[UP]
[1][TOP] >UniRef100_Q8VX74 Glycine-rich RNA-binding protein n=1 Tax=Ricinus communis RepID=Q8VX74_RICCO Length = 165 Score = 67.4 bits (163), Expect = 5e-10 Identities = 32/44 (72%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDG-GGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGYGG R+ YGG G GGSRY GGG GNWRS Sbjct: 123 GGGGYG-GGGGGYGGGRDRGYGGGGDGGSRYSRGGGASEGNWRS 165 Score = 65.9 bits (159), Expect = 1e-09 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -2 Query: 296 GGGGYGEGGGGGYGG-RREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGGY GGGGGYGG RREG YGG GG SR G G GGGGG + Sbjct: 93 GGGGYRNGGGGGYGGGRREGGYGGGGGYSRGGGGYGGGGGGY 134 [2][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPPSP PPPP Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/41 (65%), Positives = 27/41 (65%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 Q PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 204 QPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP SP PP PPPPPSP PPPP Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPP-PPPPPSPPPPPP 246 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP SP PP PPPPPSP PPPP Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPP-PPPPPSPPPPPP 258 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPP PSP PPPP Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP SPS PP PPP PSP PPPP Sbjct: 242 PPPPPPPPPPSPPPPPPPPSPS--PPPPPPSPSPPPPPP 278 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP PPPP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP PPPP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P-----PPPPSPYPPPP 297 PPPPPPP P PPP PP SP PP P PPPPSP PPPP Sbjct: 233 PPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP SPS PP PPPPPSP P PP Sbjct: 253 PPPPPPPPSPSPPPPPP-SPS--PPPPPPPPSPPPAPP 287 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PP PP SPS PP PPP P P PPP Sbjct: 254 PPPPPPPSP---SPPPPPPSPSPPPPPPPPSPPPAPPP 288 [3][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 67.0 bits (162), Expect = 6e-10 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 ++PPPPPPP P PPPSPP PS PP PPPPP P PPPP Sbjct: 203 KYPPPPPPPPPSPSPPPSPPPPPSPPPP-PPPPPPPSPPPP 242 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPSP PPP Sbjct: 229 PPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPP 267 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP PS PP PPPPP PPPP Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPPSP PP P Sbjct: 227 PPPPPPPPPPPSPPPPPPPPP---PPSPPPPPSPPPPSP 262 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP P PPP PP SP PP PPPP P PP P Sbjct: 219 PSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSP 257 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP PS PP PP PP P PP Sbjct: 235 PPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSPP 273 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP P PP PPPP PPP Sbjct: 223 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 [4][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 67.0 bits (162), Expect = 6e-10 Identities = 28/49 (57%), Positives = 31/49 (63%) Frame = +1 Query: 151 GKQTI*LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 G +T+ + PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 67 GGRTVKCIVIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP 291 PPPPPPP P PPP PP P PP PPPPP P P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCP 118 [5][TOP] >UniRef100_Q6YNS1 Putative glycine-rich RNA-binding protein n=1 Tax=Prunus avium RepID=Q6YNS1_PRUAV Length = 178 Score = 67.0 bits (162), Expect = 6e-10 Identities = 33/46 (71%), Positives = 36/46 (78%), Gaps = 3/46 (6%) Frame = -2 Query: 296 GGGGYGEGGGG-GYGGRREGEYGG-DGGGSRYGNGGGGG-GGNWRS 168 GGGGYG GGGG G GGRREG YGG +GGG+RY G GG GG+WRS Sbjct: 133 GGGGYGSGGGGYGGGGRREGGYGGGEGGGARYSRGSGGSEGGSWRS 178 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/45 (66%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGG---DGGGSRYGNGGGGGGGNWR 171 GGGGYG GGG G GGRREG GG GGG YG+GGGG GG R Sbjct: 105 GGGGYGGGGGYGGGGRREGGGGGYSRGGGGGGYGSGGGGYGGGGR 149 [6][TOP] >UniRef100_B9SLQ3 Glycine-rich RNA-binding protein, putative n=1 Tax=Ricinus communis RepID=B9SLQ3_RICCO Length = 166 Score = 67.0 bits (162), Expect = 6e-10 Identities = 32/45 (71%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGG--GSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGYGG R+ YGG GG GSRY GGG GNWRS Sbjct: 123 GGGGYG-GGGGGYGGGRDRGYGGGGGDGGSRYSRGGGASEGNWRS 166 Score = 65.9 bits (159), Expect = 1e-09 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -2 Query: 296 GGGGYGEGGGGGYGG-RREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGGY GGGGGYGG RREG YGG GG SR G G GGGGG + Sbjct: 93 GGGGYRNGGGGGYGGGRREGGYGGGGGYSRGGGGYGGGGGGY 134 [7][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP P PPPP Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*R-EPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPPLP PPP PP P PP PPPPP P+PPPP Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSP-SRRPP*PPPPPSPYPPPP 297 PPPPPPLP PPPSPP P S PP PPPPP P PPPP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPP 252 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPP PP P PP PPPPP P PPPP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PP PPSP PPPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPSPP P PP PPPPP P PPPP Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP P PP PPPPP P PPPP Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PP PP P PPPP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P P PPPPP P PPPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPP P PPPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P P PPPPP P PPPP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP P PP PPPPP P PPPP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP P PP PPPPP P PPPP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P PP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 [8][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPPLP PPP PP P PP PPPPP P PPPP Sbjct: 24 PPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 33 PPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPHCPPP---PPPPPPLPPPPPPPPPPPPPPPPPPPP 51 [9][TOP] >UniRef100_Q2QLR2 Os12g0632000 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2QLR2_ORYSJ Length = 162 Score = 66.6 bits (161), Expect = 8e-10 Identities = 34/55 (61%), Positives = 35/55 (63%), Gaps = 12/55 (21%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDG--GGSRYGNGGGGGG----------GNWRS 168 GGGGYG GGGGGYG RREG YGG G GG R G GG GGG GNWR+ Sbjct: 108 GGGGYGGGGGGGYGQRREGGYGGGGGYGGGRGGGGGYGGGYGSRGGGNSDGNWRN 162 [10][TOP] >UniRef100_A8WN17 C. briggsae CBR-UAF-2 protein n=1 Tax=Caenorhabditis briggsae RepID=A8WN17_CAEBR Length = 281 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRRE---GEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGG GYGG R+ G +GG GGG RYG GGGGGGG Sbjct: 219 GGGGYGGGGGYGYGGGRDRDRGGWGGGGGGGRYGGGGGGGGG 260 [11][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPPLP PPP PP PS PP PPPPP P PPPP Sbjct: 207 PPPPPPPLP---PPPPPPPPPSPPPPSPPPPPPPSPPPP 242 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P----PPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP P PPPPSP PPPP Sbjct: 215 PPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PP P PP PPPP P PPPP Sbjct: 220 PPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP----PSPYPPPP 297 P PPPPP P PPPSPP PS PP PPPP PSP PPPP Sbjct: 1173 PSPPPPPSP---PPPSPPPPPSPPPPSPPPPLPPPPSPPPPPP 1212 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP PP P PP PPPPSP PP P Sbjct: 2274 PPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSP 2312 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPPP P P PPP+PP SP PP PPP PP P PPPP Sbjct: 2267 PPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPP 2305 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P PPPSPP SP PP PP PP P PPPP Sbjct: 2670 PPPPPSPPPSPPPPSPPPSPPPSPP-PPSPPPPSPPPP 2706 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP SP P PP PP P PPPP Sbjct: 2698 PPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPP 2735 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPP P PPPSPP SP P PP PP P PPPP Sbjct: 2673 PPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPP 2711 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PPPPSP PP P Sbjct: 2677 PPSPPPPSPPPSPPPSPP--PPSPPPPSPPPPSPPPPSP 2713 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP-PSPYPPPP 297 PPP PPP P PPP P PS PP PPPP P P PPPP Sbjct: 2681 PPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPP 2720 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PP PPPP P PPPSPP PS PP PP PP P PPP Sbjct: 223 PPSPPPPSPPPPPPPSPP-PPSPPPPPPPSPPPPPPPP 259 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYP 288 PPPPPPP P PPPSPP P PP PPPPP P P Sbjct: 231 PPPPPPPSP---PPPSPPPPPPPSPPPPPPPPLPTP 263 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP PP P PPPSPP P PP PPPP P P PPPP Sbjct: 2272 PPPPSPPPP--TPPPSPPPPPPTPPPSPPPPSPPPPSPPPP 2310 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PP PPPP P PPP P PS PP PPP PP P PPPP Sbjct: 2705 PPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2745 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P P P PP P PP P PPPSP PPPP Sbjct: 2254 PPSPPPPSP-HPPSPPPPSPPPPSPPPPTPPPSPPPPPP 2291 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP-PSPYPPPP 297 PPP PPP P PPP P PS PP PPPP P P PPPP Sbjct: 2533 PPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPP 2572 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP PS PP PPP P P PPP Sbjct: 2542 PPSPPPPLP---PPPSPP-PPSPPPPSPPPSPPPPSPPP 2576 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP P PPPSP PP P Sbjct: 2545 PPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSP 2583 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PP PPPP P PPPSPP PS PP PPP PP P PPPP Sbjct: 2690 PPSPPPPSP---PPPSPP-PPSPPPPSPPPSPPPPSPPPP 2725 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPY-SPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP +P PP PPP P P PPPP Sbjct: 2264 PPSPPPPSP---PPPSPPPPTPPPSPPPPPPTPPPSPPPP 2300 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS---PSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PPPPSP P PP Sbjct: 2529 PPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPP 2570 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PP PP P PPPP Sbjct: 2693 PPPPSPPPPSPPPPSPPPPSPPPSPP-PPSPPPPSPPPP 2730 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PP PPPP P PPPSPP PS PP PPPP P P PPPP Sbjct: 2714 PPSPPPPSP---PPPSPP-PPSPPPPSPPPPSPPPPSPPPP 2750 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 2717 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 2755 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 2722 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 2760 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/40 (60%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP P PP P+ PP PPPPSP P PP Sbjct: 2742 PPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPP 2781 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP P PP PPPPSP P PP Sbjct: 2550 PPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPP 2588 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP P PP PP SP PP PPPPSP PP P Sbjct: 2668 PSPPPPPSP---PPSPPPPSPPPSPPPSPPPPSPPPPSP 2703 [12][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP SP PP PPPPP P PPPP Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPP 524 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPPSPP P PP PPPPP P PPP Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PP PPPPP P PPPP Sbjct: 505 PPPPPPPSP---PPPPPP------PPPPPPPPPPPPPPP 534 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPP PP P PP PPPPP P P P Sbjct: 501 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 [13][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PPPPPPP P PPP PP P PP P PPPPSP PPPP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPP 272 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPP PP PS PP PPPPP P PPPP Sbjct: 226 PPPPPPP-----PPPPPPPPPSPPPPPPPPPPPPPPPPP 259 [14][TOP] >UniRef100_O48567 Glycine-rich RNA-binding protein n=1 Tax=Euphorbia esula RepID=O48567_EUPES Length = 164 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/46 (63%), Positives = 32/46 (69%), Gaps = 3/46 (6%) Frame = -2 Query: 296 GGGGYGE---GGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGY GGGGGYGG R+ YGG GGGSRY GGG GNW++ Sbjct: 119 GGGGYNSRSSGGGGGYGGGRDQGYGGGGGGSRYSRGGGESDGNWKN 164 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/44 (68%), Positives = 30/44 (68%), Gaps = 5/44 (11%) Frame = -2 Query: 296 GGGGYGEGGGGGY---GGRREGEYGGDGGG--SRYGNGGGGGGG 180 GGGGY GGGGG GGRREG YGG GGG SR GGGG GG Sbjct: 93 GGGGYSRGGGGGGYGGGGRREGGYGGGGGGYNSRSSGGGGGYGG 136 [15][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP P PPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 396 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP SP PP PPPPP P PPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 398 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 364 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 369 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 [16][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP P PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP SP PP PPPPP P PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPP 264 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPPSPP SP PP PPPPP P PPPP Sbjct: 238 PPPPPPP-----PPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP P PP PPPPP P PPPP Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPP---PPPPPPPPPPPPPPP 301 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP P PP P PPPSPP SP PP PPP P P PPPP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPP 256 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PP P PP PPPPP PPPP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP P PP PPPP P PPPP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP PPPP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP---PPPP 302 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP 291 PPPPPPP P PPP PP P PP PPPPP P P Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = +1 Query: 172 LQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 L P PP PLP PPP PP SP PP PPPPP P PPP Sbjct: 212 LPLPNAPPSPLP-PSPPPPPPPSPPPSPPPPPPPPPPSPPP 251 [17][TOP] >UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis RepID=B9S5R2_RICCO Length = 210 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = +1 Query: 169 LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 ++Q PPPPPPP P PPPSPP PS PP PPPPPSP PPPP Sbjct: 39 IVQPPPPPPPPSP---PPPSPP-PPSPPPPPPPPPPSPSPPPP 77 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPP----SPYPPPP 297 PPPPPPP P PP SPP S PP PPPP SP PPPP Sbjct: 64 PPPPPPPSPSPPPPTSPPSSLLSPPPPSPPPPASSSSPPPPPP 106 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-----PPSPYPPPP 297 PP PPPP P PPP PP SPS PP PP PP P PPPP Sbjct: 53 PPSPPPPSP-PPPPPPPPPSPSPPPPTSPPSSLLSPPPPSPPPP 95 [18][TOP] >UniRef100_C5CSB2 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CSB2_VARPS Length = 181 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/43 (69%), Positives = 30/43 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGYGG G YGG GGG G GG GGGG RS Sbjct: 97 GGGGYGGGGGGGYGGGGGGGYGGGGGGRSGGGGGYGGGGGGRS 139 Score = 62.0 bits (149), Expect = 2e-08 Identities = 30/48 (62%), Positives = 31/48 (64%), Gaps = 5/48 (10%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYG-----GDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGYGG G G G GGG R G GGGGG G +RS Sbjct: 105 GGGGYGGGGGGGYGGGGGGRSGGGGGYGGGGGGRSGGGGGGGDGGFRS 152 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/43 (67%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGG--GGGGNW 174 GGGGYG GGGGGYGG G YGG GGG G GGG GGGG + Sbjct: 90 GGGGYG-GGGGGYGGGGGGGYGGGGGGGYGGGGGGRSGGGGGY 131 [19][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPPPP P PPPP Sbjct: 281 PPPPPPPSPPPPPPPSPP-PPSPPPPSPPPPPPPSPPPP 318 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP P PPPPSP PPPP Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPPP P PPPP Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 466 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 436 PPPPPPPSPPPPPPPSPPPPP---PPSPPPPPPPSPPPP 471 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP P PP PPPPPSP PPPP Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPP-PPPPPSPPPPPP 294 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPPPP P PPPP Sbjct: 307 PPPPPPPSP---PPPSPP-PPSPPPPSPPPPPPPSPPPP 341 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PPPPPSP PPPP Sbjct: 420 PPSPPPPSPPPPPPPSPPPPPPPSPP-PPPPPSPPPPPP 457 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP PS PP PPPPP P PPPP Sbjct: 229 PPSPPPPSPPPPPPPSPP-PPSPPPPSPPPPPPPSPPPP 266 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP PS PP PPPPP P PPPP Sbjct: 247 PPSPPPPSPPPPPPPSPP-PPSPPPPSPPPPPPPSPPPP 284 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP PS PP PPPPP P PPPP Sbjct: 348 PPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPPPPSPPPP 385 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP PS PP PPPPP P PPPP Sbjct: 462 PPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPPPPSPPPP 499 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PPPPP P P PPPSPP P PP P PPPPSP PPPP Sbjct: 239 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 278 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PP PP P PPPP Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPP-PPSPPPPSPPPP 367 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PP PP P PPPP Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPP-PPSPPPPSPPPP 411 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PP PP P PPPP Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPP-PPSPPPPSPPPP 481 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PP PP P PPPP Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPP-PPSPPPPSPPPP 525 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 265 PPSPPPPSPPPPPPPSPPPPP---PPSPPPPPPPSPPPP 300 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 322 PPSPPPPSPPPPPPPSPPPPP---PPSPPPPPPPSPPPP 357 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 366 PPSPPPPSPPPPPPPSPPPPP---PPSPPPPPPPSPPPP 401 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPP PP P PPPP Sbjct: 382 PPPPPPPSPPPPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 421 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 480 PPSPPPPSPPPPPPPSPPPPP---PPSPPPPPPPSPPPP 515 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPP PP P PPPP Sbjct: 496 PPPPPPPSPPPPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 535 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPPSP PPPP Sbjct: 315 PPPPSPPPPSPPPPSPPPPPPPSPP-PPPPPSPPPPPP 351 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPPSP PPPP Sbjct: 359 PPPPSPPPPSPPPPSPPPPPPPSPP-PPPPPSPPPPPP 395 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPPSP PPPP Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPP-PPPPPSPPPPPP 449 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPPSP PPPP Sbjct: 473 PPPPSPPPPSPPPPSPPPPPPPSPP-PPPPPSPPPPPP 509 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS----PSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP PS PP PPPPP P PPPP Sbjct: 506 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 548 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP PS PP PPPPP P PPPP Sbjct: 212 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPPPPSPPPP 248 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PP PP P PPPP Sbjct: 237 PPPPPPPSP---PPPSPP-PPSPPPPPPPSPPPPSPPPP 271 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PP PP P PPPP Sbjct: 289 PPPPPPPSP---PPPSPP-PPSPPPPPPPSPPPPSPPPP 323 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS----PSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPPP P PPPP Sbjct: 338 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 380 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP PS PP PPPPP P PPPP Sbjct: 403 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPPPPSPPPP 439 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS----PSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPPP P PPPP Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 494 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP SP PP PPPPSP PP P Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 307 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PPPPSP PPPP Sbjct: 299 PPSPPPPSPPPPPPPSPP--PPSPPPPSPPPPSPPPPPP 335 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP--YSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP P PP PPPPP P PPPP Sbjct: 309 PPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 349 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP SP PP PPPPSP PP P Sbjct: 326 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 364 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP SP PP PPPPSP PP P Sbjct: 370 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 408 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP SP PP PPPPSP PP P Sbjct: 484 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 522 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP P PPPPPSP PPPP Sbjct: 403 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 441 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PPPP P P PPPSPP P PP P PPPPSP PPPP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 260 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP P PP PP PP P PPPP Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPP-PPSPPPPSPPPP 328 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP----PSPYPPPP 297 PPPPP P P PPPSPP PS PP PPPP PSP PPPP Sbjct: 392 PPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPPPP 433 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP SP PP PPPP P PPP Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 462 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPSP PPPP Sbjct: 207 PPPPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPPP 242 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP PS PP PP PP P PPPP Sbjct: 217 PPPPSPPPPSPPPPSPP-PPSPPPPPPPSPPPPSPPPP 253 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP PS PP PP PP P PPPP Sbjct: 517 PPPPSPPPPSPPPPSPP-PPSPPPPPPPSPPPPSPPPP 553 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PP PP P PP P Sbjct: 255 PPPPPPPSP---PPPSPP-PPSPPPPPPPSPPPPPPPSP 289 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP P PPPPPSP PP P Sbjct: 212 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PPPPSP PP P Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP P PPPPPSP PP P Sbjct: 512 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 550 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PPPPSP PP P Sbjct: 517 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 555 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP P PP PS PP PPPP P PPPP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 261 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PP PP P PPPP Sbjct: 522 PPPPSPPPPSPPPPSPPPPPPPSPP-PPSPPPPSPPPP 558 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 192 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 230 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 197 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 235 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP SP PP PPPP P PPP Sbjct: 320 PPPPSPPPP--SPPPPPPPSPPPPPPPSPPPPPPPSPPP 356 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP SP PP PPPP P PPP Sbjct: 364 PPPPSPPPP--SPPPPPPPSPPPPPPPSPPPPPPPSPPP 400 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP SP PP PPPP P PPP Sbjct: 418 PPPPSPPPP--SPPPPPPPSPPPPPPPSPPPPPPPSPPP 454 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP SP PP PPPP P PPP Sbjct: 478 PPPPSPPPP--SPPPPPPPSPPPPPPPSPPPPPPPSPPP 514 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PPPP P PPP Sbjct: 354 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 392 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PPPP P PPP Sbjct: 408 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 446 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PPPP P PPP Sbjct: 468 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 506 