475 [208][TOP] >UniRef100_C1WHH0 Putative uncharacterized protein n=1 Tax=Kribbella flavida DSM 17836 RepID=C1WHH0_9ACTO Length = 425 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/79 (37%), Positives = 41/79 (51%), Gaps = 5/79 (6%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALS----- 166 TPTP+PT +P+ TP+ +P PTPT +P + TPT TP+ P G P+ S Sbjct: 292 TPTPTPTDTPSDTPTPTPTPTPTDTPSDTPTPTDTPSESPTPTPTDSPSGTPSESPSQSP 351 Query: 167 GYVPDGPYVTSTTYTGTIV 223 P TS+T T +V Sbjct: 352 SQTPTPSQPTSSTSTPVVV 370 [209][TOP] >UniRef100_C0VCJ2 Cellobiohydrolase A (1,4-beta-cellobiosidase A) n=1 Tax=Xylanimonas cellulosilytica DSM 15894 RepID=C0VCJ2_9MICO Length = 459 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGIL 127 TPTP+PT +PT TP+ +P+PTPT +P P+ TPT P G L Sbjct: 143 TPTPTPTPTPTPTPTPTPDPTPTPTPTPTPTPTVPPVEAGEL 184 [210][TOP] >UniRef100_C5FXH4 TadE family protein n=1 Tax=Microsporum canis CBS 113480 RepID=C5FXH4_NANOT Length = 387 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTPS T SPT+TP+A+P TPTA+ P+ATPTATP+P Sbjct: 90 TPTPSSTDSPTATPTATPTATPTAT--PTATPTATPSP 125 [211][TOP] >UniRef100_A8NVW6 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NVW6_COPC7 Length = 943 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/66 (37%), Positives = 34/66 (51%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 P P+PT +PTSTP+ +P PTP + P+ PT TP P AP P + P Sbjct: 843 PAPTPTPAPTSTPAPAPTPTPAPTSTPAPAPTPTPAPTSTPAPAPTPTPAPTSASAPPPA 902 Query: 185 PYVTST 202 P + +T Sbjct: 903 PVLPTT 908 [212][TOP] >UniRef100_C1VEF3 Copper binding protein, plastocyanin/azurin family n=1 Tax=Halogeometricum borinquense DSM 11551 RepID=C1VEF3_9EURY Length = 202 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGI 124 TP SPT +PTS+P+A+P PT A+P P+ TPTATP P + Sbjct: 54 TPGESPTDTPTSSPTATPSPTTDATPSPTQTPTATPTPNAL 94 [213][TOP] >UniRef100_Q2JSH5 Protein kinase n=1 Tax=Synechococcus sp. JA-3-3Ab RepID=Q2JSH5_SYNJA Length = 721 Score = 54.3 bits (129), Expect = 5e-06 Identities = 30/84 (35%), Positives = 35/84 (41%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP PT +PT P+ +P P PT +P P TPT P P P P + VP Sbjct: 529 TPTPPPTPTPTPPPTPTPTPPPTLTPTPPPTPTPAPTPTPTPVPTPTLTPIPRFTPLVPR 588 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDA 253 P T T P T A Sbjct: 589 TPTPTPTPIPTPTSTPAPATPTPA 612 [214][TOP] >UniRef100_Q111N6 Cadherin n=1 Tax=Trichodesmium erythraeum IMS101 RepID=Q111N6_TRIEI Length = 2145 Score = 54.3 bits (129), Expect = 5e-06 Identities = 29/79 (36%), Positives = 38/79 (48%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 PTP PT PT P+ +P P PT +P P+ TP TP P LAP+ + P ++ P Sbjct: 39 PTPEPTPEPTLAPTPAPTPAPTLAPTPAPTPAPTPAP--TLAPIPAPIPAPTIA---PTP 93 Query: 185 PYVTSTTYTGTIVKPVAGT 241 P VT P+ T Sbjct: 94 PVVTPAPTPAPTPAPIPTT 112 [215][TOP] >UniRef100_B8G4H1 PT repeat-containing protein n=1 Tax=Chloroflexus aggregans DSM 9485 RepID=B8G4H1_CHLAD Length = 390 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/52 (51%), Positives = 34/52 (65%), Gaps = 2/52 (3%) Frame = +2 Query: 2 TPTPS--PTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVG 151 TPTPS PTL PT+TP ++ P TA+P P+ATP TP P I AP+ + G Sbjct: 45 TPTPSAIPTLPPTATPESTATPAATATPEPTATPEPTPTPEPITAPLAVPRG 96 [216][TOP] >UniRef100_B2SWM6 Putative hemagglutinin-related transmembrane protein n=1 Tax=Burkholderia phytofirmans PsJN RepID=B2SWM6_BURPP Length = 478 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/49 (51%), Positives = 34/49 (69%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNV 148 TPTP+PT +PT TP+ +P PTPT +P P+ TPT+ NP G++ NV Sbjct: 40 TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSA-NPVGVVVQNSGNV 87 [217][TOP] >UniRef100_A5USV4 Putative uncharacterized protein n=1 Tax=Roseiflexus sp. RS-1 RepID=A5USV4_ROSS1 Length = 548 Score = 54.3 bits (129), Expect = 5e-06 Identities = 29/80 (36%), Positives = 39/80 (48%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT P+A+P P PTA+P P+ T T T P P + +P Sbjct: 444 TPTPAPTATPTPAPTATPTPAPTATPTPAPTATPTDPPAPTATPTET----------LPP 493 Query: 182 GPYVTSTTYTGTIVKPVAGT 241 P +T T G AG+ Sbjct: 494 TPSITPTDEAGQPTVTPAGS 513 [218][TOP] >UniRef100_Q9WXI9 Family 19 chitinase (PRYA1 ORF) n=1 Tax=Aeromonas sp. 10S-24 RepID=Q9WXI9_9GAMM Length = 686 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 4/42 (9%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPT----PTASPGPSATPTATPNP 115 T TP PT SPT+ P+A+P+PT PTA+P P+A PTATP P Sbjct: 96 TATPVPTASPTAAPTATPKPTATPLPTATPAPTAAPTATPAP 137 [219][TOP] >UniRef100_Q7WYN2 Cellulosomal scaffoldin anchoring protein C n=1 Tax=Acetivibrio cellulolyticus RepID=Q7WYN2_9FIRM Length = 1237 Score = 54.3 bits (129), Expect = 5e-06 Identities = 41/91 (45%), Positives = 46/91 (50%), Gaps = 8/91 (8%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATP--TATPNPGGILAP-VKLNVGGPALSGY 172 TPTP+ + PT TPSA+ PTPT S P+ TP TATP P P V V A Sbjct: 898 TPTPTQSAMPTETPSATATPTPTQSEMPTETPSATATPTPTQSAIPTVTPEVTTSATPTP 957 Query: 173 VPDGP----YVTSTTYTGT-IVKPVAGTSND 250 P G TSTT T T VKP A T N+ Sbjct: 958 TPTGSVTPGVTTSTTPTPTQTVKPTATTVNE 988 [220][TOP] >UniRef100_C1RP99 Cellulase (Glycosyl hydrolase family 5) with CBM domain (Fragment) n=1 Tax=Cellulomonas flavigena DSM 20109 RepID=C1RP99_9CELL Length = 465 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 2/42 (4%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSAT--PTATPNPGG 121 TPTPSPT + T+TPS +P T T SP P+AT PTATP PGG Sbjct: 341 TPTPSPTPTVTTTPSPTPTATTTPSPTPTATTTPTATPAPGG 382 [221][TOP] >UniRef100_B5W858 Putative uncharacterized protein n=1 Tax=Arthrospira maxima CS-328 RepID=B5W858_SPIMA Length = 811 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +2 Query: 8 TPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPG 118 TPSP+ SP+ +PS SP P+P+ SP PS TPT TP PG Sbjct: 584 TPSPSPSPSPSPSPSPSPSPSPSPSPSPTPTPTPPPG 620 [222][TOP] >UniRef100_A0ZFT7 Putative uncharacterized protein n=1 Tax=Nodularia spumigena CCY9414 RepID=A0ZFT7_NODSP Length = 253 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTP PT PT TP+ +P PTP A+P P+ TP ATP P Sbjct: 151 PTPKPTAKPTPTPTPTPTPTPRATPTPTPTPRATPTP 187 [223][TOP] >UniRef100_A8J2F5 Predicted protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J2F5_CHLRE Length = 620 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/39 (53%), Positives = 31/39 (79%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPG 118 +P+PSP+ SP+ +PS SP P+P+ SP PS +P+ +PNPG Sbjct: 186 SPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPNPG 224 [224][TOP] >UniRef100_A7SXP8 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SXP8_NEMVE Length = 1190 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/61 (40%), Positives = 33/61 (54%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 PTP+PT +PT P+ +P P PT +P P+ TP TP P AP PAL+ + Sbjct: 814 PTPAPTPAPTPAPTPAPTPAPTPAPTPAPTPAPTPEPTPAPAPAPTPSPAPALTPALTPA 873 Query: 185 P 187 P Sbjct: 874 P 874 [225][TOP] >UniRef100_A2FY54 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2FY54_TRIVA Length = 560 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/76 (36%), Positives = 39/76 (51%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PT