[UP]
[1][TOP] >UniRef100_Q6Z245 Putative signal recognition particle receptor n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z245_ORYSJ Length = 610 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK Sbjct: 581 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 610 [2][TOP] >UniRef100_C5WMT6 Putative uncharacterized protein Sb01g050330 n=1 Tax=Sorghum bicolor RepID=C5WMT6_SORBI Length = 624 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK Sbjct: 595 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 624 [3][TOP] >UniRef100_B9STS5 Signal recognition particle receptor alpha subunit, putative n=1 Tax=Ricinus communis RepID=B9STS5_RICCO Length = 618 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK Sbjct: 589 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 618 [4][TOP] >UniRef100_B9G1G0 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9G1G0_ORYSJ Length = 1103 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK Sbjct: 1074 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 1103 [5][TOP] >UniRef100_B4F9Q4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4F9Q4_MAIZE Length = 625 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK Sbjct: 596 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 625 [6][TOP] >UniRef100_A7PFQ9 Chromosome chr11 scaffold_14, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PFQ9_VITVI Length = 616 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK Sbjct: 587 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 616 [7][TOP] >UniRef100_A5ANZ7 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5ANZ7_VITVI Length = 313 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK Sbjct: 284 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 313 [8][TOP] >UniRef100_Q6Z246 Os08g0480100 protein n=2 Tax=Oryza sativa RepID=Q6Z246_ORYSJ Length = 624 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK Sbjct: 595 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 624 [9][TOP] >UniRef100_Q6UCJ1 Signal recognition particle receptor protein (Fragment) n=1 Tax=Cucumis sativus RepID=Q6UCJ1_CUCSA Length = 313 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQSYTDLKKLNVKSIVKTL+K Sbjct: 284 GAPVMFVGCGQSYTDLKKLNVKSIVKTLIK 313 [10][TOP] >UniRef100_C5YZN3 Putative uncharacterized protein Sb09g003220 n=1 Tax=Sorghum bicolor RepID=C5YZN3_SORBI Length = 588 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQSYTDLKKLNVKSIV TLLK Sbjct: 559 GAPVMFVGCGQSYTDLKKLNVKSIVNTLLK 588 [11][TOP] >UniRef100_Q9M0A0 Signal recognition particle receptor-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9M0A0_ARATH Length = 634 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 G+PVMFVGCGQSYTDLKKLNVK+IVKTLLK Sbjct: 605 GSPVMFVGCGQSYTDLKKLNVKAIVKTLLK 634 [12][TOP] >UniRef100_B9HB30 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HB30_POPTR Length = 624 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 G+PVMFVGCGQSYTDLKKLNVK+IVKTLLK Sbjct: 595 GSPVMFVGCGQSYTDLKKLNVKAIVKTLLK 624 [13][TOP] >UniRef100_B9IMD0 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9IMD0_POPTR Length = 312 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 G+PVMFVGCGQSYTDLKKLNVK+I+KTLLK Sbjct: 283 GSPVMFVGCGQSYTDLKKLNVKAIIKTLLK 312 [14][TOP] >UniRef100_A8IS72 Alpha subunit of the SRP receptor n=1 Tax=Chlamydomonas reinhardtii RepID=A8IS72_CHLRE Length = 687 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 293 GAPVMFVGCGQ+Y DLKKLNVKS+VK+LLK Sbjct: 658 GAPVMFVGCGQTYVDLKKLNVKSVVKSLLK 687 [15][TOP] >UniRef100_A9SLT4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SLT4_PHYPA Length = 591 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLL 296 GAPVMFVGCGQ+YTDLKKLNVKS++K+LL Sbjct: 562 GAPVMFVGCGQNYTDLKKLNVKSVMKSLL 590 [16][TOP] >UniRef100_A9TQP8 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TQP8_PHYPA Length = 633 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLL 296 GAPVMFVGCGQ+YTDLKKLN+KS++K+LL Sbjct: 604 GAPVMFVGCGQNYTDLKKLNIKSVMKSLL 632 [17][TOP] >UniRef100_C1MW67 Type II secretory pathway family protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MW67_9CHLO Length = 628 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLL 296 GAPVMFVGCGQ+YTDLK+LNV+S+VK+LL Sbjct: 598 GAPVMFVGCGQTYTDLKRLNVRSVVKSLL 626 [18][TOP] >UniRef100_C1EBQ9 Type II secretory pathway family n=1 Tax=Micromonas sp. RCC299 RepID=C1EBQ9_9CHLO Length = 650 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 382 GAPVMFVGCGQSYTDLKKLNVKSIVKTLL 296 GAPV+FVGCGQ+YTDL++LNVKS+VK LL Sbjct: 619 GAPVVFVGCGQTYTDLRRLNVKSVVKILL 647