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPP PP P PP P PPP P P PP Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 264 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPP PP P PP P PPP P P PP Sbjct: 245 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 282 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPP PP P PP P PPP PPPP Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPP 334 [20][TOP] >UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA Length = 688 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP +P +PP PPPPP P PPPP Sbjct: 202 PPPPPPPAPAPTPPPPPPPAPKPKPP-PPPPPKPKPPPP 239 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPS-RRPP*PPPPPSPYPPPP 297 PPPPPPP P +PPP PP P PP PPPPP+P P PP Sbjct: 214 PPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPP 253 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P+ +P P PPP+ PPP Sbjct: 226 PPPPPPPKPKPPPPPPPPPPPAPKPSPPTPPPTTPPPP 263 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/43 (55%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP----PPSPYPPPP 297 PPPPP P P PPP PP +P PP PPP PP+ PPPP Sbjct: 228 PPPPPKPKPPPPPPPPPPPAPKPSPPTPPPTTPPPPTAPPPPP 270 [21][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = +1 Query: 172 LQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 +Q PPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 230 VQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPP-PPPPPPPLPPPP 286 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P PP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP PPPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPP P PPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP P P PPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PP PP P PPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPP 284 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPP P PP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P P PPPPP P PPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 [22][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/41 (65%), Positives = 28/41 (68%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 + PPPPPPP P PPP PP PS PP PPPPP P PPPP Sbjct: 64 EHPPPPPPPPP---PPPQPPLPPSPSPPPPPPPPVPPPPPP 101 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P+ PP PPPPPSP PPP Sbjct: 117 PPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPP 154 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+P PPP PP P PP PPPPP P P PP Sbjct: 88 PPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPP 126 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP P PP PPPPPSP PPPP Sbjct: 92 PPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPP 130 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP P PPP Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPP 141 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP P PP PPPPP+P PPPP Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPP 144 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P PP Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPP 153 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P P PPPPP P PPPP Sbjct: 99 PPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPP 137 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP SP PP P PPPSP P PP Sbjct: 140 PPPPPPPPPSPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 177 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNP 139 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP RPP P PPPSP P PP Sbjct: 164 PPPSPPPSPPPSPPPSPPPSPPPRPP-PSPPPSPPPSPP 201 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP RPP P PPSP PP P Sbjct: 184 PPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSP 222 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPPSPP P PP PP PP P PPPP Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPP 133 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P P PSPP P PP PPPPP P PPPP Sbjct: 71 PPPPPPPQPPLPPSPSPPPPPP--PPVPPPPPPPPPPPP 107 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PP PP P PPPP Sbjct: 112 PPPPPPPPP---PPPSPPPPPPPPPPPPPNPPPPPPPPP 147 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP P PPPSP P PP Sbjct: 128 PPPPPPPPPPNPPPPPPPPPPSPSPP-PSPPPSPPPSPP 165 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP SP PP PPPPP PPPP Sbjct: 91 PPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PP SP PP PPPPP PPPP Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*RE--PPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PPLP PPP PP P PP PPPPP P PPPP Sbjct: 74 PPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPP 114 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP SP PP P PPPSP P PP Sbjct: 144 PPPPPSPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 181 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP PP P Sbjct: 180 PPPSPPPRPPPSPPPSPPPSPPPSPP-PRPPPSPNPPSP 217 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 152 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPRPP 189 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 160 PPPSPPPSPPPSPPPSPPPSPPPSPP-PRPPPSPPPSPP 197 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 114 PPPPPPPPPPSPPPPPPPPPPP--PPNPPPPPPPPPPSP 150 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP+PP P PP P PPPSP P PP Sbjct: 126 PPPPPPPPP---PPPNPPPPPPPPPPSPSPPPSPPPSPP 161 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 4/42 (9%) Frame = +1 Query: 184 PPPPPPLP*REPPPSP----PYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P R PPPSP P PS PP PPPPPSP P PP Sbjct: 331 PPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPP 372 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP PP PPP P P PPP Sbjct: 156 PPPSPPPSPPPSPPPSPPPSP---PPSPPPSPPPRPPP 190 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP PP PPP P P PPP Sbjct: 176 PPPSPPPSPPPRPPPSPPPSP---PPSPPPSPPPRPPP 210 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPP---PPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 145 PPPPSPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 185 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRP-P*PPPPPSPYPPPP 297 PPPPPPP P PPP PP SPS P P P PPPSP P PP Sbjct: 131 PPPPPPPNP-PPPPPPPPPSPSPPPSPPPSPPPSPPPSPP 169 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYP---PPP 297 PPPPPPP P PPP PP P P PPPPP P P PPP Sbjct: 113 PPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPP 154 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP P PP PPPPSP PP P Sbjct: 258 PPSPPPPLP---PPPSPP--PPLPPPPSPPPPSPPPPSP 291 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP P PP PPP P PPP Sbjct: 168 PPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPP 206 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*--REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PLP R P PSPP +P RPP PP PP P PPPP Sbjct: 286 PPPPSPLPPSPRPPKPSPPNNPFPRPP-PPNPPPPRPPPP 324 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP SP PP PPP P PPP Sbjct: 172 PPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPP 210 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/58 (48%), Positives = 29/58 (50%), Gaps = 19/58 (32%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPS------------------RRPP*PPP-PPSPYPPPP 297 PPP PPP P PPP PP SP+ RRPP PPP PP P PPPP Sbjct: 192 PPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPP 249 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P R PPPSPP P PP PPPP P P PPPP Sbjct: 246 PPPPAPPPPRPPPPSPP-PPLPPPPSPPPPLPPPPSPPPP 284 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP P PS RPP P PP +P+P PP Sbjct: 276 PPPPSPPPP--SPPPPSPLPPSPRPPKPSPPNNPFPRPP 312 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 5/43 (11%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYS----PSRRPP*PPPP-PSPYPPPP 297 PPPP P P R PPPSPP PS PP PPPP PSP PPP Sbjct: 321 PPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPP 363 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = +1 Query: 178 FPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 FPPP PPP R PPP+PP P R PP PPPP P PP P Sbjct: 236 FPPPSPPPP--RPPPPAPP--PPRPPPPSPPPPLPPPPSP 271 [23][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P RPP PPPPPSP PP P Sbjct: 260 PPPPPPPSPPPPPPPSPPPPPPPRPP-PPPPPSPPPPSP 297 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P R PPPSPP PS PP PPPPP P PPPP Sbjct: 377 PPSPPPPPPPRPPPPSPP-PPSPPPPSPPPPPPPSPPPP 414 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP--YSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P R PPPSPP P PP PPPPPSP PPPP Sbjct: 309 PPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPP 349 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP PS PP PPPPP P PPPP Sbjct: 286 PPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPPPPRPPPP 323 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP PS PP PP PP P PPPP Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPP 360 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS----PSRRPP*PPPPPSPYPPPP 297 PP PPPP P R PPPSPP PS PP PPPPP P PPPP Sbjct: 341 PPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 383 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P------PPPPSPYPPPP 297 PP PPPP P PPPSPP P RPP P PPPPSP PPPP Sbjct: 364 PPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPP 408 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 252 PPSPPPPSPPPPPPPSPPPPPPPSPP-PPPPPRPPPPPP 289 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PPPP P P PPPSPP P RPP P PPPPSP PPPP Sbjct: 297 PPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPP 335 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P RPP PP PP P PPPP Sbjct: 330 PPPPPPPSP--PPPPSPPPPPPPRPP-PPSPPPPSPPPP 365 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P RPP PP PP P PPPP Sbjct: 395 PPSPPPPSPPPPPPPSPPPPPPPRPP-PPSPPPPSPPPP 432 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPPSP PPPP Sbjct: 245 PPPPSPPPPSPPPPSPPPPPPPSPP-PPPPPSPPPPPP 281 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P------PPPPSPYPPPP 297 PP PPPP P R PPP PP P PP P PPPPSP PPPP Sbjct: 273 PPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 317 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPP P PPPP Sbjct: 372 PPPPPPPSPPPPPPPRPP-PPSPPPPSPPPPSPPPPPPP 409 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP PS PP PPPPP P PPPP Sbjct: 235 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPPPPSPPPP 271 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS----PSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPPP P PPPP Sbjct: 276 PPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 318 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PP PP P PPPP Sbjct: 268 PPPPPPPSPPPPPPPRPPPPPPPSPP-PPSPPPPSPPPP 305 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP P PPPPPSP PPPP Sbjct: 235 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 273 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PP---PPPSPYPPPP 297 PPPPP P P PPPSPP P PP PP PPP P PPPP Sbjct: 314 PPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPP 355 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPP P PPPP Sbjct: 357 PPPPSPPPPSPPPPSPPPPP---PPSPPPPPPPRPPPP 391 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP SP PP PPPP P PPP Sbjct: 256 PPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPP 294 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPP P P PP Sbjct: 403 PPPPPPPSPPPPPPPRPP-PPSPPPPSPPPPSPPPPSPP 440 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPSP PPPP Sbjct: 230 PPPPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPPP 265 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP P PP PPPP P P PPPP Sbjct: 388 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPP 427 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP SP PP PPPPSP PP P Sbjct: 362 PPPPSPPPP--SPPPPPPPSPPPPPPPRPPPPSPPPPSP 398 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP SP PP PPPPSP PP P Sbjct: 393 PPPPSPPPP--SPPPPPPPSPPPPPPPRPPPPSPPPPSP 429 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PPPPSP PP P Sbjct: 292 PPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSP 330 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 190 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 228 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 195 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 233 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 200 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 238 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 205 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 243 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 210 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 248 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 215 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 253 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 220 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 258 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP SP PP PPPP P PPP Sbjct: 250 PPPPSPPPP--SPPPPPPPSPPPPPPPSPPPPPPPRPPP 286 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PPPP P PPP Sbjct: 240 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 278 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPP PP P PP P PPP P P PP Sbjct: 302 PPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPP 339 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PPPP P PPP Sbjct: 352 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPP 390 [24][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/43 (55%), Positives = 27/43 (62%) Frame = +1 Query: 169 LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 +++ PPP PP P PPP PP P PP PPPPP P PPPP Sbjct: 51 VIELPPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 [25][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = +1 Query: 169 LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 LL PPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 22 LLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 99 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 100 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 101 [26][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/41 (65%), Positives = 27/41 (65%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 Q PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 320 QPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPP 367 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPP 367 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P P P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQP 369 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP P P P PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPP 372 [27][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 71 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 58 PPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 109 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPP 82 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P RP PPPPP P PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPP 80 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P R P PPPPP P PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPP 81 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P R PP PP P PP PPPPP P PPPP Sbjct: 55 PPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 56 PPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PP P PP PPPPP P PPPP Sbjct: 60 PPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P P PP PPPPP P PPPP Sbjct: 49 PPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPP 87 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPP 69 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP P P PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPP 73 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P P PPPPP P PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPP 79 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P P PP PPPPP P PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPP 86 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P P P PP P PP PPPPP P PPPP Sbjct: 52 PPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P P P PP P PP PPPPP P PPPP Sbjct: 54 PPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPP 107 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP P PPP P PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPP 77 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P P PP PPPPP P PPPP Sbjct: 50 PPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPP 88 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPP P P PPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPP 110 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P RP PPPP P PPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPP 117 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYP---PPP 297 PPPPPP P PPP PP P PP PPPPP P P PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPP 108 [28][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/42 (66%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P---PPPPSPYPPPP 297 PPPP PP P EPPPSPP P+ PP P PPPPSP PPPP Sbjct: 1185 PPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPPP 1226 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPPSPP PS PP PP PP P PPPP Sbjct: 1150 PPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPRPPPP 1187 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPP PP P PP PPPPPSP PPPP Sbjct: 1138 PPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPSPMPPPP 1176 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PPPP PP P EPPPSPP PS PP P PPPSP PPPP Sbjct: 1116 PPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPP 1155 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP PP PPPPP+P PPPP Sbjct: 1174 PPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPP 1212 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP PP PPPPPSP PP P Sbjct: 1105 PPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTP 1143 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P P P PP PS PP PP PP P PPPP Sbjct: 1080 PPPPSPPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPP 1118 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P R PP P PPP + PPP Sbjct: 1094 PPPPPPPSPPPPPPPSPP--PPRPPPPPSPPPPVHEPPP 1130 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PP PP P PPPSPP P PP P PPP P PPPP Sbjct: 1086 PSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPP 1124 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP 291 PPP PPP P P P PP PS PP PPPPPSP PP Sbjct: 1157 PPPSPPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPP 1193 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRP-P*PPPPPSPYPPPP 297 PPP PP P PPPSPP SP P P PPPPPSP PP P Sbjct: 1146 PPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPRP 1184 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP P PPPSPP P R PP P PPP + PPP Sbjct: 1163 PSPPPPPSPMPPPPPSPP--PPRPPPPPSPPPPVHEPPP 1199 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPY-SPSRRPP*PPPP-PSPYPPPP 297 PPP P P P PPPSPP SP PP PPPP PSP PPPP Sbjct: 1217 PPPSPMPPPPSPPPPSPPPPSPMPPPPSPPPPIPSPPPPPP 1257 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = +1 Query: 175 QFPPPPPPPLP*RE----PPPSPPYSPSRRPP*PPPPPSPYPPPP 297 +FP PP + R PPPSPP PS P PPPPPSP PPPP Sbjct: 1063 RFPAPPAAAMDNRPCEKPPPPSPPSPPSPPSPPPPPPPSPPPPPP 1107 [29][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/43 (62%), Positives = 28/43 (65%) Frame = +1 Query: 169 LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 +L PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 69 ILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVP 117 [30][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/38 (76%), Positives = 29/38 (76%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGGYG GGGGGYGG G YGG GGG YG GGGGGG Sbjct: 134 GGGGYGGGGGGGYGGGGGGGYGGGGGGG-YGGGGGGGG 170 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G YGG GGG YG GGGGG G Sbjct: 126 GGGGYGGGGGGGYGGGGGGGYGGGGGGG-YGGGGGGGYG 163 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G YGG GGG YG GGGGG G Sbjct: 119 GGGGYG-GGGGGYGGGGGGGYGGGGGGG-YGGGGGGGYG 155 [31][TOP] >UniRef100_Q43472 Low temperature-responsive RNA-binding protein n=1 Tax=Hordeum vulgare RepID=Q43472_HORVU Length = 161 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/54 (62%), Positives = 34/54 (62%), Gaps = 12/54 (22%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGG----DGGGSRYGNGGGG--------GGGNWR 171 GGGGYG GGGGGYGG R G GG DGGG YG GGGG GGGNWR Sbjct: 108 GGGGYG-GGGGGYGGGRSGGGGGYGSRDGGGGGYGGGGGGYGGSRGGSGGGNWR 160 [32][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 152 PPPPPPPSP--PPPPSPPPPPPPSPPPPPPPPPPPPPPP 188 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PP SP PP PPPPP P PPPP Sbjct: 154 PPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 192 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 3/41 (7%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PP---PPPSPYPPPP 297 PPPPPP P PPPSPP PS PP PP PPPSP PPPP Sbjct: 131 PPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPP 171 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP P PPPSPP PS PP PP PP P PPPP Sbjct: 144 PSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPP 182 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP P PP PPPPP P PPPP Sbjct: 155 PPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 193 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 166 PPPPPPPSP---PPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP P PP PPPPP P PPPP Sbjct: 162 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PP SP PP PPPPP P PPPP Sbjct: 140 PPPPPSPPPPPSPPPPPPPSPPP-PPSPPPPPPPSPPPP 177 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PP PP P PP P Sbjct: 138 PPPPPPPSP--PPPPSPPPPPPPSPPPPPSPPPPPPPSP 174 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +1 Query: 187 PPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P PPP PP P PP PPPPPSP PPPP Sbjct: 122 PPPPPEP-ECPPPPPPSPPPPPPPSPPPPPSPPPPPP 157 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPP----PPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP PP P PPP PP SP P PPPPP PPPP Sbjct: 122 PPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPP 164 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PPPPP PPPP Sbjct: 167 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP---PPPP 202 [33][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP PPPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPP 969 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPP +P PPPP Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPP 970 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP PPPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP PP PPPP Sbjct: 941 PPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPP 981 [34][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [35][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPP--PPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PPP P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPHCPPPPP---PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 [36][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQP 46 [37][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPP--PPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PPP P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPHCPPPPP---PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 [38][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/48 (60%), Positives = 29/48 (60%), Gaps = 9/48 (18%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP---------YSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPPPPSPYPP P Sbjct: 433 PPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSP 480 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPSP PS +PP PPPPPSPYPP P Sbjct: 287 PPPPPSPEPPSPKPPSPE-PPSPQPPLPPPPPSPYPPSP 324 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P--PPPPSPYPPPP 297 PP PPPP P PPP PY PS PP P PPPPSPYPP P Sbjct: 461 PPSPPPPPP---PPPPSPYPPSPAPPLPPSPPPPSPYPPSP 498 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P--PPPPSPYPPPP 297 PP P PPLP PPP PY PS PP P PPPPSPYPP P Sbjct: 378 PPSPQPPLP---PPPPSPYPPSPAPPVPPSPPPPSPYPPSP 415 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = +1 Query: 178 FPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 +PP P PP+P PPPSP Y PS PP PP PP P PPPP Sbjct: 393 YPPSPAPPVPPSPPPPSP-YPPSPAPPAPPSPPPPPPPPP 431 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P