P+ +P P PT +P P+ T TP P P P L+ Sbjct: 260 TPTPTPTPTPTVAPTPTPTPEPTVAPTPTPTVAPTPEPTVAPTPTPTVAPTPTLTPTAHA 319 Query: 182 GPYVTSTTYTGTIVKP 229 GP S+++ T+ KP Sbjct: 320 GPPPMSSSHGITLNKP 335 [226][TOP] >UniRef100_Q8ZZW0 Putative uncharacterized protein n=1 Tax=Pyrobaculum aerophilum RepID=Q8ZZW0_PYRAE Length = 627 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/53 (50%), Positives = 32/53 (60%), Gaps = 15/53 (28%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASP---------------EPTPTASPGPSATPTATPNP 115 TP+PSPT++PT TP+A+P PTPTASP P TPTATP P Sbjct: 532 TPSPSPTVTPTPTPTATPTPAPPPQTATPTPTQTPTPTASPPPVTTPTATPTP 584 [227][TOP] >UniRef100_Q18EE0 Chitinase TP rich domain homolog n=1 Tax=Haloquadratum walsbyi DSM 16790 RepID=Q18EE0_HALWD Length = 404 Score = 54.3 bits (129), Expect = 5e-06 Identities = 32/73 (43%), Positives = 42/73 (57%) Frame = +2 Query: 8 TPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDGP 187 TP+PT +PT+TP +PEPTP +P P+ATPT TP P P GPA G Sbjct: 224 TPTPTATPTATP--TPEPTPIPTPTPTATPTPTPTP----TPTPTPSPGPAAGAV---GE 274 Query: 188 YVTSTTYTGTIVK 226 ++ TT+ GT V+ Sbjct: 275 WI-ETTHNGTNVR 286 [228][TOP] >UniRef100_B8G6L2 Putative uncharacterized protein n=1 Tax=Chloroflexus aggregans DSM 9485 RepID=B8G6L2_CHLAD Length = 1010 Score = 53.9 bits (128), Expect = 6e-06 Identities = 49/168 (29%), Positives = 63/168 (37%), Gaps = 1/168 (0%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPT +PT +PT T +A+P TPTA+ P+ T TATP P P + D Sbjct: 483 TPTATPTDTPTVTATATPTATPTATDTPTVTATATPTDTPTATPTDTPTATPTDTPTATD 542 Query: 182 GPYVTST-TYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVSLLFAEVYTYT 358 P T+T T T T T++ + T A P T T T + T T Sbjct: 543 TPTATATPTATDTPTTTATPTASPTVTAT-------PTATPTDTPTVTATATPTATATPT 595 Query: 359 SAIGKRVFDIAIGDAAAAPVLLHDYDLFADAGEATAVAKVFDVTVTSA 502 + V A A P D D ATA D +A Sbjct: 596 ATDTPTVTATATATPTATPT---DTPTATDTPTATATPTATDTPTVTA 640 [229][TOP] >UniRef100_B8G5M0 Laminin G, domain-containing 2 n=1 Tax=Chloroflexus aggregans DSM 9485 RepID=B8G5M0_CHLAD Length = 1746 Score = 53.9 bits (128), Expect = 6e-06 Identities = 29/74 (39%), Positives = 37/74 (50%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPT +PT +PT+TP+ +P PT T +P + TPT TP P P + P Y P Sbjct: 1632 TPTNTPTYTPTNTPTNTPTPTETPAPTNTPTPTETPAPTNTPTPTETPTNTPT---YTPT 1688 Query: 182 GPYVTSTTYTGTIV 223 TT T T V Sbjct: 1689 ATNTPITTPTATAV 1702 [230][TOP] >UniRef100_A9WC61 Autotransporter-associated beta strand repeat protein n=2 Tax=Chloroflexus RepID=A9WC61_CHLAA Length = 1320 Score = 53.9 bits (128), Expect = 6e-06 Identities = 35/112 (31%), Positives = 48/112 (42%), Gaps = 4/112 (3%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILA----PVKLNVGGPALSGY 172 PT S T SP++T S +PEPT + +P PSAT + TP+P + P P+ + Sbjct: 686 PTASTTPSPSATASTTPEPTASTTPSPSATASTTPSPSATASATPEPTASTTPSPSATAS 745 Query: 173 VPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYTVS 328 V P T++T S A A A P PT + T S Sbjct: 746 VTPSPSATASTTPSPSATASVTPSPSATASMTPSPSATASATPEPTASTTPS 797 Score = 53.9 bits (128), Expect = 6e-06 Identities = 35/109 (32%), Positives = 48/109 (44%), Gaps = 4/109 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSAS----PEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSG 169 TP+PS T S T +PSA+ PEPT + +P PSAT +ATP P +PV P + Sbjct: 1065 TPSPSATASVTPSPSATASTTPEPTASTTPSPSATASATPEPTASTSPVSTVTTSPVPTV 1124 Query: 170 YVPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGT 316 P VT++ PV + + P+PT T Sbjct: 1125 TTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVT 1173 Score = 53.5 