[UP]
[1][TOP] >UniRef100_Q9LZZ7 Spindle and kinetochore-associated protein 1 homolog n=1 Tax=Arabidopsis thaliana RepID=SKA1_ARATH Length = 272 Score = 78.6 bits (192), Expect = 2e-13 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 454 DIKGPSLKLDNTGKAILTVLRHLGRINETRVGHHRVIILPKPH 326 D+KGPSLKLDNTGKAILTVLRHLGRI+ETR+G +RVIIL KPH Sbjct: 230 DMKGPSLKLDNTGKAILTVLRHLGRISETRIGQNRVIILMKPH 272 [2][TOP] >UniRef100_A7PYB5 Chromosome chr15 scaffold_37, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PYB5_VITVI Length = 269 Score = 78.2 bits (191), Expect = 3e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -1 Query: 454 DIKGPSLKLDNTGKAILTVLRHLGRINETRVGHHRVIILPKP 329 DIKGP+LKLDNTG+AILTVLRHLGRI+E R+GHHRVIIL KP Sbjct: 227 DIKGPALKLDNTGRAILTVLRHLGRISEIRIGHHRVIILSKP 268 [3][TOP] >UniRef100_A5B3L2 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B3L2_VITVI Length = 279 Score = 78.2 bits (191), Expect = 3e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -1 Query: 454 DIKGPSLKLDNTGKAILTVLRHLGRINETRVGHHRVIILPKP 329 DIKGP+LKLDNTG+AILTVLRHLGRI+E R+GHHRVIIL KP Sbjct: 237 DIKGPALKLDNTGRAILTVLRHLGRISEIRIGHHRVIILSKP 278 [4][TOP] >UniRef100_B9RD75 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RD75_RICCO Length = 265 Score = 74.7 bits (182), Expect = 3e-12 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -1 Query: 454 DIKGPSLKLDNTGKAILTVLRHLGRINETRVGHHRVIILPKP 329 DIKGP+LKLDNTGKA+LTVLRHLGRI+ETR+G HR++IL KP Sbjct: 224 DIKGPTLKLDNTGKAMLTVLRHLGRISETRIGPHRILILLKP 265 [5][TOP] >UniRef100_B4FGS2 Spindle and kinetochore-associated protein 1 homolog n=1 Tax=Zea mays RepID=SKA1_MAIZE Length = 273 Score = 73.6 bits (179), Expect = 7e-12 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 454 DIKGPSLKLDNTGKAILTVLRHLGRINETRVGHHRVIILPK 332 DIKGP LKLDNTGKAILTVLRHLGR +E R+GHHRV IL K Sbjct: 231 DIKGPGLKLDNTGKAILTVLRHLGRFHEVRIGHHRVFILSK 271 [6][TOP] >UniRef100_Q7XAM0 Spindle and kinetochore-associated protein 1 homolog n=1 Tax=Oryza sativa Japonica Group RepID=SKA1_ORYSJ Length = 276 Score = 72.8 bits (177), Expect = 1e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -1 Query: 454 DIKGPSLKLDNTGKAILTVLRHLGRINETRVGHHRVIILPK 332 DIKGP LKLD TGKAILTVLRHLGR ETR+GHHRV IL K Sbjct: 234 DIKGPGLKLDTTGKAILTVLRHLGRFQETRIGHHRVFILSK 274 [7][TOP] >UniRef100_B8B624 Spindle and kinetochore-associated protein 1 homolog n=1 Tax=Oryza sativa Indica Group RepID=SKA1_ORYSI Length = 276 Score = 72.8 bits (177), Expect = 1e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -1 Query: 454 DIKGPSLKLDNTGKAILTVLRHLGRINETRVGHHRVIILPK 332 DIKGP LKLD TGKAILTVLRHLGR ETR+GHHRV IL K Sbjct: 234 DIKGPGLKLDTTGKAILTVLRHLGRFQETRIGHHRVFILSK 274 [8][TOP] >UniRef100_C5X8L2 Putative uncharacterized protein Sb02g033410 n=1 Tax=Sorghum bicolor RepID=C5X8L2_SORBI Length = 273 Score = 71.2 bits (173), Expect = 3e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -1 Query: 454 DIKGPSLKLDNTGKAILTVLRHLGRINETRVGHHRVIILPK 332 DIKGP LKLD+TGKAILTVLRHLGR E R+GHHRV IL K Sbjct: 231 DIKGPGLKLDHTGKAILTVLRHLGRFQEVRIGHHRVFILSK 271