P P+PP PS PP PPPPP P PPPP Sbjct: 402 PPSPPPPSP-YPPSPAPPAPPSPPPPPPPPPPPPPPPPP 439 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 9/47 (19%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPP---------PPSPYPPPP 297 PPPPPP P PPP PP+ P PP PPP PPSP PPPP Sbjct: 423 PPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPP 469 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = +1 Query: 178 FPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 +PP P PP P PPP PP P PP PPPP P+PPPP Sbjct: 411 YPPSPAPPAPPSPPPPPPPPPP---PPPPPPPFPPFPPPP 447 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSP-------PYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPSP P PS PP PPPPPSP PP P Sbjct: 232 PPSPPPPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSP 277 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P----PPPPSPYPPPP 297 PP P PPLP PPP PY PS PP P PPPPSP PP P Sbjct: 305 PPSPQPPLP---PPPPSPYPPSPSPPSPPPPSPPPPSPAPPSP 344 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPPPPPL---P*REPPPSP----PYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSP P PS PP PPPPPSP PP P Sbjct: 253 PPGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSP 298 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = +1 Query: 178 FPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 +PP P PPLP PPPS PY PS PP PP P P P PP Sbjct: 476 YPPSPAPPLPPSPPPPS-PYPPSPAPPVPPSPAPPSPEPP 514 [39][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 [40][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 [41][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPY 285 PPPPPPP P PPP PP P PP PPPPPS + Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTH 532 [42][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEP 102 [43][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [44][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 [45][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [46][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [47][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPY 285 PPPPPPP P PPP PP P PP PPPPP P+ Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 41 [48][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 [49][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [50][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTP 47 [51][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [52][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPY 285 PPPPPPP P PPP PP P PP PPPPP P+ Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 58 [53][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP PS PP PPPPP P PPPP Sbjct: 21 PPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP P PPP PP SP PP PPPPP P PP P Sbjct: 5 PSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PP PP PS PP PPPP P PPPP Sbjct: 48 PPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPP 86 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPP PSP PPPP Sbjct: 72 PPPPPPPSPPPPPPPSPP-PPLPSPPPPPPLPSPPPPPP 109 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP P PP P PPPP Sbjct: 190 PPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPP 228 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPPSPP SP P PPPPPSP PPPP Sbjct: 25 PPPPPPSPPPPPPPSPP-SPLPPSPPPPPPPSPPPPPP 61 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REP-PPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP P PP PP P PP PPPPP P PPPP Sbjct: 162 PPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPP 201 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPP-SPYPPPP 297 PPPPPPLP PPP P SP PP PPPPP SP PPPP Sbjct: 95 PPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPP 133 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP----YSPSRRPP*PPPPPSPYPPPP 297 P PPPPPL PPPSPP SP PP PPPPP P PPPP Sbjct: 119 PSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPP 161 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP+ PP PPPPPSP PPPP Sbjct: 166 PPPLPPPSPLPPPPPSPPHPLPPSPP-PPPPPSPPPPPP 203 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = +1 Query: 172 LQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 L PP P PP P PPP PP SP PP PPPPSP PPPP Sbjct: 211 LPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPPPPP 252 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPPPPP P PPPSPP P PP PPP PPSP PP P Sbjct: 9 PPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSP 48 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPP--PPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PPP P PPP PP SP PP PPPP P PPPP Sbjct: 58 PPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPP 98 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = +1 Query: 181 PPPPP---PPLP*REPPPSPPYSPSRRPP*PP---PPPSPYPPPP 297 PPPPP PP P PPP PP SP PP PP PPPSP PPPP Sbjct: 135 PPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPP 179 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPPLP P PSPP P PP PPPPPSP PPPP Sbjct: 204 PSPPPPPLP-SPPAPSPPSPP--LPPPPPPPPSPPPPPP 239 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP P PP PPPPP P PPPP Sbjct: 131 PPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPP-PSPPPP 168 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PP PLP PPP PP P PP PPPPP P PP P Sbjct: 179 PPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAP 217 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPP----PLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP PLP PPP PP P P PPPPPS PPPP Sbjct: 33 PPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPP 75 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPSPP P PP PPPPP PPPP Sbjct: 32 PPPPPPPSPPSPLPPSPPPPP---PPSPPPPPPSQPPPP 67 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 5/43 (11%) Frame = +1 Query: 184 PPPPPPLP*REPPPSP-----PYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPLP PPP P P SP PP PPPPP PPPP Sbjct: 104 PPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPP 146 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P P PSPP PP PPPPP P PPP Sbjct: 198 PPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPP 236 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP P PP P PPPP Sbjct: 17 PPPPPPPSP-PPPPPSPPPPPPPSPPSPLPPSPPPPPPP 54 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Frame = +1 Query: 175 QFPPPP----PPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 Q PPPP PPP P PPP PP P P PPPPP P PPPP Sbjct: 63 QPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPP 107 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*-PPPPPSPYPPPP 297 PPPPP P P PPSPP P PP PPPPP P PPPP Sbjct: 206 PPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPP 245 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +1 Query: 187 PPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P PPP PP SP PP PPPP P PPPP Sbjct: 1 PPPPPSP--PPPPPPPSSPPPPPPPSPPPPPPSPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/50 (54%), Positives = 28/50 (56%), Gaps = 11/50 (22%) Frame = +1 Query: 181 PPPPP------PPLP*REPPPSPPYSPSRRPP*PP-----PPPSPYPPPP 297 PPPPP PP P PPPSPP P +PP PP PPP P PPPP Sbjct: 34 PPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPP 83 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSP-SRRPP*PPPPPSPYPPP 294 PPPPPP P PPPSPP P S PP PPP P P PPP Sbjct: 143 PPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPP 180 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPP P P PP SPP P PP PPP P P PPP Sbjct: 1 PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPP 38 [54][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 [55][TOP] >UniRef100_Q08I87 Putative glycine-rich RNA-binding protein n=1 Tax=Dianthus caryophyllus RepID=Q08I87_DIACA Length = 163 Score = 63.9 bits (154), Expect = 5e-09 Identities = 31/48 (64%), Positives = 32/48 (66%), Gaps = 5/48 (10%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGG-----GGNWRS 168 GGGGYG G GGGYGGRREG GGG YG GGGGG GNWR+ Sbjct: 121 GGGGYGGGSGGGYGGRREG-----GGGGGYGGGGGGGYRGNSDGNWRN 163 [56][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 93 PPPPPPPPPPSPPPPSPP--PPSPPPPPPPPPPPSPPPP 129 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/52 (53%), Positives = 31/52 (59%) Frame = +1 Query: 142 KP*GKQTI*LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 KP G +T+ + PPPPPPP P P P PP P PP PPPPP P PPP Sbjct: 78 KPVGDRTL-PNKVPPPPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPP 128 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP 291 PPPPP P P PPPSPP P PP PPPPSP PP Sbjct: 98 PPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPPSPPPP 134 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PP PP P PPPP Sbjct: 101 PPSPPPPSP---PPPSPP--PPPPPPPPPSPPPPSPPPP 134 [57][TOP] >UniRef100_Q6RY61 Glycine-rich RNA-binding protein RGP-1c (Fragment) n=1 Tax=Nicotiana sylvestris RepID=Q6RY61_NICSY Length = 136 Score = 63.5 bits (153), Expect = 7e-09 Identities = 37/67 (55%), Positives = 38/67 (56%), Gaps = 24/67 (35%) Frame = -2 Query: 296 GGGGYG----EGGGGGYGG-------RREGEYGGDG-----------GGSRYGNGGGGGG 183 GGGGYG EGGGGGYGG RREG YGG G GGSRY GGGGG Sbjct: 70 GGGGYGGGRREGGGGGYGGGGGYGGGRREGGYGGGGGGYGGGDRYNDGGSRYSRGGGGGA 129 Query: 182 --GNWRS 168 GNWR+ Sbjct: 130 SDGNWRN 136 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGGYGG R GG GGG R G GGG GGG Sbjct: 51 GGGGGGRGGGGGYGGGRREGGGGYGGGRREGGGGGYGGG 89 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/49 (63%), Positives = 31/49 (63%), Gaps = 10/49 (20%) Frame = -2 Query: 296 GGGGYG----EGGGGGYGGRREGEYGGDGGGSRYGNG------GGGGGG 180 GGGGYG EGGGG GGRREG GG GGG YG G GGGGGG Sbjct: 59 GGGGYGGGRREGGGGYGGGRREGGGGGYGGGGGYGGGRREGGYGGGGGG 107 [58][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P P PPPPP P+PPPP Sbjct: 2051 PPPPPPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPP 2089 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPPPPPLP*REPPPS-------PPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP SPS PP PPPPPSP PPPP Sbjct: 2087 PPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPPP 2132 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP----PSPYPPPP 297 PPPPP PLP PPP PP +PS PP PPPP PSP PPPP Sbjct: 2055 PPPPPAPLP-PPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPP 2096 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP PS PP P PPP+P PPPP Sbjct: 2109 PPPPSPSP---PPPSPPPPPSPPPPPPSPPPAPLPPPP 2143 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS---PSRRPP*PPPPPSPYPPPP 297 PPP PPPLP P PSPP P PP PPPPP+P PPPP Sbjct: 2025 PPPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPP 2066 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP PPP Sbjct: 2130 PPPSPPPAPLPPPPPSPPPSP---PPPPSPPPSPPAPPP 2165 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSP-PYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP+P P P PP PPPPPSP P PP Sbjct: 2122 PPPPSPPPPPPSPPPAPLPPPPPSPPPSPPPPPSPPPSPP 2161 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPLP P PSPP P PP PPPP P PPPP Sbjct: 2063 PPPPPPLPPPAPSPSPPPPP---PPWPPPPSPPPPPPP 2097 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS-PSRRPP*PPPPPSPYPPPP 297 PPP PPPL PPP PP P PP PPP PSP PPPP Sbjct: 2042 PPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPPP 2081 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PP P PP P PPPSPP P PP P PPP P PPP Sbjct: 2111 PPSPSPPPPSPPPPPSPPPPPPSPPPAPLPPPPPSPPP 2148 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPPPP P P PPPSPP SP PP PPP PP+P PP Sbjct: 2140 PPPPPSPPPSPPPPPSPPPSPPAPPPHPPPEPPAPPSFPP 2179 [59][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPPPP P P PP Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPP PP PS PP PPPPP P PPPP Sbjct: 261 PPPPPPP-----PPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP PP P PP PPPP P PPPP Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP P P P PPP PP P PP PPPPP P PPPP Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P SP R+PP P PP P P PP Sbjct: 279 PPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPP 317 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPP P PP PP SPS PP PPPPP P PPPP Sbjct: 241 PPSPPPSP--RPPSPPPPSPSPPPPPPPPPPPPPPPPP 276 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSP-PYSPSRRPP*PPPPPSPYPPPP 297 P PPP P P PPPSP P P PP PPPPP P PPPP Sbjct: 242 PSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPP 281 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP--PP 297 PPPPPPP P PPP PP PP PPPPPSP PP PP Sbjct: 270 PPPPPPPSPPPPPPPPPP------PPPPPPPPSPSPPRKPP 304 [60][TOP] >UniRef100_Q6ASX7 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ASX7_ORYSJ Length = 162 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/56 (58%), Positives = 34/56 (60%), Gaps = 13/56 (23%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDG-------------GGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGY GRREG YGG G GGSR G GG GGNWR+ Sbjct: 108 GGGGYGGGGGGGY-GRREGGYGGGGGYGGGRGGGGGGYGGSRGGGYGGDSGGNWRN 162 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGG------SRYGNGGGGGGG 180 GGGGYG GGGG GGR G YGG GGG YG GGG GGG Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGG 136 [61][TOP] >UniRef100_Q10FE5 Retrotransposon protein, putative, Ty1-copia subclass, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q10FE5_ORYSJ Length = 153 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/56 (58%), Positives = 34/56 (60%), Gaps = 13/56 (23%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDG-------------GGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGY GRREG YGG G GGSR G GG GGNWR+ Sbjct: 99 GGGGYGGGGGGGY-GRREGGYGGGGGYGGGRGGGGGGYGGSRGGGYGGDSGGNWRN 153 [62][TOP] >UniRef100_Q0KIW2 Glycine-rich RNA-binding protein n=1 Tax=Triticum aestivum RepID=Q0KIW2_WHEAT Length = 163 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/52 (57%), Positives = 31/52 (59%), Gaps = 10/52 (19%) Frame = -2 Query: 296 GGGGYG----------EGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWR 171 GGGGYG GGGGGYG R G YGG GGG G+ GG GGGNWR Sbjct: 111 GGGGYGGGGGGYRGGRSGGGGGYGSRDGGGYGGGGGGGYGGSRGGSGGGNWR 162 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/43 (65%), Positives = 30/43 (69%), Gaps = 5/43 (11%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRRE-----GEYGGDGGGSRYGNGGGGGG 183 GGGG+G GGGGGYGG+R G YGG GGG R G GGGGG Sbjct: 91 GGGGFG-GGGGGYGGQRREGGGGGGYGGGGGGYRGGRSGGGGG 132 [63][TOP] >UniRef100_O22384 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22384_ORYSA Length = 162 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/56 (58%), Positives = 34/56 (60%), Gaps = 13/56 (23%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDG-------------GGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGY GRREG YGG G GGSR G GG GGNWR+ Sbjct: 108 GGGGYGGGGGGGY-GRREGGYGGGGGYGGGRGGGGGGYGGSRGGGYGGDSGGNWRN 162 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGG------SRYGNGGGGGGG 180 GGGGYG GGGG GGR G YGG GGG YG GGG GGG Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGG 136 [64][TOP] >UniRef100_B4NCX9 GK10119 n=1 Tax=Drosophila willistoni RepID=B4NCX9_DROWI Length = 201 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGG+G GGGGG+GG G YG GGG YG+GGGGGG Sbjct: 45 GGGGWGGGGGGGWGGGGGGNYGHGGGGGNYGHGGGGGG 82 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGG 186 GGGG+G GGGGG+GG G +GG GGG YG+GGGGG Sbjct: 37 GGGGWGGGGGGGWGGGGGGGWGG-GGGGNYGHGGGGG 72 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -2 Query: 296 GGGGYGEGGGGGY-GGRREGEYGGDGGGSRYGNGGGGGG 183 GGG +G GGGGGY GG G Y G GGG +G GGGGGG Sbjct: 101 GGGHHGGGGGGGYHGGGGGGGYPGGGGGGYHGGGGGGGG 139 [65][TOP] >UniRef100_UPI0000ECAE31 Heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0). n=2 Tax=Gallus gallus RepID=UPI0000ECAE31 Length = 328 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/61 (50%), Positives = 31/61 (50%), Gaps = 22/61 (36%) Frame = -2 Query: 290 GGYGEGGGGGYGGRREGEYGGDGGGSRYGN----------------------GGGGGGGN 177 GGYG GGGGGYGG G YGG GGG YGN GGGGGGGN Sbjct: 245 GGYGGGGGGGYGGYGGGSYGGGGGGGDYGNGYGGFGSYSQHQSSYGPMKSGGGGGGGGGN 304 Query: 176 W 174 W Sbjct: 305 W 305 [66][TOP] >UniRef100_Q9MBF3 Glycine-rich RNA-binding protein n=1 Tax=Citrus unshiu RepID=Q9MBF3_CITUN Length = 167 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/53 (58%), Positives = 33/53 (62%), Gaps = 10/53 (18%) Frame = -2 Query: 296 GGGGYGE-----GGGGGYGGRREGEYGGDG-----GGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGYGGRREG Y DG GGSRY G GG+WR+ Sbjct: 115 GGGGYGGSRGYGGGGGGYGGRREGGYSRDGGYGGDGGSRYSRSGASDGGSWRN 167 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/42 (71%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = -2 Query: 296 GGGGYGEGGGGGY--GGRREGEYGGDGGGSR-YGNGGGGGGG 180 GGGGYG GGGGY GGRRE GG GGSR YG GGGG GG Sbjct: 93 GGGGYGSRGGGGYGGGGRRESGGGGGYGGSRGYGGGGGGYGG 134 [67][TOP] >UniRef100_Q8RW11 Putative glycine rich protein n=1 Tax=Rumex obtusifolius RepID=Q8RW11_RUMOB Length = 168 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGY GGGGGYGGRREG Y GGG YG GGGG GG Sbjct: 91 GGGGYRGGGGGGYGGRREGGYNRGGGGG-YGGGGGGYGG 128 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGGG GGRREG YGG GGG RY G +WR+ Sbjct: 129 GGGGYGGGGGGYGGGRREGGYGG-GGGDRYAR--GNSDSDWRN 168 [68][TOP] >UniRef100_Q40427 RNA-binding glycine-rich protein-1b n=1 Tax=Nicotiana sylvestris RepID=Q40427_NICSY Length = 148 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGGYG GGGG GGRREG GG GGG R G GGG GGG + Sbjct: 102 GGGGYGGGGGGYGGGRREGGGGGYGGGRREGGGGGYGGGGY 142 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = -2 Query: 296 GGGGYG----EGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGGYG EGGGGGYGG R +GGG YG GG GGGG + Sbjct: 109 GGGGYGGGRREGGGGGYGGGRR-----EGGGGGYGGGGYGGGGRY 148 [69][TOP] >UniRef100_O22653 Glycine-rich RNA-binding protein n=1 Tax=Euphorbia esula RepID=O22653_EUPES Length = 165 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 3/46 (6%) Frame = -2 Query: 296 GGGGYGE---GGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGY GG GGYGG R+ YG GGGSRY GGG GNWR+ Sbjct: 120 GGGGYNSISTGGSGGYGGGRDQGYGSGGGGSRYSTGGGESDGNWRN 165 [70][TOP] >UniRef100_C0PEX7 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PEX7_MAIZE Length = 98 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/57 (57%), Positives = 33/57 (57%), Gaps = 15/57 (26%) Frame = -2 Query: 296 GGGGYGEG-------GGGGYGGRREGEYGGDGGGSRYGNG--------GGGGGGNWR 171 GGGGYG G GGGGYGGRREG GG GGG YG GGGGGG WR Sbjct: 41 GGGGYGGGRRDGGYGGGGGYGGRREGGGGGYGGGGGYGGRREGGGGGYGGGGGGGWR 97 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/44 (70%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = -2 Query: 296 GGGGYG--EGGGGGYGG-RREGEYGGDG--GGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG RR+G YGG G GG R G GGG GGG Sbjct: 31 GGGGYGGGRGGGGGYGGGRRDGGYGGGGGYGGRREGGGGGYGGG 74 [71][TOP] >UniRef100_B6U1V8 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6U1V8_MAIZE Length = 156 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/56 (58%), Positives = 33/56 (58%), Gaps = 14/56 (25%) Frame = -2 Query: 296 GGGGYGEG-------GGGGYGGRREGEYGGDGGGSRY-------GNGGGGGGGNWR 171 GGGGYG G GGGGYGGRREG GG GGG Y G G GGGGG WR Sbjct: 100 GGGGYGGGRRDGGYGGGGGYGGRREGGGGGYGGGGGYGGRREGGGGGYGGGGGGWR 155 [72][TOP] >UniRef100_B4FFJ9 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FFJ9_MAIZE Length = 234 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/57 (57%), Positives = 33/57 (57%), Gaps = 15/57 (26%) Frame = -2 Query: 296 GGGGYGEG-------GGGGYGGRREGEYGGDGGGSRYGNG--------GGGGGGNWR 171 GGGGYG G GGGGYGGRREG GG GGG YG GGGGGG WR Sbjct: 177 GGGGYGGGRRDGGYGGGGGYGGRREGGGGGYGGGGGYGGRREGGGGGYGGGGGGGWR 233 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/44 (70%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = -2 Query: 296 GGGGYG--EGGGGGYGG-RREGEYGGDG--GGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG RR+G YGG G GG R G GGG GGG Sbjct: 167 GGGGYGGGRGGGGGYGGGRRDGGYGGGGGYGGRREGGGGGYGGG 210 [73][TOP] >UniRef100_P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein n=2 Tax=Zea mays RepID=GRPA_MAIZE Length = 157 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/56 (58%), Positives = 33/56 (58%), Gaps = 14/56 (25%) Frame = -2 Query: 296 GGGGYGEG-------GGGGYGGRREGEYGGDGGGSRY-------GNGGGGGGGNWR 171 GGGGYG G GGGGYGGRREG GG GGG Y G G GGGGG WR Sbjct: 101 GGGGYGGGRRDGGYGGGGGYGGRREGGGGGYGGGGGYGGRREGGGGGYGGGGGGWR 156 [74][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 272 PPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPP 310 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P P PPPPP P PPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPP 300 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PP PP P PPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPP 303 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P P PP Sbjct: 268 PPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPP 306 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP P PPP P PPPP Sbjct: 276 PPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPP 314 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP P P PPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPP 302 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 288 PPPPPPCP-PPPPPPPPCPPPPPPPPPPPPPCPPPPPP 324 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP PP P PPPP Sbjct: 321 PPPPPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPPCPPPP 361 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 295 PPPPPPPPPCPPPPPPPPPPPPPCPP-PPPPPPPCPPP 331 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP-PSPYPPP 294 PPPPPPP P PPP PP P PP PPPP P P PPP Sbjct: 297 PPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPP 335 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 247 PPPPPPCPPPCPPPCPPPPP---PPPPPPPPPPPPPPP 281 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP PP P PP PPPPP P PPPP Sbjct: 285 PPCPPPPPPCPPPPPPPPPCPPPPPP-PPPPPPPCPPPP 322 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP P P PPPP Sbjct: 309 PPPPPPPPPCPPPPPPPPPCP---PPCPPPCPPPCPPPP 344 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP---PPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP PP P PPPP Sbjct: 311 PPPPPPPCP-PPPPPPPPCPPPCPPPCPPPCPPPPPPCPPPP 351 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PP-PPPSPYPPPP 297 PPP PPP P PPP PP P PP PP PPP P PPPP Sbjct: 254 PPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPP 293 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PP P PP PP PP P PPPP Sbjct: 289 PPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPP 327 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP PP P PPPP Sbjct: 319 PPPPPPPPP--CPPPCPPPCPPPCPPPPPPCPPPPCPPPP 356 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPP P PP PP P PP PPPPP P PPPP Sbjct: 240 PPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPP 277 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP---PSPYPPPP 297 PPP PPP P PPP PP P PP PPPP P P PPPP Sbjct: 250 PPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPP 291 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PP P PP PPPPP P P PP Sbjct: 299 PPPPPCPPP---PPPPPPPPPPCPPPPPPPPPCPPPCPP 334 [75][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPPLP P P+P +P PP PPPPP P PPPP Sbjct: 787 PPPPPPPLPPAPPQPAPAPTPPPPPPPPPPPPPPPPPPP 825 [76][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP+P P+ PP PPPPP P PPPP Sbjct: 1934 PPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPP 1972 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P +P PP PPPPP P PPPP Sbjct: 1932 PPPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPP 1970 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P P PP PPPPP P PPPP Sbjct: 1933 PPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPP 1971 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P P P+PP +P PP PPPPP P PPP Sbjct: 1936 PPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPP 1973 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP+PP P PP PPPPP P PP Sbjct: 1940 PPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPPSAPP 1977 [77][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP+P PPP PP P PP PPPPP P PPPP Sbjct: 239 PRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPP PP P PPP PP P PP PPPPP P PPP Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP PP P Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLP 285 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP P P P PPP PP P PP PPPPP P PPPP Sbjct: 231 PPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPP 269 