bits (127), Expect = 8e-06 Identities = 37/113 (32%), Positives = 49/113 (43%), Gaps = 8/113 (7%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSAS----PEPTPTASPGPSATPTATPNPGGILAPVKLNVG----GP 157 TP+PS T S T +PSA+ PEPT + +P PSAT +ATP P + P P Sbjct: 825 TPSPSATASATPSPSATASVTPEPTASTTPSPSATASATPEPTASVTPSPSATASVTPSP 884 Query: 158 ALSGYVPDGPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGT 316 + + V P T++T V S A T A P P+ T Sbjct: 885 SATASVTPSPSATASTTPSPSVTASTTPSPSATASTTPSPSATASTTPSPSAT 937 [231][TOP] >UniRef100_A7HFY4 ABC transporter related n=1 Tax=Anaeromyxobacter sp. Fw109-5 RepID=A7HFY4_ANADF Length = 620 Score = 53.9 bits (128), Expect = 6e-06 Identities = 33/102 (32%), Positives = 48/102 (47%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+PT +PTSTP+++P T T P ++TPT+TP P P P + Sbjct: 291 TPTPTPTSTPTSTPTSTPASTST--PTSTSTPTSTPTPTPTPTPTSTPTSTPTSTPTPTS 348 Query: 182 GPYVTSTTYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLP 307 P TST + P +++ L + R A+P P Sbjct: 349 TPTSTSTPTPTSTPTPTPTPTSEPLAGSARPEPVEGRAIPTP 390 [232][TOP] >UniRef100_C7PXX1 Alpha-1,2-mannosidase n=1 Tax=Catenulispora acidiphila DSM 44928 RepID=C7PXX1_CATAD Length = 1465 Score = 53.9 bits (128), Expect = 6e-06 Identities = 35/91 (38%), Positives = 43/91 (47%), Gaps = 6/91 (6%) Frame = +2 Query: 14 SPTLSPTSTPSASPEPTPTASPGPSATPT---ATPNPGGILAPVKLNVG---GPALSGYV 175 SP +P S+P+ASP P PTASP PSA+P+ + G A K G P L G + Sbjct: 278 SPNTAPGSSPTASPSPNPTASPSPSASPSPAAGSSTGGSTPAAPKAKPGALPAPTLHGAI 337 Query: 176 PDGPYVTSTTYTGTIVKPVAGTSNDALYHTF 268 P P T + A T D LY TF Sbjct: 338 PAAPKAA----TQKLAANAAATGPDGLYLTF 364 [233][TOP] >UniRef100_C4RIE3 Putative uncharacterized protein n=1 Tax=Micromonospora sp. ATCC 39149 RepID=C4RIE3_9ACTO Length = 247 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP+ T +PT+TP+ + PTPT +P P+ TPTATP P Sbjct: 161 TPTPTATPTPTATPTPTATPTPTVTPTPTRTPTATPTP 198 [234][TOP] >UniRef100_C4CM86 Serine/threonine protein kinase n=1 Tax=Sphaerobacter thermophilus DSM 20745 RepID=C4CM86_9CHLR Length = 592 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TP P+PTL PT TP +P PTPT P P+ TP TP P Sbjct: 376 TPEPTPTLEPTPTPEPTPTPTPTPEPTPTPTPEPTPTP 413 [235][TOP] >UniRef100_C0BAW2 Putative uncharacterized protein n=1 Tax=Coprococcus comes ATCC 27758 RepID=C0BAW2_9FIRM Length = 161 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/50 (52%), Positives = 30/50 (60%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGG 154 PTP PT PT P +PEPTPT P P +TP TP+PGG + N GG Sbjct: 111 PTPEPTPDPTPAPDPAPEPTPTPDPAPDSTP--TPDPGG---GAESNAGG 155 [236][TOP] >UniRef100_B1Q2N8 Putative glycosidase n=1 Tax=Paenibacillus sp. KSM-M126 RepID=B1Q2N8_9BACL Length = 1172 Score = 53.9 bits (128), Expect = 6e-06 Identities = 36/85 (42%), Positives = 47/85 (55%), Gaps = 3/85 (3%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 TPTP+ T +PT TP+A+P TPTA+P P+ATPTATP P + V Sbjct: 181 TPTPTATPTPTVTPTATP--TPTATPTPTATPTATP------------TATPTPTATVT- 225 Query: 182 GPYVTSTTYTGT---IVKPVAGTSN 247 P VT T TG+ +VK + +SN Sbjct: 226 -PTVTPTPVTGSNIAVVKSITASSN 249 [237][TOP] >UniRef100_A0YIV9 Beta-lactamase, putative n=1 Tax=Lyngbya sp. PCC 8106 RepID=A0YIV9_9CYAN Length = 1543 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/38 (57%), Positives = 26/38 (68%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 TPTP PT +PT P +P+PTPT +P P TPT TP P Sbjct: 1173 TPTPQPTPTPTPEPVPTPQPTPTPTPEPQPTPTPTPEP 1210 [238][TOP] >UniRef100_Q556Y6 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q556Y6_DICDI Length = 659 Score = 53.9 bits (128), Expect = 6e-06 Identities = 37/112 (33%), Positives = 50/112 (44%), Gaps = 5/112 (4%) Frame = +2 Query: 2 TPTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPD 181 T TP+PT+S T TP+ + PTPT + P+ T T TP P + P P + V Sbjct: 315 TVTPTPTVSATPTPTETVTPTPTMTTTPTPTETVTPTPTETVTPTPTESATPTPTETVTP 374 Query: 182 GPYVTST-----TYTGTIVKPVAGTSNDALYHTFRFGKTVAYALPLPTGTYT 322 P VT+T T T T + T ++ + T A P PT T T Sbjct: 375 TPTVTTTPAPTETVTPTPTESATPTPSETVTPT-----PTVTATPTPTETET 421 [239][TOP] >UniRef100_Q54Y16 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q54Y16_DICDI Length = 664 Score = 53.9 bits (128), Expect = 6e-06 Identities = 33/90 (36%), Positives = 43/90 (47%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNPGGILAPVKLNVGGPALSGYVPDG 184 PTP+PT + T TP+ + PT T++P P+ TPT TP P P + + VP Sbjct: 71 PTPTPTSTSTPTPTPTQTPTSTSTPTPTPTPTPTPTPTPTPTPTSTSTPTTTQTKTVPSN 130 Query: 185 PYVTSTTYTGTIVKPVAGTSNDALYHTFRF 274 P ST Y + G SN YH RF Sbjct: 131 P--ISTNY-------MEGVSN---YHKIRF 148 [240][TOP] >UniRef100_A2I2C4 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2I2C4_TRIVA Length = 280 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 202 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 238 [241][TOP] >UniRef100_A2HYW7 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2HYW7_TRIVA Length = 320 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 118 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 154 [242][TOP] >UniRef100_A2HXL9 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2HXL9_TRIVA Length = 288 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 57 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 93 [243][TOP] >UniRef100_A2HBZ3 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2HBZ3_TRIVA Length = 347 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 132 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 168 [244][TOP] >UniRef100_A2H4Q8 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2H4Q8_TRIVA Length = 459 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 212 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 248 [245][TOP] >UniRef100_A2H3K3 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2H3K3_TRIVA Length = 475 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 198 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 234 [246][TOP] >UniRef100_A2H1Q1 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2H1Q1_TRIVA Length = 295 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 132 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 168 [247][TOP] >UniRef100_A2H0K6 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2H0K6_TRIVA Length = 447 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 323 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 359 [248][TOP] >UniRef100_A2GVT7 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2GVT7_TRIVA Length = 553 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 194 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 230 [249][TOP] >UniRef100_A2GPR9 Putative uncharacterized protein (Fragment) n=1 Tax=Trichomonas vaginalis G3 RepID=A2GPR9_TRIVA Length = 661 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 82 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 118 [250][TOP] >UniRef100_A2G6T0 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2G6T0_TRIVA Length = 900 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 5 PTPSPTLSPTSTPSASPEPTPTASPGPSATPTATPNP 115 PTPSPT SPT T + +P PTPT +P PS TPT P P Sbjct: 132 PTPSPTPSPTPTKAPTPSPTPTKAPTPSPTPTKAPTP 168