[UP]
[1][TOP] >UniRef100_UPI000198304D PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI000198304D Length = 280 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEADQSGT+V+++A+DGKSVS+DTPLF IEP Sbjct: 250 IEADQSGTIVEILADDGKSVSIDTPLFAIEP 280 [2][TOP] >UniRef100_B9IQ25 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IQ25_POPTR Length = 284 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEADQ+GT+V+++AEDGK VSVDTPLFVIEP Sbjct: 254 IEADQTGTIVEILAEDGKPVSVDTPLFVIEP 284 [3][TOP] >UniRef100_Q42783 Biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic n=2 Tax=Glycine max RepID=BCCP_SOYBN Length = 262 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEADQSGT+V+++AED KSVSVDTPLFVI+P Sbjct: 232 IEADQSGTIVEIVAEDAKSVSVDTPLFVIQP 262 [4][TOP] >UniRef100_Q84T86 Biotin carboxylase carrier protein n=1 Tax=Solanum lycopersicum RepID=Q84T86_SOLLC Length = 285 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEAD+SGT+V+V+AEDGK VSVDTPLFVI+P Sbjct: 255 IEADRSGTIVEVVAEDGKPVSVDTPLFVIKP 285 [5][TOP] >UniRef100_A8RWF8 Biotin carboxyl carrier protein subunit n=1 Tax=Gossypium hirsutum RepID=A8RWF8_GOSHI Length = 282 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEADQSGT+V+++AEDGK+VSVD PLFVIEP Sbjct: 252 IEADQSGTMVEILAEDGKAVSVDMPLFVIEP 282 [6][TOP] >UniRef100_Q39347 Biotin carboxyl carrier protein (Fragment) n=1 Tax=Brassica napus RepID=Q39347_BRANA Length = 68 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IE+DQ+GTVVD++AEDGK VS+DTPLFV++P Sbjct: 38 IESDQTGTVVDIVAEDGKPVSLDTPLFVVQP 68 [7][TOP] >UniRef100_B5LAS8 Putative biotin carboxyl carrier protein 2 n=1 Tax=Capsicum annuum RepID=B5LAS8_CAPAN Length = 263 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEA+QSGT+V+V+AEDGK VSVDTPLFVI+P Sbjct: 233 IEANQSGTIVEVVAEDGKPVSVDTPLFVIKP 263 [8][TOP] >UniRef100_A5B6T4 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B6T4_VITVI Length = 383 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 463 EADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 EADQSGT+V+++A+DGKSVS+DTPLF IEP Sbjct: 354 EADQSGTIVEILADDGKSVSIDTPLFAIEP 383 [9][TOP] >UniRef100_Q9GE06 Biotin carboxyl carrier protein subunit n=1 Tax=Glycine max RepID=Q9GE06_SOYBN Length = 284 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEADQSGTV +V+AEDGK VSVDTPLFVI P Sbjct: 254 IEADQSGTVAEVVAEDGKPVSVDTPLFVIVP 284 [10][TOP] >UniRef100_Q9FQ74 Biotin carboxyl carrier protein subunit n=1 Tax=Glycine max RepID=Q9FQ74_SOYBN Length = 284 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEADQSGTV +V+AEDGK VSVDTPLFVI P Sbjct: 254 IEADQSGTVAEVVAEDGKPVSVDTPLFVIVP 284 [11][TOP] >UniRef100_B9RM56 Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) n=1 Tax=Ricinus communis RepID=B9RM56_RICCO Length = 315 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEADQSGT+V+ + EDGK VSVDTPLFVIEP Sbjct: 285 IEADQSGTIVEALLEDGKPVSVDTPLFVIEP 315 [12][TOP] >UniRef100_C0LLW0 Acetyl-coenzyme A carboxylase (Fragment) n=1 Tax=Suaeda salsa RepID=C0LLW0_SUASA Length = 257 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEADQSGT+V+++A+DGK VSVD PLFVIEP Sbjct: 227 IEADQSGTIVEILAKDGKPVSVDMPLFVIEP 257 [13][TOP] >UniRef100_B9SJD0 Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP2) n=1 Tax=Ricinus communis RepID=B9SJD0_RICCO Length = 260 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IEADQSGT+ +V+AEDGK VSVDTPLFVI P Sbjct: 230 IEADQSGTITEVLAEDGKPVSVDTPLFVIVP 260 [14][TOP] >UniRef100_Q42048 Biotin carboxyl carrier protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q42048_ARATH Length = 90 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IE+D +GTVVD++AEDGK VS+DTPLFV++P Sbjct: 60 IESDHTGTVVDIVAEDGKPVSLDTPLFVVQP 90 [15][TOP] >UniRef100_Q42533 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=BCCP1_ARATH Length = 280 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -3 Query: 466 IEADQSGTVVDVIAEDGKSVSVDTPLFVIEP 374 IE+D +GTVVD++AEDGK VS+DTPLFV++P Sbjct: 250 IESDHTGTVVDIVAEDGKPVSLDTPLFVVQP 280