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPP P PPS P SPS RPP PP PP P PPPP Sbjct: 218 PPSSPPPPPSASSPPSSP-SPSPRPPPPPMPPPPPPPPP 255 [78][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPY-SPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP SP P PPPPPSP PPPP Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 214 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP PS PP PPPPP P PPPP Sbjct: 211 PPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPPPPSPPPP 248 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP P PP PPPPP P PPPP Sbjct: 185 PPPPPSPPPPSPPPPSPPPPP---PPSPPPPPPPSPPPP 220 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS----PSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPPP P PPPP Sbjct: 201 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP PP PP P PPPP Sbjct: 193 PPSPPPPSPPPPPPPSPPPPPPPSPP-PPSPPPPSPPPP 230 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP SP P PP PP P PPPP Sbjct: 197 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 235 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PPPPSP PP P Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PP PP P PPPP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPP-PPSPPPPSPPPP 258 [79][TOP] >UniRef100_A9TWI4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWI4_PHYPA Length = 818 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PP PP PS PP PPPPPSP PPPP Sbjct: 494 PPSPPPPSPPPPPPSPPPPPPSPPPPSPPPPPSPSPPPP 532 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP P PP PP PP P PPPP Sbjct: 486 PPPPSPPPPPSPPPPSPPPPPPSPPPPPPSPPPPSPPPP 524 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = +1 Query: 187 PPPPPLP*REPPPSPPYSPSRRPP*PPPPP-SPYPPPP 297 PPPPP P PPPSPP PS PP PPPPP SP PPPP Sbjct: 480 PPPPPSP---PPPSPPPPPSPPPPSPPPPPPSPPPPPP 514 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP PP PPPP P PPPP Sbjct: 481 PPPPSPPPPSPPPPPSPPPPSPPPPPPSPPPPPPSPPPP 519 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP P PP PP SP PP PPPP P PP P Sbjct: 489 PSPPPPPSPPPPSPPPPPPSPPPPPPSPPPPSPPPPPSP 527 [80][TOP] >UniRef100_A4CWS8 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 7805 RepID=A4CWS8_SYNPV Length = 197 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/43 (67%), Positives = 29/43 (67%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGYGG G Y G GGG G GG GGGG RS Sbjct: 97 GGGGYGGGGGGGYGGGGGGGYRGGGGGYNDGGGGYGGGGERRS 139 [81][TOP] >UniRef100_A9P8Z7 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8Z7_POPTR Length = 165 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/40 (72%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGG-DGGGSRYGNGGGGGGG 180 GGGGY GGGGGYGGRREG GG GG YG GGGG GG Sbjct: 93 GGGGYSRGGGGGYGGRREGGGGGYSRGGGGYGGGGGGYGG 132 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/42 (69%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Frame = -2 Query: 296 GGGGYG---EGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG EGGGGGY R G YGG GGG YG GGGG GG Sbjct: 101 GGGGYGGRREGGGGGY-SRGGGGYGGGGGG--YGGGGGGYGG 139 [82][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P Y P PP PPPPP+ PPPP Sbjct: 211 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPP 249 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P Y P PP PPPPP+ PPPP Sbjct: 119 PPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPP 157 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P Y P PP PPPPP+ PPPP Sbjct: 142 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPP 180 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P Y P PP PPPPP+ PPPP Sbjct: 165 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPP 203 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P Y P PP PPPPP+ PPPP Sbjct: 188 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPP 226 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = +1 Query: 178 FPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 + PPPPPP P PPP P Y P PP PPPPP+ PPPP Sbjct: 307 YGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPP 346 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPP---PPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPPP P PPP P Y+P PP PPPPPS PPPP Sbjct: 93 PPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPP 134 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPP P YSP PP PPPPP+ Y PPP Sbjct: 231 PPPPPPP-----PPPPPAYSPPPPPP-PPPPPAAYGPPP 263 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P Y P P PPPPP+ PPPP Sbjct: 289 PPPPPPPPPAYSPPPPPAYGP----PPPPPPPAYAPPPP 323 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP-------YSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP Y P P PPPP P PPPP Sbjct: 234 PPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPP 279 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPY---PPPP 297 PPPPPPP PPP P Y P PP PPPPP+ Y PPPP Sbjct: 249 PPPPPPPPAAYGPPPPPAYGPPPPPP-PPPPPAAYAYGPPPP 289 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPPPPPPLP*REPPPS--PPYSPSRRPP*PPPPPSP---YPPPP 297 PPPPPPP P PPPS PP P+ PP PPPPP P Y PPP Sbjct: 116 PPPPPPPPP---PPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPP 156 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PP + Y P PP PPPPP+ PPPP Sbjct: 269 PPPPPPPPP---PPAAYAYGPPPPPPPPPPPPAYSPPPP 304 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPPPP---PPLP*REPPPSPPYSPSRRPP--*PPPPPSPYPPPP 297 PPPPP PP P PPP P Y+P PP PPPPP Y PPP Sbjct: 320 PPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPP 363 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/43 (55%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +1 Query: 178 FPPPPPPPLP*REPPPSPPYSPSRRPP*PP---PPPSPYPPPP 297 + PPPPP PPP PP PS PP PP PPP P PPPP Sbjct: 106 YAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPP 148 [83][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PP PLP PPPSPP SP PP PPPP P PPPP Sbjct: 1573 PPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPP 1611 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP SP PP PP PP P PPPP Sbjct: 717 PPLPPPPLPPPSPPPSPPPSPPPSPP-PPTPPPPAPPPP 754 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP PPPP+P PP P Sbjct: 752 PPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAP 790 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP SP PP PPP PSP PPPP Sbjct: 1634 PPLPPPPSPPPSPPPSPPPSP---PPSPPPSPSPLPPPP 1669 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP PP PP P PPPP Sbjct: 756 PPPAPPPSPPPSPPPSPPPSPPPSPP-PPTPPPPAPPPP 793 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP PP PP P PPPP Sbjct: 1228 PPPSPPPSPPPSPPPSPPPSPPPSPP-PPTPPPPAPPPP 1265 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP P PP PP P PPPP Sbjct: 961 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPP 999 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP SP PP PPPP+P PP P Sbjct: 1224 PPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAP 1262 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP SP PP PPP P P PPPP Sbjct: 748 PPAPPPPAPPPAPPPSPPPSP---PPSPPPSPPPSPPPP 783 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP SP PP PP PP P PPPP Sbjct: 847 PPLPPPPSPPPSPPPSPPPSPPPSPP-PPTPPPPAPPPP 884 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP SP PP PP PP P PPPP Sbjct: 957 PPLPPPPSPPPSPPPSPPPSPPPSPP-PPTPPPPAPPPP 994 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP SP PP PP PP P PPPP Sbjct: 1025 PPLPPPPSPPPSPPPSPPPSPPPSPP-PPTPPPPAPPPP 1062 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP SP PP PP PP P PPPP Sbjct: 1116 PPLPPPPSPPPSPPPSPPPSPPPSPP-PPTPPPPAPPPP 1153 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP P PP P PPPSP P PP Sbjct: 1720 PPNPPPPLP---PPPSPPSPPPPSPPPPSPPPSPPPSPP 1755 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP SP PP PPP P P PPPP Sbjct: 842 PPLPPPPLP---PPPSPPPSP---PPSPPPSPPPSPPPP 874 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP SP PP PPP P P PPPP Sbjct: 952 PPLPPPPLP---PPPSPPPSP---PPSPPPSPPPSPPPP 984 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP SP PP PPP P P PPPP Sbjct: 1020 PPLPPPPLP---PPPSPPPSP---PPSPPPSPPPSPPPP 1052 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP SP PP PPP P P PPPP Sbjct: 1111 PPLPPPPLP---PPPSPPPSP---PPSPPPSPPPSPPPP 1143 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SPS PP PP PP P PP P Sbjct: 1642 PPPSPPPSPPPSPPPSPPPSPSPLPP-PPTPPPPSPPLP 1679 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP P PP PPPPSP PPPP Sbjct: 379 PPSPPPPLP---PPPSPP--PPLPPPPIPPPPSPPPPPP 412 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPP PPP P PPPSPP SP P PPP PP P PPPP Sbjct: 1581 PPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPP 1621 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*RE-PPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP SP PP PPPP+P PP P Sbjct: 712 PPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAP 751 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP P PP PP P PPP Sbjct: 760 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPP 797 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP P PP PP P PPP Sbjct: 851 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 888 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP P PP PP P PPP Sbjct: 1029 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 1066 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP P PP PP P PPP Sbjct: 1120 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 1157 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPPSPP SP PP P PPPSP P PP Sbjct: 1219 PPLPPPPLP---PPPSPPPSPPPSPP-PSPPPSPPPSPP 1253 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP P PP PP P PPP Sbjct: 1232 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPP 1269 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP P P+ PP PPP P P PPPP Sbjct: 768 PPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPP 806 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/41 (63%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PP PPPP P PPPSPP P+ PP PPPP P P PPPP Sbjct: 787 PPAPPPPTPPPSPPPSPP-PPTPPPPAPPPPNPPPPSPPPP 826 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP P P+ PP PPP P P PPPP Sbjct: 859 PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPP 897 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/41 (63%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PP PPPP P PPPSPP P+ PP PPPP P P PPPP Sbjct: 878 PPAPPPPAPPPSPPPSPP-PPTPPPPAPPPPNPPPPSPPPP 917 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP P P+ PP PPP P P PPPP Sbjct: 1037 PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPP 1075 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/41 (63%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PP PPPP P PPPSPP P+ PP PPPP P P PPPP Sbjct: 1056 PPAPPPPAPPPSPPPSPP-PPTPPPPAPPPPNPPPPSPPPP 1095 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP P P+ PP PPP P P PPPP Sbjct: 1128 PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPP 1166 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/41 (63%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PP PPPP P PPPSPP P+ PP PPP PP P PPPP Sbjct: 1147 PPAPPPPAPPPSPPPSPP-PPTPPPPAPPPPNPPPPSPPPP 1186 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP-PSPYPPPP 297 PPP PPP P PPPSPP P+ PP PPPP P P PPPP Sbjct: 1236 PPPSPPPSPPPSPPPSPP-PPTPPPPAPPPPTPPPSPPPP 1274 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP P PPPP+P PP P Sbjct: 1638 PPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSP 1676 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPP---SPYPPPP 297 PP PPPP P PPPSPP SP PP P PPP SP PPPP Sbjct: 1733 PPSPPPPSP---PPPSPPPSPPPSPPPPSPPPPSLSPSPPPP 1771 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP+P PPP+PP SP PP P PPPSP P PP Sbjct: 2116 PPLPPPPVP---PPPTPPPSPPPLPPPPTPPPSPPPLPP 2151 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP+PP SP PP PP PP P PPPP Sbjct: 782 PPTPPPPAP---PPPTPPPSPPPSPP-PPTPPPPAPPPP 816 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP SP P PP PP P PPPP Sbjct: 785 PPPPAPPPP--TPPPSPPPSPPPPTPPPPAPPPPNPPPP 821 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP+PP SP PP PP PP P PPPP Sbjct: 873 PPTPPPPAP---PPPAPPPSPPPSPP-PPTPPPPAPPPP 907 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP SP P PP PP P PPPP Sbjct: 876 PPPPAPPPP--APPPSPPPSPPPPTPPPPAPPPPNPPPP 912 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/41 (63%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPP PPP P PPPSPP P+ PP PPPP P P PPPP Sbjct: 965 PPPSPPPSPPPSPPPSPP-PPTPPPPAPPPPNPPPPSPPPP 1004 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP+PP SP PP PP PP P PPPP Sbjct: 1051 PPTPPPPAP---PPPAPPPSPPPSPP-PPTPPPPAPPPP 1085 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP SP P PP PP P PPPP Sbjct: 1054 PPPPAPPPP--APPPSPPPSPPPPTPPPPAPPPPNPPPP 1090 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP+PP SP PP PP PP P PPPP Sbjct: 1142 PPTPPPPAP---PPPAPPPSPPPSPP-PPTPPPPAPPPP 1176 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP SP P PP PP P PPPP Sbjct: 1145 PPPPAPPPP--APPPSPPPSPPPPTPPPPAPPPPNPPPP 1181 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP PP P PPPSPP P PP PPPP P P PPPP Sbjct: 680 PPPPSPPPPSPSPPPSPP--PPSPPPSPPPPSPPPPLPPPP 718 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP SP P PP PP P PPPP Sbjct: 685 PPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPP 723 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP PP P PPPSPP P PP PPPP P P PPPP Sbjct: 1536 PPPPSPPPPSPSPPPSPP--PPSPPPSPPPPSPPPPLPPPP 1574 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PP PPPP P PPPSPP P PP PPP PP P PPPP Sbjct: 1725 PPLPPPPSPPSPPPPSPP--PPSPPPSPPPSPPPPSPPPP 1762 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPS----PYPPPP 297 PPP PPPLP PPP+PP SP PP P PPP P PPPP Sbjct: 2129 PPPSPPPLP---PPPTPPPSPPPLPPPPTPPPQSPPLPSPPPP 2168 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPP---SPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P + PP PP SP PP PPP PSP PPPP Sbjct: 2147 PPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPP 2188 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP--YSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP P PP P PPPSP P PP Sbjct: 764 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPP 804 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP--YSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP P PP P PPPSP P PP Sbjct: 855 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPP 895 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP--YSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP P PP P PPPSP P PP Sbjct: 1033 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPP 1073 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP--YSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP P PP P PPPSP P PP Sbjct: 1124 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPP 1164 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/41 (58%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPP PPP P PPP P P+ PP PPP PP P PPPP Sbjct: 1151 PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPP 1191 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/40 (60%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPP PPP P PPP P P+ PP PPP PP P PPPP Sbjct: 1240 PPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPPTPPPP 1279 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP SP PP PPP P P PPPP Sbjct: 1571 PPPPVPPSP--LPPPSPPPSP---PPSPPPSPPPSPPPP 1604 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP P PS P PPPPP P PPPP Sbjct: 2187 PPIPPPPSPPPHPPPQSPLPPS---PPPPPPPPPLPPPP 2222 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP P+ PP PPPP P PPP Sbjct: 725 PPPSPPPSPPPSPPPSPP-PPTPPPPAPPPPAPPPAPPP 762 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP-PSPYPPPP 297 PP PPPPLP PPPSPP P PP PPPP P P PPPP Sbjct: 1598 PPSPPPPLP-LPPPPSPP-PPLPPPPVPPPPSPPPLPPPP 1635 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +1 Query: 172 LQFPPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 L PPPP PP P PP PP SP PP P PPPPSP P PP Sbjct: 1605 LPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPP 1647 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPLP PPP+PP P PP PP PP P PPPP Sbjct: 1710 PPLPPPPLP---PPPNPP-PPLPPPPSPPSPPPPSPPPP 1744 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP PP PPPPSP P PP Sbjct: 1713 PPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPP 1751 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PPLP PPP PP P PP PPP P P PPPP Sbjct: 2104 PPPPSPPLP-PSPPPLPP-PPVPPPPTPPPSPPPLPPPP 2140 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/38 (57%), Positives = 23/38 (60%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPP P P+ PP PPP P P PPP Sbjct: 729 PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPP 766 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP+PP SP PP P PPPSP P PP Sbjct: 746 PPPPAPPPP--APPPAPPPSPPPSPP-PSPPPSPPPSPP 781 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/43 (55%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P----PPPPSPYPPPP 297 PPP PPP P PPP P P+ PP P PPPP P PPPP Sbjct: 791 PPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPP 833 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*P-PPPPSPYPPPP 297 PP PPPPLP PP P PP P PP P PPPPSP P PP Sbjct: 820 PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP 860 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/43 (55%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P----PPPPSPYPPPP 297 PPP PPP P PPP P P+ PP P PPPP P PPPP Sbjct: 882 PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPP 924 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/43 (55%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P----PPPPSPYPPPP 297 PPP PPP P PPP P P+ PP P PPPP P PPPP Sbjct: 969 PPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPP 1011 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*P-PPPPSPYPPPP 297 PP PPPPLP PP P PP P PP P PPPPSP P PP Sbjct: 998 PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP 1038 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/43 (55%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P----PPPPSPYPPPP 297 PPP PPP P PPP P P+ PP P PPPP P PPPP Sbjct: 1060 PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPP 1102 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*P-PPPPSPYPPPP 297 PP PPPPLP PP P PP P PP P PPPPSP P PP Sbjct: 1089 PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP 1129 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/41 (63%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PP PPPP P PPP+PP PS PP PPPP P P PPPP Sbjct: 1165 PPTPPPPAP---PPPNPP-PPSPPPPLPPPPSPPPPLPPPP 1201 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP P PS P PPP SP PPPP Sbjct: 1742 PPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPP 1780 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/44 (56%), Positives = 27/44 (61%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPP-----PPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPPP+P PPPSPP P + P PP PP P PPPP Sbjct: 2177 PPPSPSPLPPPPIP---PPPSPPPHPPPQSPLPPSPPPPPPPPP 2217 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP+PP +P PP P PPPSP P PP Sbjct: 743 PPTPPPPAP---PPPAPPPAPPPSPP-PSPPPSPPPSPP 777 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 5/43 (11%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS---PSRRPP*PPP--PPSPYPPP 294 PPPP P P PPPSPP S PS PP PPP PPSP PPP Sbjct: 1541 PPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPP 1583 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP P PP P PPPSP P PP Sbjct: 1613 PPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPP 1651 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 172 LQFPPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 L PPPP PP P PP PP SPS PP P PPPPSP P PP Sbjct: 2162 LPSPPPPSPPTP----PPLPPPSPSPLPPPPIPPPPSPPPHPP 2200 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPP PP P PP PP P PP PPP P P PPP Sbjct: 741 PPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPP 778 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*P-PPPPSPYPPPP 297 PP PPPPLP PP P PP P PP P PPPPSP P PP Sbjct: 911 PPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPP 951 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P P P PP P PP P PPPSP P PP Sbjct: 936 PPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPP 974 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP------PSPYPPPP 297 PP PPPPLP PPPSPP P PP PPPP P P PPPP Sbjct: 1180 PPSPPPPLP---PPPSPP-PPLPPPPLPPPPVPPPPSPPPLPPPP 1220 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P P P PP P PP P PPPSP P PP Sbjct: 1203 PPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPP 1241 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSP SP PP PPPP P P PP Sbjct: 1646 PPPSPPPSPPPSPPPSP--SPLPPPPTPPPPSPPLPSPP 1682 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPP PPLP PPPSPP P PP P P PP P PPPP Sbjct: 2155 PPPQSPPLP-SPPPPSPPTPPPLPPPSPSPLPPPPIPPPP 2193 [84][TOP] >UniRef100_UPI00016C3DAE RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C3DAE Length = 144 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G YGG GGG R G GG GGGG Sbjct: 95 GGGGYGGGGGGGYGG--GGGYGGGGGGRRGGGGGYGGGG 131 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/44 (65%), Positives = 29/44 (65%), Gaps = 5/44 (11%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYG-----GDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G YG G GGG R G GGG GGG Sbjct: 88 GGGGYG-GGGGGYGGGGGGGYGGGGGYGGGGGGRRGGGGGYGGG 130 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGGYGG G GG GG YG GGGG GG Sbjct: 101 GGGGGGYGGGGGYGGGGGGRRGGGGG---YGGGGGGYGG 136 [85][TOP] >UniRef100_Q38M49 Putative glycine-rich RNA binding protein-like n=1 Tax=Solanum tuberosum RepID=Q38M49_SOLTU Length = 176 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/53 (58%), Positives = 31/53 (58%), Gaps = 10/53 (18%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGG----------SRYGNGGGGGGGNWRS 168 GGGGY GGGG GGRREG YGG GGG S G GGG GNWRS Sbjct: 124 GGGGYSGGGGGYGGGRREGGYGGGGGGYGGGDRYSDRSSRGGGGGSSDGNWRS 176 [86][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP P PPP+P PPPP Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP P P PPPP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP P P PPPP Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPP 1452 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PPPPP+P P PP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP 291 PPPPPPP P PPP PP P PP PPPPP P PP Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPP P PPP Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPP P PPPP Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 [87][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS-PSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PPY PS PP P PPP YPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP YP PP Sbjct: 379 PPPPPPPPP---PPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP---PSPYPPPP 297 PPPPPPP P PPP PP P PP PPPP PSP PPPP Sbjct: 380 PPPPPPPPP---PPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPP PP P P PPPPP YPPPP Sbjct: 401 PPPPPPPYVYPSPPPPPPSPPPYVYP-PPPPPYVYPPPP 438 [88][TOP] >UniRef100_Q00TR5 Homology to unknown gene n=1 Tax=Ostreococcus tauri RepID=Q00TR5_OSTTA Length = 1931 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP PPPPSP P PP Sbjct: 1809 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPP 1847 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 1813 PPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPP 1851 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP PPPPSP P PP Sbjct: 1829 PPPSPPPSP---PPPSPPPSPPPSPPPSPPPPSPPPSPP 1864 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP P P PPPSP P PP Sbjct: 1817 PPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPP 1855 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 1830 PPSPPPSPPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPP 1868 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PP PPPP P PPPSPP PS PP PPP P P PPP Sbjct: 1834 PPSPPPPSPPPSPPPSPP--PSPPPPSPPPSPPPSPPP 1869 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +1 Query: 190 PPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P PPPSPP SP PP PPP P P PPPP Sbjct: 1808 PPPPSPPPSPPPSPPPSP---PPSPPPSPPPSPPPP 1840 [89][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = +1 Query: 169 LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 ++ PPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 71 MMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRRP 117 [90][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PP PPPP P PPPSPP P PP P PPPPSP PPPP Sbjct: 158 PPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPP 197 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP P PP PPPPP P PPPP Sbjct: 153 PPPPPPPSP---PPPSPPSPP---PPSPPPPPPPSPPPP 185 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPY-SPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP SP P PPPPP+ PPPP Sbjct: 166 PPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPPPP 205 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPP SP PPPP Sbjct: 174 PPPPPPPSP---PPPSPP-PPSPSPP--PPPASPPPPPP 206 [91][TOP] >UniRef100_Q40052 Glycine rich protein, RNA binding protein n=1 Tax=Hordeum vulgare RepID=Q40052_HORVU Length = 173 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/52 (57%), Positives = 31/52 (59%), Gaps = 9/52 (17%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGG---------GGGNWRS 168 GGGGYG GGGGYGG+R G G GGG YG GGGG GG WRS Sbjct: 122 GGGGYGGQGGGGYGGQRGGGGGYGGGGGGYGGGGGGYGGQRGGGDSGGQWRS 173 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGD-GGGSRYGNGGGGGGG 180 GGGYG GGGGYGG+ G YGG GGG YG GGGG GG Sbjct: 115 GGGYGGQGGGGYGGQGGGGYGGQRGGGGGYGGGGGGYGG 153 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 5/43 (11%) Frame = -2 Query: 296 GGGGYGEGGG-----GGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGGYG GGG GGYGG+ G YGG GGG G GGGGG Sbjct: 101 GGGGYGGGGGYGGQGGGYGGQGGGGYGGQGGGGYGGQRGGGGG 143 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGG G GGGGGYGG+ G YGG GGG G GGGG GG Sbjct: 100 GGGGGYGGGGGYGGQGGG-YGGQGGGGYGGQGGGGYGG 136 [92][TOP] >UniRef100_Q04130 Glycine-rich protein (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q04130_SOLLC Length = 82 Score = 61.6 bits (148), Expect = 3e-08 Identities = 36/63 (57%), Positives = 37/63 (58%), Gaps = 20/63 (31%) Frame = -2 Query: 296 GGGGYG----EGGGGGYGG------RREGEYGGDGGGS--------RYGNGGGGGG--GN 177 GGGGYG EGGGGGYGG RREG YGG GGG R GGGGGG GN Sbjct: 20 GGGGYGGGRREGGGGGYGGGGYGGGRREGGYGGGGGGYGGGDRYNVRSSRGGGGGGSDGN 79 Query: 176 WRS 168 WR+ Sbjct: 80 WRN 82 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/45 (64%), Positives = 30/45 (66%), Gaps = 7/45 (15%) Frame = -2 Query: 296 GGGGYG----EGGGGGYGGRREGEYGG---DGGGSRYGNGGGGGG 183 GGGGYG EGGGGGYGG G YGG +GGG YG GG GGG Sbjct: 2 GGGGYGGGRREGGGGGYGGG--GGYGGGRREGGGGGYGGGGYGGG 44 [93][TOP] >UniRef100_B4JLJ8 GH12877 n=1 Tax=Drosophila grimshawi RepID=B4JLJ8_DROGR Length = 96 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = -2 Query: 296 GGGGYGEGG--GGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGGYG GG GGGYGG G +GG GG G GGGGGGG W Sbjct: 33 GGGGYGGGGHGGGGYGGGHGGGHGGGHGGGGGGGGGGGGGGGW 75 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/52 (51%), Positives = 30/52 (57%), Gaps = 11/52 (21%) Frame = -2 Query: 296 GGGGYGEGG-GGGYGGRREGEYGGDGGGSRYGNGGGG----------GGGNW 174 GGGG+G GG GGG+GG G +GG GGG G GGGG GGG W Sbjct: 38 GGGGHGGGGYGGGHGGGHGGGHGGGGGGGGGGGGGGGWAPQGGWAQGGGGGW 89 [94][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/41 (70%), Positives = 29/41 (70%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 Q PP PPPP P PPPSPP PS PP PPPPPSP PPPP Sbjct: 124 QPPPSPPPPSP---PPPSPP-PPSPPPPSPPPPPSPPPPPP 160 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP PS PP PP PP P PPPP Sbjct: 410 PPPPSPPPPPSPPPPSPP-PPSPPPPSPPSPPPPSPPPP 447 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP PS PP PPPP P PPPP Sbjct: 405 PPPPSPPPPSPPPPPSPP-PPSPPPPSPPPPSPPSPPPP 442 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPPP P P PPPSPP PS PP PPP PP P PPPP Sbjct: 134 PPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPP 172 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP PS PP PPPPPSP PP P Sbjct: 390 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPPSPPPPSP 426 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP SP P PP PP P PPPP Sbjct: 144 PPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPP 182 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPPP P P PPPP Sbjct: 156 PPPPPPPSP---PPPSPP-PPSPPPPSPPPPSPPPPSPPPP 192 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPPP P P PPPP Sbjct: 260 PPPPPPPSP---PPPSPP-PPSPPPPSPPPPSPPPPSPPPP 296 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PP PPPP P PPPSPP PS PP PPP PP P PPPP Sbjct: 428 PPSPPPPSPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 467 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP PP SP P PPPPP P PPPP Sbjct: 129 PPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPP 167 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPPSPP P P PP PP P PPPP Sbjct: 139 PPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPP 177 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPPP P P PPPSPP PS PP PPP PP P PPPP Sbjct: 158 PPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 197 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPPP P P PPPSPP PS PP PPP PP P PPPP Sbjct: 262 PPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 301 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP PP P PPPSPP PS PP PPPP P P PPPP Sbjct: 308 PPPPSPPPPPPSPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 347 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPPPP P PPPSPP PS PP PPP PP P PPPP Sbjct: 313 PPPPPPSPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 352 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP PP P PPPSPP PS PP PPPP P P PPPP Sbjct: 364 PPPPSPPPPPPSPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 403 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPPPP P PPPSPP PS PP PPP PP P PPPP Sbjct: 369 PPPPPPSPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 408 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPY-SPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSPP SP PP PPPPSP PP P Sbjct: 415 PPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSP 454 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPSP PPPP Sbjct: 229 PPPPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPPP 264 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPSP PPPP Sbjct: 283 PPPPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPPP 318 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP P PP PPPP P P PPPP Sbjct: 298 PPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP 337 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP SP P PP PP P PPPP Sbjct: 305 PPSPPPPSP-PPPPPSPPPSPPPPSPPPPSPPPPSPPPP 342 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPSP PPPP Sbjct: 339 PPPPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPPP 374 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP P PP PPPP P P PPPP Sbjct: 354 PPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP 393 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP SP P PP PP P PPPP Sbjct: 361 PPSPPPPSP-PPPPPSPPPSPPPPSPPPPSPPPPSPPPP 398 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PP Sbjct: 400 PPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPP 437 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PPP PPP P PPP PP P PP P PPPPSP PP P Sbjct: 145 PPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 184 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP P PP P PP PPPPPSP PP P Sbjct: 234 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSP 273 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP P PP PP PP P PPPP Sbjct: 249 PPPPSPPPPSPPPPPPPPSPPPPSPP-PPSPPPPSPPPP 286 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 P PPPPP P PPP P PS PP PPP PP P PPPP Sbjct: 147 PSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 187 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PP PPPP P PPP P PS PP PPP PP P PPPP Sbjct: 251 PPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 291 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPPP PP P PP PP SP PP PPP PP P PPPP Sbjct: 293 PPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPP 332 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPPP PP P PP PP SP PP PPP PP P PPPP Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPP 388 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PPPP P P PPPSPP P PP P PPPPSP PP P Sbjct: 421 PPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSP 459 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP P PP PPPPSP PP P Sbjct: 303 PPPPSPPPP--SPPPPPPSPPPSPPPPSPPPPSPPPPSP 339 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP P PP PPPPSP PP P Sbjct: 359 PPPPSPPPP--SPPPPPPSPPPSPPPPSPPPPSPPPPSP 395 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP PP PP PP P PPPP Sbjct: 239 PPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPP 276 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P P PP PP P PPPP Sbjct: 244 PPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPP 281 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP PS PP PPPPSP PP P Sbjct: 395 PPPPSPPPPSPPPPSPP-PPSPPPPPSPPPPSPPPPSP 431 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 169 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 207 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 174 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 212 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 179 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 217 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 184 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 222 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 189 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 227 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 194 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 232 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 199 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 237 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 204 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 242 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 209 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 247 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 214 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 252 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 219 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 257 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 273 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 311 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/40 (60%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP P PP P PP PPP P P PPPP Sbjct: 288 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPP 327 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 324 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 362 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 329 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 367 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/40 (60%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP P PP P PP PPP P P PPPP Sbjct: 344 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPP 383 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 380 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 418 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/40 (60%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PP P PP P PP P PPP P PPPP Sbjct: 385 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPP 424 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 439 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 477 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 444 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 482 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 449 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 487 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 454 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 492 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 459 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 497 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 464 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 502 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 469 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 507 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 474 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 512 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 479 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 517 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PPPP PP P PP PP SP PP P PPPPSP PP P Sbjct: 239 PPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSP 278 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PP PPPP P PPSPP PS PP PPPP P P PPPP Sbjct: 423 PPSPPPPSPPPPSPPSPP-PPSPPPPSPPPPSPPPPSPPPP 462 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPSP PP P Sbjct: 484 PPPPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPSP 519 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP P PP PPPPSP P PP Sbjct: 489 PPPPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPSPP 524 [95][TOP] >UniRef100_Q3MC83 Putative uncharacterized protein n=1 Tax=Anabaena variabilis ATCC 29413 RepID=Q3MC83_ANAVT Length = 387 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 325 PPPPPPPDPPPPPPPDPPPPPPPDPP-PPPPPDPPPPPP 362 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 333 PPPPPPPDPPPPPPPDPPPPPPPDPP-PPPPPDPPPPPP 370 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 341 PPPPPPPDPPPPPPPDPPPPPPPDPP-PPPPPDPPPPPP 378 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 349 PPPPPPPDPPPPPPPDPPPPPPPDPP-PPPPPDPPPPPP 386 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 318 PPPPPPDPPPPPPPDPPPPPPPDPP-PPPPPDPPPPPP 354 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P +PPP PP P PP PPPP P PPP Sbjct: 321 PPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 359 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P +PPP PP P PP PPPP P PPP Sbjct: 329 PPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 367 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P +PPP PP P PP PPPP P PPP Sbjct: 337 PPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 375 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P +PPP PP P PP PPPP P PPP Sbjct: 345 PPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 383 [96][TOP] >UniRef100_A5VB72 Filamentous haemagglutinin family outer membrane protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5VB72_SPHWW Length = 1531 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP S PP PPPP SP PPPP Sbjct: 1265 PPPPPPPPPVSPPPPPPPPPVSPPPPPPPPPVSPPPPPP 1303 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPPP PPPP Sbjct: 1264 PPPPPPPPPPVSPPPPPPPPPVSPPPPPPPPPVSPPPPP 1302 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPP SP PPPP Sbjct: 1276 PPPPPPPPPVSPPPPPPP--PPVSPPPPPPPVSPPPPPP 1312 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPP PP SP PP PPP P PPPP Sbjct: 1278 PPPPPPPVSPPPPPPPPPVSPPPPPPPVSPPPPPPPPPP 1316 [97][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAP 42 [98][TOP] >UniRef100_A7RNZ0 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RNZ0_NEMVE Length = 370 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PPY P + PP PPPPP P PPPP Sbjct: 296 PPPPPYPAPTPYPPPPPPY-PEQVPPPPPPPPPPPPPPP 333 [99][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPPPP P PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PP P PPP P PPPP Sbjct: 64 PPPPPPPPP---PPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP P PP PPP P P PPPP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 [100][TOP] >UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XP48_SORBI Length = 109 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/40 (72%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -2 Query: 296 GGGGYGEGGGG-GYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGG GYGG G YGG GGG R G GGG GGG Sbjct: 41 GGGGYGGGGGGGGYGGGGGGGYGGGGGGGRGGGGGGFGGG 80 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/43 (67%), Positives = 29/43 (67%), Gaps = 4/43 (9%) Frame = -2 Query: 296 GGGGYGEGGGGGY----GGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGY GG R G GG GGG R G GGGGG G Sbjct: 50 GGGGYGGGGGGGYGGGGGGGRGGGGGGFGGGGRGGVGGGGGRG 92 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 10/49 (20%) Frame = -2 Query: 296 GGGGYGEGG------GGGYGGRREGE----YGGDGGGSRYGNGGGGGGG 180 GGGGYG GG GGG GGR G YGG GGG YG GGGGG G Sbjct: 15 GGGGYGSGGYGGRGGGGGGGGRGRGGGGGGYGGGGGGGGYGGGGGGGYG 63 [101][TOP] >UniRef100_A1BQW1 Glycine-rich RNA-binding protein (Fragment) n=1 Tax=Nicotiana attenuata RepID=A1BQW1_9SOLA Length = 152 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/46 (67%), Positives = 32/46 (69%), Gaps = 5/46 (10%) Frame = -2 Query: 296 GGGGYGEGGGGGY--GGRREGEYGGD---GGGSRYGNGGGGGGGNW 174 GGGGY GGGGGY GGRREG YGG GGG R G GGGGGG + Sbjct: 92 GGGGYRGGGGGGYGGGGRREGGYGGGGGYGGGRREGGYGGGGGGGY 137 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/52 (61%), Positives = 33/52 (63%), Gaps = 12/52 (23%) Frame = -2 Query: 296 GGGGYGEGG--------GGGYGG-RREGEYGGDGGGSRYGNG---GGGGGGN 177 GGGGYG GG GGGYGG RREG YGG GGG YG G GG GGG+ Sbjct: 100 GGGGYGGGGRREGGYGGGGGYGGGRREGGYGGGGGGG-YGGGRREGGYGGGS 150 [102][TOP] >UniRef100_A4H3P3 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis RepID=A4H3P3_LEIBR Length = 1295 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWR 171 GGGG G GGGGG GG G GG GGG G GGGGGGG WR Sbjct: 1226 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRWR 1267 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWR 171 GGGG G GGGGG GG G GG GGG G GGGGGGG R Sbjct: 1224 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 1265 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1200 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1238 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1201 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1239 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1202 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1240 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1203 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1241 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1204 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1242 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1205 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1243 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1206 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1244 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1207 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1245 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1208 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1246 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1209 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1247 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1210 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1248 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1211 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1249 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1212 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1250 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1213 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1251 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1214 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1252 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1215 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1253 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1216 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1254 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1217 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1255 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1218 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1256 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1219 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1257 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1220 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1258 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1221 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1259 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/38 (50%), Positives = 21/38 (55%) Frame = -1 Query: 291 RWIWRRRRRWLWWSS*R*IWW*WWWLPLWQRRWWRRWK 178 RW W R R W WW WW WWW W+RRWW W+ Sbjct: 1265 RWRWWRWRWWWWW------WWRWWWW--WRRRWWWWWR 1294 [103][TOP] >UniRef100_Q2W222 RTX toxins and related Ca2+-binding protein n=1 Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W222_MAGSA Length = 1274 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP SP P PPPPP+P PPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPSPPAPAP-PPPPPAPPPPPP 310 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPPSPP PP PPPP P PPPP Sbjct: 277 PPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPP 315 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP PS P PPPPP PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPP 309 [104][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP PP PPPPPSP PPP Sbjct: 858 PPPNPPPAPTPPPPPSPPPSP---PPSPPPPPSPPPPP 892 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP+PP PS PP PPPP PPPP Sbjct: 806 PPPPPPPSP--PPPPNPPTPPSPPPPPSPPPPPSSPPPP 842 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 P PPPPP P PPPSPP PS PP P PPPSP PPP Sbjct: 866 PTPPPPPSPPPSPPPSPPPPPSPPPP-PSPPPSPSPPP 902 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPP--PPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP PP P PPPSPP +PS PP P PPP+P PPPP Sbjct: 832 PPPPPSSPPPPSPSPPPSPPPAPSPPPP-PNPPPAPTPPPP 871 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/40 (60%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP-PSPYPPPP 297 PPP PPP P PPP+PP +P+ PP PPP P P PPPP Sbjct: 846 PPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPP 885 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSR-RPP*PPPPPSPYPPP 294 PPPPP P PPPSPP P+ PP PPPPPSP PPP Sbjct: 799 PPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPP 836 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP P PPPS P PS PP P PPP+P PPPP Sbjct: 824 PSPPPPPSP--PPPPSSPPPPSPSPP-PSPPPAPSPPPP 859 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYP---PPP 297 PPP P P P PPPSPP SP PP PPPPPSP P PPP Sbjct: 862 PPPAPTPPPPPSPPPSPPPSPP-PPPSPPPPPSPPPSPSPPP 902 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PP PPPPL PPSPP PS PP PPPPPSP PPP Sbjct: 788 PPSPPPPL-----PPSPPPPPS--PPPPPPPPSPPPPP 818 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPP PP P PPP P P PP P PPP P PPP Sbjct: 827 PPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPP 864 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPS-RRPP*PPPPPSPYPPP 294 PPP PPP P PPSPP PS PP PPPPSP PPP Sbjct: 810 PPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPP 848 [105][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PP PPPPPSP PPPP Sbjct: 259 PPPPPPPSPPPPPPPPPP------PPPPPPPPSPSPPPP 291 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSP-------PYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSP P PS PP PPPPP P PPPP Sbjct: 238 PPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPP 283 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PLP PPP PP P PP PPPPP P PP P Sbjct: 249 PPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSP 286 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSP----PYSPSRRPP*PPPPPSPYPPPP 297 PP P PP P PPPSP P PS PP PPPPP P PPPP Sbjct: 228 PPSPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPP 270 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP P PP P PPPSPP P PP PPPPP P P PP Sbjct: 251 PPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 289 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP P PP PP SP P PPPPPSP PPPP Sbjct: 236 PSPPPPPSP--APPSPPPPSPLPPSPPPPPPPSPPPPPP 272 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*PPPP----PSPYPPPP 297 PPPP P P +PP PSPP PS PP PPPP PSP PPPP Sbjct: 221 PPPPSPQPPSPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPP 264 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/49 (55%), Positives = 27/49 (55%), Gaps = 10/49 (20%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP----------PPSPYPPPP 297 PPPPPPP P PPP PP SPS PP PP PP P PPPP Sbjct: 269 PPPPPPPPP---PPPPPPPSPSPPPPELPPAQPVTPARKRPPPPAPPPP 314 [106][TOP] >UniRef100_A7Z068 LMOD2 protein n=1 Tax=Bos taurus RepID=A7Z068_BOVIN Length = 553 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYP 288 PPPPPPP P PPP PP +P R PP PPPPP P P Sbjct: 421 PPPPPPPPPPPPPPPPPPLAPQRLPPPPPPPPPPAP 456 [107][TOP] >UniRef100_A3WGB5 Single-stranded DNA-binding protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WGB5_9SPHN Length = 187 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -2 Query: 287 GYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 G GEGGGGG GGR G YGG GGG+ YG+ GG GGG W Sbjct: 116 GRGEGGGGGGGGRSGGGYGGGGGGAGYGDRGGQGGGGW 153 [108][TOP] >UniRef100_Q9M6A0 Putative glycine-rich RNA binding protein 3 n=1 Tax=Catharanthus roseus RepID=Q9M6A0_CATRO Length = 164 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 16/59 (27%) Frame = -2 Query: 296 GGGGYGEG-------GGGGYGG-RREGEYGGD--------GGGSRYGNGGGGGGGNWRS 168 GGGGYG G G GGYGG RREG YGG GGGSRY GGG GNWR+ Sbjct: 106 GGGGYGGGRRDGGYGGNGGYGGGRREGGYGGGDRGYGGGGGGGSRYSRGGGASDGNWRN 164 [109][TOP] >UniRef100_Q41453 Putative glycine rich RNA binding protein n=1 Tax=Solanum tuberosum RepID=Q41453_SOLTU Length = 175 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 10/53 (18%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGG----------SRYGNGGGGGGGNWRS 168 GGGGY GGGG GGRREG YGG GGG S G GGG GNWR+ Sbjct: 123 GGGGYSGGGGGYGGGRREGGYGGGGGGYGGGDRYSDRSSRGGGGGSSDGNWRN 175 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = -2 Query: 296 GGGGYG----EGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG EGGGGGYGG G G GGG G GGG GGG Sbjct: 95 GGGGYGGGRREGGGGGYGGYGGGRREGGGGGGYSGGGGGYGGG 137 [110][TOP] >UniRef100_Q2VCI6 Putative glycine-rich RNA binding protein-like n=1 Tax=Solanum tuberosum RepID=Q2VCI6_SOLTU Length = 178 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 10/53 (18%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGG----------SRYGNGGGGGGGNWRS 168 GGGGY GGGG GGRREG YGG GGG S G GGG GNWR+ Sbjct: 126 GGGGYSGGGGGYGGGRREGGYGGGGGGYGGGDRYSDRSSRGGGGGSSDGNWRN 178 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/42 (69%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNG---GGGGGG 180 GGGG G GGGG GGRREG GG GGG YG G GGGGGG Sbjct: 88 GGGGGGRGGGGYGGGRREGGGGGYGGGGGYGGGRREGGGGGG 129 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/58 (56%), Positives = 33/58 (56%), Gaps = 19/58 (32%) Frame = -2 Query: 296 GGGGYG----EGGGGGYGG-------RREGEYGG--DGGGSRYGNG------GGGGGG 180 GGGGYG EGGGGGYGG RREG GG GGG YG G GGGGGG Sbjct: 95 GGGGYGGGRREGGGGGYGGGGGYGGGRREGGGGGGYSGGGGGYGGGRREGGYGGGGGG 152 [111][TOP] >UniRef100_B9H173 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H173_POPTR Length = 207 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/44 (70%), Positives = 31/44 (70%), Gaps = 5/44 (11%) Frame = -2 Query: 296 GGGGYGEGGGG----GYGG-RREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGG GYGG RR G GG GGG YG GGGGGGG Sbjct: 103 GGGGYGGGGGGYGGGGYGGGRRGGGGGGYGGGGGYGGGGGGGGG 146 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/51 (54%), Positives = 28/51 (54%), Gaps = 12/51 (23%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGE------------YGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGG G GE GG GGG RYG G GGGGG Sbjct: 133 GGGGYGGGGGGGGGCYSCGESGHMARDCPQGGSGGGGGGGRYGGGNGGGGG 183 [112][TOP] >UniRef100_B6TY06 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6TY06_MAIZE Length = 142 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/52 (61%), Positives = 32/52 (61%), Gaps = 10/52 (19%) Frame = -2 Query: 296 GGGGY---GEGGGGGYGGRREGEYGGDGGGSRY-------GNGGGGGGGNWR 171 GGGG G GGGGGYGGRREG GG GGG Y G G GGGGG WR Sbjct: 90 GGGGRRDGGYGGGGGYGGRREGGGGGYGGGGGYGGRREGGGGGYGGGGGGWR 141 [113][TOP] >UniRef100_B2YKT9 Glycine-rich RNA-binding protein n=1 Tax=Nicotiana tabacum RepID=B2YKT9_TOBAC Length = 157 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/46 (65%), Positives = 30/46 (65%), Gaps = 7/46 (15%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGG-------SRYGNGGGGGGG 180 GGGGYG GGG G GGRREG YGG GGG YG GGG GGG Sbjct: 96 GGGGYGGGGGYGGGGRREGGYGGGGGGYGGGRRDGGYGGGGGYGGG 141 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/44 (63%), Positives = 30/44 (68%), Gaps = 3/44 (6%) Frame = -2 Query: 290 GGYGEGGGGGYGGRREGEYGGD---GGGSRYGNGGGGGGGNWRS 168 GGYG GGGG GGRR+G YGG GGG R G GGG G+WRS Sbjct: 114 GGYGGGGGGYGGGRRDGGYGGGGGYGGGRREGGYGGGSEGSWRS 157 [114][TOP] >UniRef100_Q99070 Glycine-rich RNA-binding protein 2 n=1 Tax=Sorghum bicolor RepID=GRP2_SORBI Length = 168 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/43 (67%), Positives = 30/43 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGYGGR G GG GGG YG G GGNWR+ Sbjct: 129 GGGGYG-GGGGGYGGREGG--GGYGGGGGYGGNRGDSGGNWRN 168 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/42 (71%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDG---GGSRYGNGGGGGGG 180 GGGGYG GGGGGYGGR G YGG G GG R G GG GGGG Sbjct: 92 GGGGYG-GGGGGYGGREGGGYGGGGGGYGGRREGGGGYGGGG 132 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/46 (63%), Positives = 29/46 (63%), Gaps = 7/46 (15%) Frame = -2 Query: 296 GGGGYGEG-------GGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGYGGRREG GG GG YG GGGG GG Sbjct: 99 GGGGYGGREGGGYGGGGGGYGGRREG--GGGYGGGGYGGGGGGYGG 142 [115][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP-------YSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP YSP PP PPPPP Y PPP Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P P PPPPSP PPPP Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 7/49 (14%) Frame = +1 Query: 172 LQFPPPPPPPLP*REPPPSPP-----YSPSRRPP*PPPPP--SPYPPPP 297 L PPPP PP P PPP PP YSP PP PPPPP SP PPPP Sbjct: 423 LTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPP 471 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP------YSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPPSPP YSP PP PPPPP PPPP Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = +1 Query: 178 FPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPP--SPYPPPP 297 + PPPPPP P PPP P YSP P PPPPP SP PPPP Sbjct: 464 YSPPPPPPPP---PPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 9/48 (18%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P---------PPPPSPYPPPP 297 PPPPPPP P PPP P YS PP P PPPP P+ PPP Sbjct: 500 PPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPP 547 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 7/44 (15%) Frame = +1 Query: 187 PPPPPLP*REPPPSPPYSPSRRPP--*PPPPP-----SPYPPPP 297 PPPPP P PPP+P YSP PP PPPPP SP PPPP Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 [116][TOP] >UniRef100_A4S9A6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S9A6_OSTLU Length = 4076 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPP PPP P PPPSPP PS PP PPP PP P PPPP Sbjct: 84 PPPSPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPP 123 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PP PPPP P PPPSPP PS PP PPP PP P PPPP Sbjct: 2081 PPSPPPPSP---PPPSPPPPPSPPPPSPPPPSPPPPSPPPP 2118 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP PP P PPPSPP PS PP PPPP P P PPPP Sbjct: 2089 PPPPSPPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 2128 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPP PP P PPPSPP PS PP PPP PP P PPPP Sbjct: 2084 PPPPSPPPPSPPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 2123 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP P PS PP PPPPSP PP P Sbjct: 2072 PPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSP 2110 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P P P PP P PP PP PP P PPPP Sbjct: 2070 PPPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPP 2108 [117][TOP] >UniRef100_A4S1Y9 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S1Y9_OSTLU Length = 1065 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP PP PPP P P PPP Sbjct: 497 PPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPP 534 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP PP PPP P P PPP Sbjct: 501 PPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPP 538 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP PPP P P PPPP Sbjct: 540 PPPSPPPSPPPSPPPSPPPSP---PPSPPPSPPPSPPPP 575 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP P PP PPP P P PPP Sbjct: 505 PPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPP 542 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 481 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 518 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 485 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 522 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP PPP Sbjct: 489 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPSPPP 526 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 524 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 561 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 528 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 565 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 532 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 569 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 536 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 573 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP SP PP PP P P PPP Sbjct: 493 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPP 530 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PP P PPPSPP SP PP P PPPSP P PP Sbjct: 517 PPPSPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 553 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 521 PPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 557 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P P PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 477 PTPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 514 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 513 PPPSPPPSP-PSPPPSPPPSPPPSPP-PSPPPSPPPSPP 549 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PP PP P PP PPP P P PPP Sbjct: 509 PPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPP 546 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP 291 PPP PPP P PPPSPP SP PP PPPP + P Sbjct: 544 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPPHFAP 580 [118][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PSPP P PP PPPPP P PPPP Sbjct: 1523 PPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPPPPPP 1561 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPPS SPS PP PPPPP P PPPP Sbjct: 1522 PPPPPPP-----PPPSSSSSPSPPPPPPPPPPPPPPPPP 1555 [119][TOP] >UniRef100_A0CZ14 Chromosome undetermined scaffold_31, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CZ14_PARTE Length = 417 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/43 (62%), Positives = 30/43 (69%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*RE-PPPSPPYSPSRRPP*PPPPP---SPYPPPP 297 PPPPPPPLP ++ PPP PP RPP PPPPP +P PPPP Sbjct: 345 PPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPPP 387 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/47 (53%), Positives = 30/47 (63%), Gaps = 8/47 (17%) Frame = +1 Query: 181 PPPPPPPLP*RE--PPPSPPYSPSRRPP*PPPP------PSPYPPPP 297 PPPPPPP+P ++ PPP PP P ++ P PPPP P P PPPP Sbjct: 331 PPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPP 377 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/49 (53%), Positives = 28/49 (57%), Gaps = 10/49 (20%) Frame = +1 Query: 181 PPPPPPPLP*RE-------PPPSPPYSPSRRPP*PPPPPSP---YPPPP 297 PPPPPPPLP + PPP PP + PP PPPPP P PPPP Sbjct: 313 PPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPP 361 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPPPPPLP*R-------EPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPPLP PPP PP P PPPPP P PPPP Sbjct: 292 PPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPPP 337 [120][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYP---PPP 297 Q PPPPPPP P PPP PP P PP PPPPP P P PPP Sbjct: 40 QQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPP-----PSPYPPPP 297 Q PPPPPP P PPP PP P PP PPPP P P PPPP Sbjct: 39 QQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP 291 PPPPPPP P +PPP PP P+ P PPPPP+P P Sbjct: 1951 PPPPPPPPPTEDPPPPPPPPPAEAP--PPPPPTPLMP 1985 [121][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYP---PPP 297 Q PPPPPPP P PPP PP P PP PPPPP P P PPP Sbjct: 40 QQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPP-----PSPYPPPP 297 Q PPPPPP P PPP PP P PP PPPP P P PPPP Sbjct: 39 QQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP 291 PPPPPPP P +PPP PP P+ P PPPPP+P P Sbjct: 1854 PPPPPPPPPTEDPPPPPPPPPAEAP--PPPPPTPLMP 1888 [122][TOP] >UniRef100_Q0IE69 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. CC9311 RepID=Q0IE69_SYNS3 Length = 181 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/45 (64%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGG--GGGGNWRS 168 GGG YG GGGG YGG G YGG GGG+ G GGG GGGG RS Sbjct: 92 GGGNYGGGGGGNYGGGGGGNYGGGGGGNYGGGGGGNYGGGGERRS 136 [123][TOP] >UniRef100_O24187 OsGRP1 n=1 Tax=Oryza sativa RepID=O24187_ORYSA Length = 160 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 11/54 (20%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGG-----------GSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGY REG YGG GG G YG GGG GNWR+ Sbjct: 108 GGGGYGGGGGGGYAS-REGGYGGGGGYGGGRGGGGGYGGGYGRGGGNSDGNWRN 160 [124][TOP] >UniRef100_B9HFC9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HFC9_POPTR Length = 241 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/51 (60%), Positives = 32/51 (62%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS*IVCLP*G 144 GGGG G GGGGG GG G GG GGG +G GGGGGGGN CLP G Sbjct: 177 GGGGGGGGGGGGSGGGGGGGGGGQGGGWGWGGGGGGGGGNQGD---CLPWG 224 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREG---EYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG +G +GG GGG G GGGGGGG Sbjct: 144 GGGGGGGGGGGGGGGNGKGFGFGHGGGGGGGGGGGGGGGGGG 185 [125][TOP] >UniRef100_B6VA25 Putative glycine-rich RNA-binding protein n=1 Tax=Chorispora bungeana RepID=B6VA25_CHOBU Length = 175 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/46 (69%), Positives = 32/46 (69%), Gaps = 4/46 (8%) Frame = -2 Query: 296 GGGGYGEGGG--GGYGGRREGEYGGDGGG--SRYGNGGGGGGGNWR 171 GGGGYG GGG GG GGRREG Y G GGG SR G GGG GGG R Sbjct: 107 GGGGYGGGGGSYGGGGGRREGGYSGGGGGYPSRGGGGGGYGGGGGR 152 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 5/43 (11%) Frame = -2 Query: 296 GGGGYGE--GGGGGYGG---RREGEYGGDGGGSRYGNGGGGGG 183 GGGGY GGGGGYGG RREG YGG G G+GGGGGG Sbjct: 132 GGGGYPSRGGGGGGYGGGGGRREGGYGGGESGGYGGSGGGGGG 174 [126][TOP] >UniRef100_Q03878 Glycine-rich RNA-binding protein n=1 Tax=Daucus carota RepID=GRP1_DAUCA Length = 157 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/38 (73%), Positives = 28/38 (73%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGG G GGGGGYGGRREG GG GG R G GGG GGG Sbjct: 96 GGGGGYGGGGGYGGRREGGGGGGYGGRREGGGGGYGGG 133 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/55 (58%), Positives = 32/55 (58%), Gaps = 14/55 (25%) Frame = -2 Query: 296 GGGGYGE----GGGGGYGGRREGEYGG-DGGGSRYGN---------GGGGGGGNW 174 GGGGYG GGGGGYGGRREG GG GGG YG GGGGGG W Sbjct: 103 GGGGYGGRREGGGGGGYGGRREGGGGGYGGGGGGYGGRREGGDGGYGGGGGGSRW 157 [127][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP P PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPP 591 [128][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP P PP Sbjct: 565 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPP 603 [129][TOP] >UniRef100_UPI000069FBE2 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE2 Length = 980 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP P PP Sbjct: 452 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPP 490 [130][TOP] >UniRef100_UPI00004D6F7F Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7F Length = 555 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP P PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPP 62 [131][TOP] >UniRef100_UPI00004D6F7D Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7D Length = 1054 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PS PP PPPPP P PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPP 572 [132][TOP] >UniRef100_C4B111 Intracellular motility protein A n=4 Tax=Burkholderia mallei RepID=C4B111_BURMA Length = 373 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/53 (56%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Frame = +1 Query: 142 KP*GKQTI*LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 KP G +T+ + PPPPPPP P PPP PP P PP P PPPPSP PP P Sbjct: 78 KPVGDRTL-PNKVPPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 129 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPPPPP P PPPSPP PS PP PPPP P P PPPP Sbjct: 93 PPPPPPPPPPPPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 132 [133][TOP] >UniRef100_B9RYC5 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RYC5_RICCO Length = 510 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPL-P*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ P PPPSPP P + PP PPPPPSP PPPP Sbjct: 79 PPPPPPPICPTPLPPPSPP--PPKHPP-PPPPPSPPPPPP 115 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 6/44 (13%) Frame = +1 Query: 181 PPPPPP----PLP*REPPPS--PPYSPSRRPP*PPPPPSPYPPP 294 PPPPPP PLP PPP PP P PP PPPPP P PPP Sbjct: 80 PPPPPPICPTPLPPPSPPPPKHPPPPPPPSPPPPPPPPPPPPPP 123 [134][TOP] >UniRef100_A8HYC3 Hydroxyproline-rich glycoprotein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HYC3_CHLRE Length = 612 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPPPPLP PPPSPP PS PP PPP PP P PPPP Sbjct: 506 PPPPPPLPPSPPPPSPP-PPSPPPPSPPPPSPPPPAPPPP 544 [135][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP PP P PP PP PP P+PPPP Sbjct: 139 PPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPP 176 [136][TOP] >UniRef100_C6WDK8 Translation initiation factor IF-2 n=1 Tax=Actinosynnema mirum DSM 43827 RepID=C6WDK8_ACTMD Length = 1034 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG R G GG GGG R G GGGGGGG Sbjct: 308 GGGGRGPGGGGGGGGFRGGGGGGGGGGFRGGGGGGGGGG 346 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = -2 Query: 296 GGGGY-GEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG+ G GGGGG GG R G GG GGG R G GG GGGG Sbjct: 319 GGGGFRGGGGGGGGGGFRGGGGGGGGGGFRPGGGGPGGGG 358 [137][TOP] >UniRef100_A6G232 RNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G232_9DELT Length = 136 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/43 (67%), Positives = 29/43 (67%), Gaps = 4/43 (9%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGG----DGGGSRYGNGGGGGGG 180 GGGGYG GGGGG GGR G GG GGG YG GGGGGGG Sbjct: 88 GGGGYGGGGGGGRGGRGGGGGGGRGGRGGGGGGYGGGGGGGGG 130 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/45 (66%), Positives = 30/45 (66%), Gaps = 6/45 (13%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGE------YGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G YGG GGG R G GGGGGGG Sbjct: 67 GGGGYG-GGGGGYGGGGGGRGGGGGGYGGGGGGGRGGRGGGGGGG 110 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG G G YGG GGG YG GGGG GG Sbjct: 51 GGGGGGRGGGGGGRGGGGGGYGGGGGG--YGGGGGGRGG 87 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = -2 Query: 296 GGGGYGEGGGG------GYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGG GYGG G GG GGG G GG GGGG Sbjct: 74 GGGGYGGGGGGRGGGGGGYGGGGGGGRGGRGGGGGGGRGGRGGGG 118 [138][TOP] >UniRef100_Q9FUD5 Glycine-rich RNA-binding protein n=1 Tax=Sorghum bicolor RepID=Q9FUD5_SORBI Length = 170 Score = 60.1 bits (144), Expect = 8e-08 Identities = 32/43 (74%), Positives = 32/43 (74%), Gaps = 4/43 (9%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRRE-GEYGGDG---GGSRYGNGGGGGGG 180 GGGGYG GGGGGYGGRRE G YGG G GG R G GG GGGG Sbjct: 92 GGGGYG-GGGGGYGGRREGGGYGGGGGGYGGRREGGGGYGGGG 133 Score = 59.3 bits (142), Expect = 1e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 14/57 (24%) Frame = -2 Query: 296 GGGGYG--------------EGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGYGGRREG GG GGG YG G GGNWR+ Sbjct: 115 GGGGYGGRREGGGGYGGGGYGGGGGGYGGRREGG-GGYGGGGGYGGNRGDSGGNWRN 170 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/38 (76%), Positives = 29/38 (76%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGYG GGGGGYGGRREG GG GG YG GGGG GG Sbjct: 109 GGGYG-GGGGGYGGRREG--GGGYGGGGYGGGGGGYGG 143 [139][TOP] >UniRef100_O24106 RNA-binding protein n=1 Tax=Nicotiana glutinosa RepID=O24106_NICGU Length = 156 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/44 (65%), Positives = 30/44 (68%), Gaps = 3/44 (6%) Frame = -2 Query: 290 GGYGEGGGGGYGGRREGEYGGD---GGGSRYGNGGGGGGGNWRS 168 GGYG GGGG GGRREG YGG GGG R G GGG GNWR+ Sbjct: 113 GGYGGGGGGYGGGRREGGYGGGGGYGGGRREGGYGGGSEGNWRN 156 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/51 (60%), Positives = 31/51 (60%), Gaps = 12/51 (23%) Frame = -2 Query: 296 GGGGYGEG---GGGGYGG--RREGEYGGDGGG-------SRYGNGGGGGGG 180 GGGGY G GGGGYGG RREG YGG GGG YG GGG GGG Sbjct: 90 GGGGYRGGRGGGGGGYGGGGRREGGYGGGGGGYGGGRREGGYGGGGGYGGG 140 [140][TOP] >UniRef100_O22385 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22385_ORYSA Length = 161 Score = 60.1 bits (144), Expect = 8e-08 Identities = 31/44 (70%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -2 Query: 296 GGGGYGEGGGGG-YGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGG YG RREG YGG GGG G GGGG GG + S Sbjct: 107 GGGGYGGGGGGGGYGQRREGGYGG-GGGYGGGRGGGGYGGGYGS 149 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 4/45 (8%) Frame = -2 Query: 296 GGGGYGE-GGGGGYGGRREGEYGGDGGGSRYG---NGGGGGGGNW 174 GGGGYG+ GGGGGYGG G YGG GGG YG GG GGGG + Sbjct: 93 GGGGYGQRGGGGGYGG---GGYGGGGGGGGYGQRREGGYGGGGGY 134 [141][TOP] >UniRef100_B8AP37 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AP37_ORYSI Length = 139 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/46 (63%), Positives = 30/46 (65%), Gaps = 3/46 (6%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGS---RYGNGGGGGGGNWRS 168 GGGGYG GGGG GGR G YGG GGG R G GG GGNWR+ Sbjct: 94 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGYGGDSGGNWRN 139 [142][TOP] >UniRef100_B7SDF0 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica Group RepID=B7SDF0_ORYSJ Length = 161 Score = 60.1 bits (144), Expect = 8e-08 Identities = 31/44 (70%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -2 Query: 296 GGGGYGEGGGGG-YGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGG YG RREG YGG GGG G GGGG GG + S Sbjct: 107 GGGGYGGGGGGGGYGQRREGGYGG-GGGYGGGRGGGGYGGGYGS 149 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 4/45 (8%) Frame = -2 Query: 296 GGGGYGE-GGGGGYGGRREGEYGGDGGGSRYG---NGGGGGGGNW 174 GGGGYG+ GGGGGYGG G YGG GGG YG GG GGGG + Sbjct: 93 GGGGYGQRGGGGGYGG---GGYGGGGGGGGYGQRREGGYGGGGGY 134 [143][TOP] >UniRef100_A2ZN20 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2ZN20_ORYSI Length = 161 Score = 60.1 bits (144), Expect = 8e-08 Identities = 32/55 (58%), Positives = 33/55 (60%), Gaps = 12/55 (21%) Frame = -2 Query: 296 GGGGYGEGGGGG-YGGRREGEYGGDG------GGSRYG-----NGGGGGGGNWRS 168 GGGGYG GGGGG YG RREG YGG G GG YG GGG GNWR+ Sbjct: 107 GGGGYGGGGGGGGYGQRREGGYGGGGGYGGGRGGGSYGGGYGSRGGGNSDGNWRN 161 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 4/45 (8%) Frame = -2 Query: 296 GGGGYGE-GGGGGYGGRREGEYGGDGGGSRYG---NGGGGGGGNW 174 GGGGYG+ GGGGGYGG G YGG GGG YG GG GGGG + Sbjct: 93 GGGGYGQRGGGGGYGG---GGYGGGGGGGGYGQRREGGYGGGGGY 134 [144][TOP] >UniRef100_Q9VX67 CG5172, isoform D n=1 Tax=Drosophila melanogaster RepID=Q9VX67_DROME Length = 172 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G+ G GGG + G GG GGGG Sbjct: 28 GGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGG 66 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGG+G GG G YGG +G +GG G G NGGGGG G + Sbjct: 58 GGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGGGGGQGGY 98 [145][TOP] >UniRef100_Q8MYW0 RH06401p n=1 Tax=Drosophila melanogaster RepID=Q8MYW0_DROME Length = 93 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G+ G GGG + G GG GGGG Sbjct: 28 GGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGG 66 [146][TOP] >UniRef100_Q7KUW8 CG5172, isoform C n=1 Tax=Drosophila melanogaster RepID=Q7KUW8_DROME Length = 106 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G+ G GGG + G GG GGGG Sbjct: 28 GGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGG 66 [147][TOP] >UniRef100_B7PFH2 Secreted salivary gland peptide, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PFH2_IXOSC Length = 120 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGGYG GGGGGYGG G YGG GGGS YG+ GGGG G+ Sbjct: 65 GGGGYGGGGGGGYGGGG-GSYGGGGGGS-YGSSGGGGYGS 102 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGG YGG G YG GGG YG+ GGGG G Sbjct: 73 GGGGYG-GGGGSYGGGGGGSYGSSGGGG-YGSSGGGGSG 109 [148][TOP] >UniRef100_A9YI01 CG5172-PA (Fragment) n=1 Tax=Drosophila melanogaster RepID=A9YI01_DROME Length = 61 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G+ G GGG + G GG GGGG Sbjct: 9 GGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGG 47 [149][TOP] >UniRef100_A9YHZ8 CG5172-PA (Fragment) n=2 Tax=Drosophila melanogaster RepID=A9YHZ8_DROME Length = 63 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G+ G GGG + G GG GGGG Sbjct: 9 GGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGG 47 [150][TOP] >UniRef100_Q0UUY3 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0UUY3_PHANO Length = 180 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGGYG GGGGGYGG G+ G GGG R G GGG GG +W Sbjct: 106 GGGGYGRGGGGGYGG---GQGGYGGGGGREGYGGGQGGASW 143 [151][TOP] >UniRef100_B6INW7 R body protein, putative n=1 Tax=Rhodospirillum centenum SW RepID=B6INW7_RHOCS Length = 157 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP +P PP PPPPP P PPPP Sbjct: 116 PPPAPPPAPPAPPPPPPP-APPPAPPAPPPPPPPPPPPP 153 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/46 (56%), Positives = 29/46 (63%), Gaps = 5/46 (10%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPP-----PPSPYPPPP 297 Q PPP PPP P PPP+PP +P PP PPP PP+P PPPP Sbjct: 102 QPPPPAPPPPPAPPPPPAPPPAPPAPPPPPPPAPPPAPPAPPPPPP 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP----PPSPYPPPP 297 PPPPP P P PPP+PP P PP PPP PP P PPPP Sbjct: 108 PPPPPAPPPPPAPPPAPPAPPPPPPPAPPPAPPAPPPPPPPPP 150 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 P PPPP P P P PP +P PP PPPPP P PPP Sbjct: 101 PQPPPPAPPPPPAPPPPPAPPPAPPAPPPPPPPAPPP 137 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PP P PPP+PP +P PP PPPPP PPPP Sbjct: 120 PPPAPPAPPPPPPPAPPPAPPAPPPPPPPPP---PPPP 154 [152][TOP] >UniRef100_C1ECP1 Resistance-nodulation-cell division superfamily n=1 Tax=Micromonas sp. RCC299 RepID=C1ECP1_9CHLO Length = 1523 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P P P PP SP PP PPPPSP PPPP Sbjct: 868 PPPPPPPFPANAPRPPPPPSP---PPAIPPPPSPLPPPP 903 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSR--RPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P+ RPP PP PP PPPP Sbjct: 859 PPPPPPPSP---PPPPPPPFPANAPRPPPPPSPPPAIPPPP 896 [153][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP P P RPP PPPP SP PPPP Sbjct: 335 PPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPP 373 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP--YSPSRRPP---*PPPPPSPYPPPP 297 PPPP PP P PPP PP YSP PP PPPPPSP PPPP Sbjct: 269 PPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPP 312 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSP-YPPPP 297 PPPPPPP+ PPP P YSP PP PPPPP P Y PPP Sbjct: 281 PPPPPPPVY-SPPPPPPVYSPPPPPPSPPPPPPPVYSPPP 319 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/47 (57%), Positives = 28/47 (59%), Gaps = 8/47 (17%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP--------YSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPPSPP YSP PP PP PP P PPPP Sbjct: 307 PPPPPPPVYSPPPPPSPPPPSPPPPVYSP---PPPPPSPPPPSPPPP 350 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/48 (58%), Positives = 28/48 (58%), Gaps = 9/48 (18%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP---YSPSRRPP*PPPP------PSPYPPPP 297 PPPPP P P EPPP PP YSP P PPPP PSP PPPP Sbjct: 448 PPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPP 495 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 8/48 (16%) Frame = +1 Query: 178 FPPPPPPPLP*REPPP--SPPYSPSRRPP*PPPP------PSPYPPPP 297 + PPPPPP P PPP SPP PS PP PPPP P P PPPP Sbjct: 298 YSPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPP 345 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPP-----PPPLP*REPPPSPPYSPSRRPP*PPPPPSPY--PPPP 297 PPPP PPP P PPPSPP+SP P PPPP PY PPPP Sbjct: 388 PPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPP 433 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPP---PPPPLP*REPPPSPPYSPSRRPP*--PPPPPSPYPPPP 297 PPP PPPP P PPP PP P PP PPPPPSP PP P Sbjct: 285 PPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSP 328 [154][TOP] >UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9EXV1_ORYSJ Length = 532 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSP P PP PPPPSP PPPP Sbjct: 363 PPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP 401 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSP P PP PPPPSP PPPP Sbjct: 381 PPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP 418 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP P P P PPPSPP PP PPPPSP PP P Sbjct: 375 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 413 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP P P P PPPSPP PP PPPPSP PP P Sbjct: 392 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 430 [155][TOP] >UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa RepID=Q8L3T8_ORYSJ Length = 570 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPPSP P PP PPPPSP PPPP Sbjct: 401 PPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP 439 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSP P PP PPPPSP PPPP Sbjct: 419 PPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP 456 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP P P P PPPSPP PP PPPPSP PP P Sbjct: 413 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 451 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP P P P PPPSPP PP PPPPSP PP P Sbjct: 430 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 468 [156][TOP] >UniRef100_B3XYC5 Chitin-binding lectin n=1 Tax=Solanum lycopersicum var. cerasiforme RepID=B3XYC5_SOLLC Length = 365 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PP PPPP P PP PP SPS PP P PPPPSP PPPP Sbjct: 138 PPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPSPSPPPP 177 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PP PPPP P PP PP SPS PP P PPPP+P PPPP Sbjct: 100 PPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPPP 139 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPP---PPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPPP P PP PP SPS PP PPPPSP PPPP Sbjct: 123 PPPTPSPPPPAPSPPPPSPPPPSPSPPPP-SPPPPSPSPPPP 163 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPPPPPPLP*REPPPS----PPYSPSRRPP*P-PPPPSPYPPPP 297 PPPP PP P PPP PP SPS PP P PPPP+P PPPP Sbjct: 148 PPPPSPPPPSPSPPPPTPSPPPPSPSPPPPTPSPPPPAPSPPPP 191 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPP-PSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PP PSPP PP PPPPSP PPPP Sbjct: 112 PPSPPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPP 151 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/41 (63%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSP-PYSPSRRPP*P-PPPPSPYPPPP 297 PPP P P P PPPSP P PS PP P PPPP+P PPPP Sbjct: 130 PPPAPSPPPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPP 170 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSP---PYSPSRRPP*P-PPPPSPYPPPP 297 PPP P P P PPPSP P +PS PP P PPPP+P PPPP Sbjct: 142 PPPSPSPPPPSPPPPSPSPPPPTPSPPPPSPSPPPPTPSPPPP 184 [157][TOP] >UniRef100_A1KR25 Cell wall glycoprotein GP2 (Fragment) n=2 Tax=Chlamydomonas reinhardtii RepID=A1KR25_CHLRE Length = 1226 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSPP + + PP PPPPP P PPPP Sbjct: 998 PPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPP 1035 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP PP P PPPSPP PS PP PPPP P P PPPP Sbjct: 962 PPPPSPPPPVLSPPPSPP-PPSPPPPAPPPPSPPPPVPPPP 1001 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/44 (63%), Positives = 29/44 (65%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-----PPSPYPPPP 297 PP PPPP+P PPPSPP PS PP PPP PPSP PPPP Sbjct: 990 PPSPPPPVP---PPPSPP-PPSPPPPSPPPAAASPPPSPPPPPP 1029 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS-----PSRRPP*PPP--PPSPYPPPP 297 PP PPPP P PPPSPP PS PP PPP PP P PPPP Sbjct: 951 PPSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPP 996 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +1 Query: 169 LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 +L PP PPPP P PPP+PP PS PP PPPP P P PPPP Sbjct: 971 VLSPPPSPPPPSP---PPPAPP-PPSPPPPVPPPPSPPPPSPPPP 1011 [158][TOP] >UniRef100_O24184 Glycine-rich RNA-binding protein n=1 Tax=Oryza sativa RepID=O24184_ORYSA Length = 165 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/44 (68%), Positives = 30/44 (68%), Gaps = 6/44 (13%) Frame = -2 Query: 296 GGGGYGE------GGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGGYG GGGGGYG RREG YGG GG YG GGGGGG Sbjct: 102 GGGGYGGRGYGGGGGGGGYGQRREGGYGGGGG---YGGGGGGGG 142 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/52 (53%), Positives = 30/52 (57%), Gaps = 9/52 (17%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGG---------GGNWRS 168 GGGGYG+ GGYGG G YGG GGG YG G GGG GNWR+ Sbjct: 116 GGGGYGQRREGGYGG--GGGYGGGGGGGGYGGGYGGGYGSRGGGNSDGNWRN 165 [159][TOP] >UniRef100_C1MIF9 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MIF9_9CHLO Length = 432 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/51 (60%), Positives = 31/51 (60%), Gaps = 9/51 (17%) Frame = -2 Query: 296 GGGGYGEGGGGGYGG---RREGEYGGDG------GGSRYGNGGGGGGGNWR 171 GGGGYG GGGGGYGG R G YGG G GG G GGGGGGG R Sbjct: 370 GGGGYGGGGGGGYGGGPDRGRGGYGGGGRDNYRGGGGYRGGGGGGGGGGGR 420 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/57 (52%), Positives = 30/57 (52%), Gaps = 18/57 (31%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGG------------------DGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G YGG GGG R G GGGGGGG Sbjct: 362 GGGGYGGGGGGGYGGGGGGGYGGGPDRGRGGYGGGGRDNYRGGGGYRGGGGGGGGGG 418 [160][TOP] >UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8HQ72_CHLRE Length = 338 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/49 (61%), Positives = 30/49 (61%), Gaps = 6/49 (12%) Frame = -2 Query: 296 GGGGYGEGGGGGYG------GRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGYG G G YGG GGG G GG GGGG RS Sbjct: 107 GGGGYGGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGSGGGGGGRS 155 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGGYGG G YGG GGG YG GGGG GG Sbjct: 99 GGGGGGYGGGGGYGGGGGGGYGGGGGG--YGGGGGGYGG 135 [161][TOP] >UniRef100_B4NC76 GK25807 n=1 Tax=Drosophila willistoni RepID=B4NC76_DROWI Length = 234 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGGYG GG GG+GG + G GG G G GNGGGG GGN Sbjct: 129 GGGGYGGGGSGGFGGGKHGGGGGGGYGGNGGNGGGGYGGN 168 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GG GG+GG G++GG GGG YG GG GG G Sbjct: 107 GGGGYGGGGSGGFGG---GKHGGGGGGGGYGGGGSGGFG 142 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGG G GG GG GG G GG GGG GNGGGG GGN Sbjct: 148 GGGGGGYGGNGGNGGGGYGGNGGGGGGKHGGNGGGGYGGN 187 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/42 (61%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Frame = -2 Query: 296 GGGGYG---EGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGG +GG G YGG+GGG +GGGGGGG Sbjct: 161 GGGGYGGNGGGGGGKHGGNGGGGYGGNGGGGGGKHGGGGGGG 202 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/45 (64%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = -2 Query: 296 GGGGYGEGGG--GGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGG GG GG G YGG GGGS G GGGG GG +S Sbjct: 40 GGGGYGGGGGSHGGGGGNGGGGYGG-GGGSHGGGGGGGYGGGSKS 83 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGG +G GGGGGYGG GG+GGG GNGGGGGG Sbjct: 142 GGGKHGGGGGGGYGGN-----GGNGGGGYGGNGGGGGG 174 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/44 (59%), Positives = 29/44 (65%), Gaps = 6/44 (13%) Frame = -2 Query: 296 GGGGYGEGGG------GGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGGYG GG GG GG G++GG+GGG GNGGGGGG Sbjct: 150 GGGGYGGNGGNGGGGYGGNGGGGGGKHGGNGGGGYGGNGGGGGG 193 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/42 (61%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Frame = -2 Query: 296 GGGGYG---EGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGG +GG G YGG+GGG +GGGGGGG Sbjct: 180 GGGGYGGNGGGGGGKHGGGGGGGYGGNGGGGGGKHGGGGGGG 221 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/44 (56%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGR---REGEYGGDGGGSRYGNGGGGGGGNW 174 GGG +G GGGGGYGG G++GG GGG G GGG GG W Sbjct: 191 GGGKHGGGGGGGYGGNGGGGGGKHGGGGGGGYGGGGGGKHGGGW 234 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/41 (60%), Positives = 28/41 (68%), Gaps = 3/41 (7%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREG---EYGGDGGGSRYGNGGGGGG 183 GGG +G GGGGYGG G ++GG GGG GNGGGGGG Sbjct: 172 GGGKHGGNGGGGYGGNGGGGGGKHGGGGGGGYGGNGGGGGG 212 [162][TOP] >UniRef100_B0XB79 Gly-rich protein n=1 Tax=Culex quinquefasciatus RepID=B0XB79_CULQU Length = 299 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 3/46 (6%) Frame = -2 Query: 296 GGGGY---GEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGY G GGGGG GG G +GG GGG G+GGGGGGG++ S Sbjct: 36 GGGGYSSGGHGGGGGGGGYSSGGHGGSGGGFSGGHGGGGGGGSFSS 81 [163][TOP] >UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019841A9 Length = 525 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +1 Query: 169 LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*---PPPPPSPYPPPP 297 +L PPPP PP P PPP P YSP PP PPPPP P PPPP Sbjct: 439 VLSSPPPPSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPPP 484 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPP---PPPLP*REPPPSPP-YSPSRRPP*PPPPPSPYPPPP 297 PPPP PPP P PPP PP YSP PP PPPPP PPP Sbjct: 448 PPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPPPVXSPPP 490 [164][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP+PP P PP PPPPP+P PPP Sbjct: 626 PPPPPPPPPAPPPPPAPPPPP---PPAPPPPPAPPPPP 660 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRP-P*PPPPPSPYPPPP 297 PPPPPPP P P P PP +P+ P P PPPPP P PPPP Sbjct: 642 PPPPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPP 681 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PP-PPPSPYPPPP 297 PPP PPP P PPP+PP P+ PP PP PPP P PPPP Sbjct: 620 PPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPP 659 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPP PP P PPP P P PP PPPPP+P PPP Sbjct: 645 PPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPP 682 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P P P P P PP PPPPP P PPPP Sbjct: 601 PPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPP 639 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPP P P PPP PP +P PP PPPPP+P PPP Sbjct: 630 PPPPPAPPPPPAPPPPPPPAPP-PPPAPPPPPAPAPPP 666 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPP PPP P PPP+PP P PP PPPPP+P PPP Sbjct: 652 PPPAPPPPPAPAPPPAPP-PPPPPPPAPPPPPAPPPPP 688 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PP P+ PP PPPP PPPP Sbjct: 656 PPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPPPP 694 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP P +P PP PPPPP PPPP Sbjct: 644 PPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPP 682 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PP-PPPSPYPPPP 297 P PPPPP P P P+PP +P PP PP PPP P PPPP Sbjct: 648 PAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPP 687 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/42 (57%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*---PPPPPSPYPPPP 297 P PPPPP P PPP+PP P+ PP PPP P P PPPP Sbjct: 634 PAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPP 675 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP P PP P PP PP P PP PPPPP+P PPPP Sbjct: 610 PPAPAPPAP-APPPAPPPPPPPPPPPAPPPPPAPPPPPP 647 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P P PPP P PPP PP +P P PPPPP PPPP Sbjct: 616 PAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPP 654 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP+P P+ PP PPPP P PP P Sbjct: 646 PPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAP 684 [165][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP P PP PPP P P PPP Sbjct: 96 PPPPPPPPPPPPPPPPPPTPPPTPPPTPPPTPPPTPPP 133 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPPPPPLP*REPPP-------SPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP SPP +P + PP PPPPP P PPPP Sbjct: 66 PPPTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPP 111 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 7/46 (15%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP-------YSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP+PP SP PP PPPPP P PPPP Sbjct: 62 PPPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPP 107 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP +P PP +PP P PP PPPPP P PP P Sbjct: 78 PPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTP 115 [166][TOP] >UniRef100_Q4A373 Putative lectin protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A373_EHV86 Length = 1994 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 QFP P PPP P PPPSPP P + PP PPPP P P+PPPP Sbjct: 1439 QFPSPSPPPSPPPSPPPSPP--PLQPPPSPPPPLLPPPFPPPP 1479 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP PPPP P PPPP Sbjct: 491 PPPTPPPSP-PPPPPSPPPSPFLPPPSLPPPPPPSPPPP 528 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PP SPP P PP PPPPP P PPPP Sbjct: 1694 PPSPPPPSP--PPPASPPLLPPA-PPSPPPPPDPAPPPP 1729 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSP---PYSPSRRPP*PPPP---PSPYPPPP 297 PPPPP P P PPPSP P SP PP PPPP PSP PPPP Sbjct: 205 PPPPPSPFP-PSPPPSPAPPPPSPLPPPPLPPPPSPAPSPPPPPP 248 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP-*PPPPPSPYPP 291 PP PPPP P PPPSPP PS PP PP PP PY P Sbjct: 694 PPSPPPPSPPSPPPPSPPPPPSPPPPSLPPSPPPPYAP 731 [167][TOP] >UniRef100_Q61078 Wiscott-Aldrich Syndrome protein homolog n=1 Tax=Mus musculus RepID=Q61078_MOUSE Length = 520 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP R PP PP + PP PPPPP P PPPP Sbjct: 384 PPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPPPP 422 [168][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*-PPPPPSPYPPP 294 PPP PPP P PPPSPP PS PP PPPPPSP PPP Sbjct: 527 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 565 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*-PPPPPSPYPPP 294 PPP PPP P PPPSPP PS PP PPPPPSP PPP Sbjct: 533 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 571 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*-PPPPPSPYPPP 294 PPP PPP P PPPSPP PS PP PPPPPSP PPP Sbjct: 539 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 577 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*-PPPPPSPYPPP 294 PPP PPP P PPPSPP PS PP PPPPPSP PPP Sbjct: 545 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 583 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*-PPPPPSPYPPP 294 P PPPPP P PPPSPP PS PP PPPPPSP PPP Sbjct: 523 PSPPPPPSP--PPPPSPPPPPSPPPPPSPPPPPSPPPPP 559 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPS-RRPP*PPPPPSPYPPP 294 PPP PPP P PPPSPP PS PP PPPPPSP PP Sbjct: 551 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPP 589 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/51 (54%), Positives = 28/51 (54%), Gaps = 12/51 (23%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPS-RRPP*PPP-----------PPSPYPPPP 297 PPP PPP P PPPSPP PS R PP PPP PPSP PP P Sbjct: 563 PPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQPPSPPSPSPPSP 613 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/49 (55%), Positives = 27/49 (55%), Gaps = 10/49 (20%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPS-------RRPP*PPP---PPSPYPPPP 297 PPP PPP P PPPSPP PS R PP PPP PP P PP P Sbjct: 557 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQPPSP 605 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*-PPPPPSPYPPP 294 P PP P P R PPSPP PS PP PPPPPSP PPP Sbjct: 510 PRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPP 547 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP P PP P PPPSPP PS PP P PPP P PPPP Sbjct: 517 PPRPSPPSP--PPPPSPPPPPSPPPP-PSPPPPPSPPPP 552 [169][TOP] >UniRef100_C1MSQ5 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MSQ5_9CHLO Length = 1516 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PP PP + S +PP PPPPP P P PP Sbjct: 1047 PPPPPPPPPPPSPPSPPPPNGSPQPPPPPPPPPPLPSPP 1085 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PP P SP PP PPPPP P PPP Sbjct: 1049 PPPPPPPPPSPPSPPPPNGSPQPPPPPPPPPPLPSPPP 1086 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPS----PPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP+ PP P PP P PPPSP PP P Sbjct: 1051 PPPPPPPSPPSPPPPNGSPQPPPPPPPPPPLPSPPPSPPPPSP 1093 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 Q PPPPPPP P PPPSPP PS P PPPPP P P Sbjct: 1070 QPPPPPPPPPPLPSPPPSPP-PPSPSPSPPPPPPYALPTSP 1109 [170][TOP] >UniRef100_C1EFP7 Receptor-like cell wall protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EFP7_9CHLO Length = 1985 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/45 (60%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +1 Query: 169 LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 L+ PPPPPPP P PPP P PS PP PPP PP P PPPP Sbjct: 1455 LVANPPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 1499 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS----PSRRPP*PPP--PPSPYPPPP 297 PPPPPP P PPPSPP PS PP PPP PP P PPPP Sbjct: 1460 PPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 1504 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 1481 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPLPPPP 1519 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPP--PPSPYPPPP 297 PPPP P P PPPSPP PS PP PPP PP P PPPP Sbjct: 1471 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 1509 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 1476 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPP 1514 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPP--PSPYPPPP 297 PPPP P P PPPSPP PS PP PPPP P P PPPP Sbjct: 1486 PPPPSPPPPSPPPPSPP-PPSPPPPSPPPPLPPPPSPPPP 1524 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPP--YSPSRRPP*PPPPPSPYPP 291 PP PPPPLP PPPSPP SP P PPPPP P+PP Sbjct: 1508 PPSPPPPLP---PPPSPPPPSSPPPMSPSPPPPPPPFPP 1543 [171][TOP] >UniRef100_B9GV34 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GV34_POPTR Length = 151 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/46 (58%), Positives = 30/46 (65%), Gaps = 5/46 (10%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPY-----PPPP 297 Q PPPPPPP P PPP+P +P PP PPPPP+PY PPPP Sbjct: 56 QLPPPPPPPPPPPPPPPTPYCTPLAPPP-PPPPPTPYCSPLAPPPP 100 [172][TOP] >UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PES6_VITVI Length = 486 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +1 Query: 169 LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*---PPPPPSPYPPPP 297 +L PPPP PP P PPP P YSP PP PPPPP P PPPP Sbjct: 439 VLSSPPPPSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPPP 484 [173][TOP] >UniRef100_A4S6G3 Predicted protein (Fragment) n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S6G3_OSTLU Length = 2146 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP+P PPPSPP P PP PPPPP P PPPP Sbjct: 933 PPPPPPVP-SPPPPSPP--PPSPPPLPPPPPPPSPPPP 967 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP-PSPYPPPP 297 PPPP PP P PP PP PS PP PPPP P P PPPP Sbjct: 920 PPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPP 959 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP P SPS PP P PPSP PPPP Sbjct: 886 PPSPPPPSPLPSPPPPSPPSPSPPPP-SPLPPSPSPPPP 923 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 172 LQFPPPPPPPLP*REPPPSP-PYSPSRRPP*PPPPPSPYPPPP 297 L PPPP PP P PPPSP P SPS PP PP P P PPPP Sbjct: 895 LPSPPPPSPPSP-SPPPPSPLPPSPSPPPPSPPSPSPPSPPPP 936 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = +1 Query: 178 FPPPPPPPLP*REPPPSP-PYSPSRRPP*P-PPPPSPYPPPP 297 FP PPP P P PPPSP P P PP P PPPPSP PP P Sbjct: 877 FPSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSP 918 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPS-PYPPPP 297 PPPP PLP P P PP PS PP PPPPP P PPPP Sbjct: 908 PPPPSPLP-PSPSPPPPSPPSPSPPSPPPPPPVPSPPPP 945 [174][TOP] >UniRef100_P70315 Wiskott-Aldrich syndrome protein homolog n=2 Tax=Mus musculus RepID=WASP_MOUSE Length = 520 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP R PP PP + PP PPPPP P PPPP Sbjct: 384 PPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPPPP 422 [175][TOP] >UniRef100_Q3B0Y9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. CC9902 RepID=Q3B0Y9_SYNS9 Length = 196 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 2/40 (5%) Frame = -2 Query: 296 GGGGYGEGGGGGY--GGRREGEYGGDGGGSRYGNGGGGGG 183 GGGGYG GGGGG GG G YGG GGG YG GGGGGG Sbjct: 89 GGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGG 128 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -2 Query: 296 GGGGYGEGGGGG--YGGRREGEYGGDGGGSRYGNGGGGG 186 GGGGYG GGGGG GG G YGG GGG YG GGGGG Sbjct: 98 GGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGG 136 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGG G GGGGG GG YGG GGG YG GGGGGG Sbjct: 87 GGGGGGYGGGGGGGG-----YGGGGGGGGYGGGGGGGG 119 [176][TOP] >UniRef100_Q8LPB1 Glycine-rich RNA-binding protein n=1 Tax=Physcomitrella patens RepID=Q8LPB1_PHYPA Length = 178 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 23/65 (35%) Frame = -2 Query: 296 GGGGYGEGGGGGYG----------------GRREGEYGGDGGGSRYGNGGGGGG------ 183 GGGGYG GGGGGYG G G YGG GG YG+GGGGGG Sbjct: 107 GGGGYGGGGGGGYGAGGGGAYGSRSSYDREGGGGGGYGGSRGGGGYGSGGGGGGGRGGSG 166 Query: 182 -GNWR 171 GNWR Sbjct: 167 SGNWR 171 [177][TOP] >UniRef100_Q40426 RNA-binding glycine-rich protein-1a n=1 Tax=Nicotiana sylvestris RepID=Q40426_NICSY Length = 156 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/53 (64%), Positives = 34/53 (64%), Gaps = 10/53 (18%) Frame = -2 Query: 296 GGGGY---GEGGGGGYGG-RREGEYGGDGGGSRYGNG------GGGGGGNWRS 168 GGGG G GGGGGYGG RREG YGG GGG YG G GGG GNWRS Sbjct: 105 GGGGRREGGYGGGGGYGGGRREGGYGGGGGGG-YGGGRREGGYGGGSEGNWRS 156 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/46 (65%), Positives = 31/46 (67%), Gaps = 5/46 (10%) Frame = -2 Query: 296 GGGGYGEGGGGGYGG--RREGEYGGD---GGGSRYGNGGGGGGGNW 174 GGGGY G GGGYGG RREG YGG GGG R G GGGGGG + Sbjct: 92 GGGGYRGGSGGGYGGGGRREGGYGGGGGYGGGRREGGYGGGGGGGY 137 [178][TOP] >UniRef100_B9MU29 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MU29_POPTR Length = 398 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGG GEGGG GYGG GE GG GGG+ G+ GGGGGG Sbjct: 305 GGGSGEGGGAGYGGYGGGEGGGHGGGAEGGHAGGGGGG 342 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG+G GGGGG+GG EG + G GGG G GGGGGGG Sbjct: 339 GGGGFGGGGGGGHGGGAEGGHAGGGGG---GFGGGGGGG 374 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Frame = -2 Query: 296 GGGGYGEGGGGGYG-----GRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGGYG G G GG+GGG+ YG GG GGG Sbjct: 62 GGGGSGGGGGGGYGAVGEHGAGYGGGGGEGGGAGYGGAGGHGGG 105 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 G GGYG G GGG+GG EG + G GGG G GGGG GG Sbjct: 315 GYGGYGGGEGGGHGGGAEGGHAGGGGGGFGGGGGGGHGG 353 [179][TOP] >UniRef100_A7UTZ4 AGAP005965-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UTZ4_ANOGA Length = 113 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/41 (65%), Positives = 27/41 (65%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGG G GGGGG GG G GG GGG G GGGGGGG W Sbjct: 15 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGW 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 6 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 7 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 8 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 46 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 10 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 11 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 12 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 13 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 14 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 52 [180][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPPPPPPL-----P*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ P PPP PP P PP PPPPP P PPPP Sbjct: 121 PPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPP 164 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS-PSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP PP P PP PPPPP P PPPP Sbjct: 173 PPCPPPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPP 212 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PP PPPP+P PPPP Sbjct: 148 PPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPP 186 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPL---P*REPPPSPPYSPSRRPP*P-PPPPSPYPPPP 297 PPPPPPP+ P PPP PP P PP P PPPP+P PPPP Sbjct: 184 PPPPPPPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAPCPPPP 226 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSR----RPP*PPPPPSPYPPPP 297 PP PPPP P PPP PP P PP PPPPP P PPPP Sbjct: 110 PPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPP 152 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPP--PPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPPP PPP PP P PP PPPPP P PPPP Sbjct: 125 PPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 165 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PP----PPPSPYPPPP 297 PPPPPP P PPP PP P PP PP PPP P PPPP Sbjct: 138 PPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPP 179 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPP P P+ PP PPPPP PPPP Sbjct: 159 PPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPP 197 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPP P PPP P PP PPPPP P PPPP Sbjct: 120 PPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPP 157 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPP P PP PPPPP P PPPP Sbjct: 120 PPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPP 158 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPP PP P P PPPPP P PP P Sbjct: 183 PPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAP 221 [181][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPLP PPP P P+ PP PPPPP P PPPP Sbjct: 372 PPPPPPLP--PPPPRPVPPPAPPPPPPPPPPPPRPPPP 407 [182][TOP] >UniRef100_UPI00005A2A7A PREDICTED: hypothetical protein XP_857205 isoform 4 n=2 Tax=Canis lupus familiaris RepID=UPI00005A2A7A Length = 288 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/52 (55%), Positives = 29/52 (55%), Gaps = 13/52 (25%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P--------PPPPSPY-----PPPP 297 PPPPPP P R PPP PPY P R PP P PPPP PY PPPP Sbjct: 47 PPPPPPYGPGRIPPPPPPYGPGRIPPPPLPYGPGRIPPPPPPYGPGRIPPPP 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 13/54 (24%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*P--------PPPPSPY-----PPPP 297 + PPPPPP P R PPP PY P R PP P PPPP PY PPPP Sbjct: 57 RIPPPPPPYGPGRIPPPPLPYGPGRIPPPPPPYGPGRIPPPPPPYGTGRIPPPP 110 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 13/54 (24%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPPYSPSRRPP*P--------PPPPSPY-----PPPP 297 + PPPP P P R PPP PPY P R PP P PPPP PY PPPP Sbjct: 69 RIPPPPLPYGPGRIPPPPPPYGPGRIPPPPPPYGTGRIPPPPLPYGPGRIPPPP 122 [183][TOP] >UniRef100_UPI00000216EF glyceraldehyde-3-phosphate dehydrogenase, spermatogenic n=1 Tax=Mus musculus RepID=UPI00000216EF Length = 440 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSR---RPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P P + PP PPPPP P PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPP 98 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 7/48 (14%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPP-------YSPSRRPP*PPPPPSPYPPPP 297 Q PPPPPPP P PPP PP + + PP PPPPP P PPPP Sbjct: 53 QPPPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPP 100 [184][TOP] >UniRef100_B4YB55 BimA n=1 Tax=Burkholderia pseudomallei RepID=B4YB55_BURPS Length = 369 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/52 (51%), Positives = 30/52 (57%) Frame = +1 Query: 142 KP*GKQTI*LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 KP G +T+ PPPPPPP PPP PP P PP PPP +P PPPP Sbjct: 72 KPVGDRTLPNKVPPPPPPPPSTTTPPPPPPPPPPPPPPPPPPPSTTPSPPPP 123 [185][TOP] >UniRef100_A4S1A8 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S1A8_OSTLU Length = 388 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 118 PPPSPPPSPPPSPPPSPPPSPPPNPP-PSPPPSPPPSPP 155 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 90 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 127 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 94 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 131 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 98 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 135 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 102 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 139 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 130 PPPSPPPSPPPNPPPSPPPSPPPSPP-PSPPPSPPPSPP 167 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 106 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPNPP 143 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 114 PPPSPPPSPPPSPPPSPPPSPPPSPP-PNPPPSPPPSPP 151 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPP+P P PP Sbjct: 110 PPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPNPPPSPP 147 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP +P PP P PPPSP P PP Sbjct: 122 PPPSPPPSPPPSPPPSPPPNPPPSPP-PSPPPSPPPSPP 159 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP+PP SP PP P PPPSP P PP Sbjct: 126 PPPSPPPSPPPSPPPNPPPSPPPSPP-PSPPPSPPPSPP 163 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP PPP P P PP P Sbjct: 134 PPPSPPPNPPPSPPPSPPPSP---PPSPPPSPPPSPPVP 169 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +1 Query: 187 PPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPP P PPPSPP SP PP P PPPSP P PP Sbjct: 88 PSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPP 123 [186][TOP] >UniRef100_A4RWC6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RWC6_OSTLU Length = 4003 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/42 (66%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P---PPPPSPYPPPP 297 PPP PPP P PPPSPP SP PP P PPPPSP PPPP Sbjct: 1547 PPPSPPPSP---PPPSPPPSPPPPPPPPSPPPPPPSPPPPPP 1585 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP PP P P PP PPSP PPPP Sbjct: 1561 PPSPPPPPPPPSPPPPPPSPPPPPPSPPPSPPSPPPPPP 1599 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPP-SPYPPPP 297 PPP PPP P PPP PP SP PP PPPPP SP P PP Sbjct: 1556 PPPSPPPSP---PPPPPPPSPPPPPPSPPPPPPSPPPSPP 1592 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PP-PPPSPYPPPP 297 PPP PPP P PPPSPP P PP PP PPPSP PPP Sbjct: 1560 PPPSPPPPP---PPPSPPPPPPSPPPPPPSPPPSPPSPPP 1596 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPP PP PS PP P PPP P PPP Sbjct: 1552 PPSPPPPSPPPSPPPPPP-PPSPPPPPPSPPPPPPSPPP 1589 [187][TOP] >UniRef100_Q6UDW6 Erythrocyte membrane protein 1 n=1 Tax=Plasmodium falciparum RepID=Q6UDW6_PLAFA Length = 2322 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP 291 PPP PP P R PPPS P PSR PP PPPPP+P PP Sbjct: 1698 PPPSRPPPPSRPPPPSRPPPPSRPPPPPPPPPAPRPP 1734 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP--*PPPPPSPYPPPP 297 PPP PP P R PPPS P PSR PP PPPP P PPPP Sbjct: 1686 PPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPPPP 1726 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRP----P*PPPPPSPYPPPP 297 PPP PP P R PPPS P PSR P P PPPPP P P PP Sbjct: 1692 PPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPPPPPPPAPRPP 1734 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PP P R PPPS P PSR PP PPP PPPP Sbjct: 1662 PPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPP 1700 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PP P R PPPS P PSR PP PPP PPPP Sbjct: 1668 PPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPP 1706 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PP P R PPPS P PSR PP PPP PPPP Sbjct: 1674 PPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPP 1712 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PP P R PPPS P PSR PP PPP PPPP Sbjct: 1680 PPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPPSRPPPP 1718 [188][TOP] >UniRef100_Q64467 Glyceraldehyde-3-phosphate dehydrogenase, testis-specific n=1 Tax=Mus musculus RepID=G3PT_MOUSE Length = 440 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSR---RPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P P + PP PPPPP P PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPP 98 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 7/48 (14%) Frame = +1 Query: 175 QFPPPPPPPLP*REPPPSPP-------YSPSRRPP*PPPPPSPYPPPP 297 Q PPPPPPP P PPP PP + + PP PPPPP P PPPP Sbjct: 53 QPPPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPP 100 [189][TOP] >UniRef100_Q7V9D6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9313 RepID=Q7V9D6_PROMM Length = 199 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G YGG GGG YG GG GGGG Sbjct: 97 GGGGYGGGGGGGYGG-GGGGYGGGGGG--YGGGGYGGGG 132 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G GG GG YG GG GGGG Sbjct: 105 GGGGYG-GGGGGYGGGGGGYGGGGYGGGGYGGGGYGGGG 142 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 G GG G GGGGGYGG G YGG GGG YG GGGG GG Sbjct: 89 GYGGGGGGGGGGYGGGGGGGYGGGGGG--YGGGGGGYGG 125 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/38 (73%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDG-GGSRYGNGGGGG 186 GGGGYG GGGGGYGG G YGG G GG YG GGGGG Sbjct: 112 GGGGYG-GGGGGYGG---GGYGGGGYGGGGYGGGGGGG 145 [190][TOP] >UniRef100_C5CY78 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CY78_VARPS Length = 137 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G G GGG R G GGG GGG Sbjct: 91 GGGGYGGGGGGGYGGGGGGGGYGGGGGGRSGGGGGYGGG 129 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGG G GGGGG GG G G GGG YG GGGGG G + Sbjct: 97 GGGGGGYGGGGGGGGYGGGGGGRSGGGGGYGGGGGGGRGGY 137 [191][TOP] >UniRef100_Q9SIH2 Putative uncharacterized protein At2g36120 n=1 Tax=Arabidopsis thaliana RepID=Q9SIH2_ARATH Length = 255 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGG GEGGG GYGG G +GG GGG G GGGGGG + Sbjct: 105 GGGSGEGGGAGYGGGEAGGHGGGGGGGAGGGGGGGGGAH 143 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGG G G GGGYGG G +GG GGG GNGGGGGGG+ Sbjct: 148 GGGQGAGAGGGYGGGGAGGHGGGGGG---GNGGGGGGGS 183 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/43 (65%), Positives = 30/43 (69%), Gaps = 3/43 (6%) Frame = -2 Query: 296 GGGGYGEGG--GGGYGGRR-EGEYGGDGGGSRYGNGGGGGGGN 177 GGGG G GG GGGYGG + G GG GGG G+GGGGGGGN Sbjct: 133 GGGGGGGGGAHGGGYGGGQGAGAGGGYGGGGAGGHGGGGGGGN 175 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -2 Query: 296 GGGGYGEGGG--GGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GG GYG G G GG GG EG GG GGG G GGGGGG Sbjct: 58 GGSGYGGGSGEGGGAGGHGEGHIGGGGGGGHGGGAGGGGGG 98 [192][TOP] >UniRef100_C6SV67 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SV67_SOYBN Length = 156 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/64 (50%), Positives = 36/64 (56%), Gaps = 21/64 (32%) Frame = -2 Query: 296 GGGGYGEGGG-------GGYGGRREGEYGGDGGG---------SRYGNGG-----GGGGG 180 GGGGYG GGG GGYGGRREG Y +GGG YG+GG GGG G Sbjct: 93 GGGGYGSGGGYNRSGGTGGYGGRREGAYNRNGGGYGGDRDHRYGPYGDGGSRYSRGGGDG 152 Query: 179 NWRS 168 +WR+ Sbjct: 153 SWRN 156 [193][TOP] >UniRef100_B4FQ70 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FQ70_MAIZE Length = 140 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 8/50 (16%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNG--------GGGGGGNWR 171 GGGG G GGG G GGRREG GG GGG YG GGGGGG WR Sbjct: 90 GGGGGGYGGGRGGGGRREGGGGGYGGGGGYGGRREGGGGGYGGGGGGGWR 139 [194][TOP] >UniRef100_B4R5R3 GD17265 n=1 Tax=Drosophila simulans RepID=B4R5R3_DROSI Length = 283 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGG G GGGGG GG + GG GGG YG GGGGGGG++ Sbjct: 243 GGGGGGGGGGGGGGGGGDDGGGGGGGGDDYGGGGGGGGGDY 283 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGG G GGGGG GG G GG GGG G GGGGGG ++ Sbjct: 232 GGGGGGGGGGGGGGGGGGGGGGGGGGGGDDGGGGGGGGDDY 272 [195][TOP] >UniRef100_B3MYN1 GF22178 n=1 Tax=Drosophila ananassae RepID=B3MYN1_DROAN Length = 223 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/41 (65%), Positives = 28/41 (68%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGGYG GGGGGY G G Y G GGG +G GGGGGG W Sbjct: 136 GGGGYGGGGGGGYHGGGGGGYPGGGGGGYHG-GGGGGGPQW 175 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/48 (60%), Positives = 32/48 (66%), Gaps = 5/48 (10%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEY--GGDGGGSRYGNGGGGGG---GNWRS 168 GGGGY GGGGGY G G Y GG GGG ++G GGGGGG G+W S Sbjct: 144 GGGGYHGGGGGGYPGGGGGGYHGGGGGGGPQWGGGGGGGGGGAGSWAS 191 [196][TOP] >UniRef100_A8NMH4 Glycine-rich cell wall structural protein 1, putative n=1 Tax=Brugia malayi RepID=A8NMH4_BRUMA Length = 300 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGGS G+GGGGGGG Sbjct: 54 GGGGGGGGGGGGGGGDASGGGGGSGGGSDAGDGGGGGGG 92 [197][TOP] >UniRef100_C9J285 Putative uncharacterized protein ENSP00000392404 (Fragment) n=1 Tax=Homo sapiens RepID=C9J285_HUMAN Length = 446 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGG G GGGGG GGR G GG GGGS G+GGGGGG Sbjct: 75 GGGGGGGGGGGGGGGRGSGRDGGGGGGSGGGDGGGGGG 112 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GGR G GG GGG G GGGGGGG Sbjct: 50 GGGGGGGGGGGGGGGRGSGGDGGGGGGGGGGGGGGGGGG 88 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GGDGGG G GGGGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGRGS-GGDGGGGGGGGGGGGGGG 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GGR G GG GGG G GG GGGG Sbjct: 188 GGGGGGRGGGGGGGGRGGGGDGGGGGGGGDGGGGEGGGG 226 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGG G GGGGG GGR G GG GG S G+GGGGGG Sbjct: 1 GGGGGRGGGGGGGGRGGGGGGGGGGSSGGGDGGGGGG 37 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWR 171 GGGG G GGGGG G +G GG GGG G GGGGG G+ R Sbjct: 53 GGGGGGGGGGGGRGSGGDGGGGGGGGGGGGGGGGGGGRGSGR 94 [198][TOP] >UniRef100_P49310 Glycine-rich RNA-binding protein GRP1A n=1 Tax=Sinapis alba RepID=GRP1_SINAL Length = 166 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/44 (68%), Positives = 30/44 (68%), Gaps = 2/44 (4%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGG--SRYGNGGGGGGGNWR 171 GGGGYG GGGG GG REG Y G GGG SR G GGG GGG R Sbjct: 106 GGGGYGGGGGGYGGGGREGGYSGGGGGYSSRGGGGGGYGGGGRR 149 [199][TOP] >UniRef100_UPI0000E12BCF Os07g0596300 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E12BCF Length = 754 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*RE---PPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPP PP + S PP PPPPPSP PPPP Sbjct: 143 PPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPP 184 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPSPP PS PP PPP P PPPP Sbjct: 157 PPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPP 195 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 9/47 (19%) Frame = +1 Query: 184 PPPPPPLP*RE---------PPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPP P R PPP PP PS P PPPPP P PPPP Sbjct: 43 PPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPP 89 [200][TOP] >UniRef100_UPI00015DEC3D chromodomain helicase DNA binding protein 3 n=1 Tax=Mus musculus RepID=UPI00015DEC3D Length = 78 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 3/41 (7%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*P---PPPPSPYPPPP 297 PPPPPPLP PPP PP P R PP P PPPP P PPPP Sbjct: 37 PPPPPPLP-PPPPPGPPPLPRRTPPPPLPRPPPPPPPPPPP 76 [201][TOP] >UniRef100_Q8YQB7 All3916 protein n=1 Tax=Nostoc sp. PCC 7120 RepID=Q8YQB7_ANASP Length = 383 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP PP PPPPP P PPPP Sbjct: 319 PPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPP 357 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPPP P PPP PP P PP PPPP P PPPP Sbjct: 344 PDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPPP 382 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*-PPPPPSPYPPPP 297 PPPPP P P PPP PP P PP PPPPP P PPPP Sbjct: 324 PPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPP 363 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PP-PPPSPYPPPP 297 PPPP PP P PPP PP P PP PP PPP P PPPP Sbjct: 330 PPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPP 369 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P +PPP PP P PP PPPP P PPPP Sbjct: 340 PPPPPDPPPPPDPPPPPPPDPPP-PPDPPPPDRPPPPPP 377 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP P PP PP PP P PPP Sbjct: 336 PPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPP 374 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +1 Query: 181 PPPP--PPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPP PPP P PPP PP P PP PPPPP P PPP Sbjct: 312 PPPPSDPPPPPDPPPPPDPP-PPDPPPPDPPPPPDPPPPP 350 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P +PPP P P PP PPPP PPPP Sbjct: 318 PPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPP 356 [202][TOP] >UniRef100_B9LBU3 Putative uncharacterized protein n=1 Tax=Chloroflexus sp. Y-400-fl RepID=B9LBU3_CHLSY Length = 340 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P +P PP PPPPP P PPPP Sbjct: 287 PPPPPPPPPTVAPPPPPTVAP---PPPPPPPPPPPPPPP 322 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPS--PPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP+ PP P+ PP PPPPP P PPPP Sbjct: 284 PPPPPPPPP---PPPTVAPPPPPTVAPPPPPPPPPPPPPPP 321 [203][TOP] >UniRef100_A9WHI6 Putative uncharacterized protein n=1 Tax=Chloroflexus aurantiacus J-10-fl RepID=A9WHI6_CHLAA Length = 344 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP P +P PP PPPPP P PPPP Sbjct: 291 PPPPPPPPPTVAPPPPPTVAP---PPPPPPPPPPPPPPP 326 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPS--PPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP+ PP P+ PP PPPPP P PPPP Sbjct: 288 PPPPPPPPP---PPPTVAPPPPPTVAPPPPPPPPPPPPPPP 325 [204][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPPLP PPPSPP PP PPPPSP PPPP Sbjct: 1219 PPPPPPPLP---PPPSPP-----PPPPSPPPPSPPPPPP 1249 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPP-PPSPYPPPP 297 PPPP PP P PPP PP P PP PPP PP P PPPP Sbjct: 1208 PPPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPPPPSPPPP 1247 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*RE--PPPSPPYSPSRRPP*PP--PPPSPYPPPP 297 P PPPP P R PPPSPP P PP PP PPPSP PPPP Sbjct: 1195 PSPPPPGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPPPPP 1237 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPP P PPP PP P PP PPPPP P PPPP Sbjct: 1206 PAPPPPSPPPPPPPPPPPPPLPPPPSPPPPP-PSPPPP 1242 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPP P PP PP SP PP PPPP P PPP Sbjct: 1213 PPPPPPPPPPPPPLPPPPSPPPPPPSPPPPSPPPPPP 1249 [205][TOP] >UniRef100_C1FHQ4 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FHQ4_9CHLO Length = 1159 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP SP R PP P PPP+P PPPP Sbjct: 324 PPPPSPPPPGPPPPPLPPPSP-RAPPSPNPPPAPPPPPP 361 [206][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPPLP PPPSPP P P PPPPPS PPPP Sbjct: 52 PPPPPPPLP---PPPSPPPPP----PPPPPPPSKSPPPP 83 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSPP P PP P PPP P PPPP Sbjct: 39 PPSPPPPFP---PPPSPPPPPPPLPPPPSPPPPPPPPPP 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYP---PPP 297 PPPP P P PPP PP P PP PPPPP P P PPP Sbjct: 42 PPPPFPPPPSPPPPPPPLPPPPSPPPPPPPPPPPPSKSPPP 82 [207][TOP] >UniRef100_B9FY87 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FY87_ORYSJ Length = 1589 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*RE---PPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPP PP + S PP PPPPPSP PPPP Sbjct: 978 PPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPP 1019 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPSPP PS PP PPP P PPPP Sbjct: 992 PPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPP 1030 [208][TOP] >UniRef100_Q17G68 Formin 1,2/cappuccino n=1 Tax=Aedes aegypti RepID=Q17G68_AEDAE Length = 891 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 5/44 (11%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPY-----SPSRRPP*PPPPPSPYPPPP 297 PPP PPPLP PPP PP +P PP PPPPP P PPPP Sbjct: 299 PPPLPPPLPPPHPPPPPPMFKTAVAPPGPPPLPPPPPPPPPPPP 342 [209][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP+ PPP PP P PP PPPPP P PPPP Sbjct: 108 PPDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPP 146 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 P PPPP PPP PP P PP PPPPP P PPPP Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 147 [210][TOP] >UniRef100_C9JS29 Putative uncharacterized protein TNRC18 n=1 Tax=Homo sapiens RepID=C9JS29_HUMAN Length = 1312 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS-PSRRPP*PPPP-PSPYPPPP 297 PPPPPPP P PPP PP P R PP PPPP P P+PPPP Sbjct: 1135 PPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPP 1175 [211][TOP] >UniRef100_A8MSW5 Putative uncharacterized protein TNRC18 n=1 Tax=Homo sapiens RepID=A8MSW5_HUMAN Length = 1308 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS-PSRRPP*PPPP-PSPYPPPP 297 PPPPPPP P PPP PP P R PP PPPP P P+PPPP Sbjct: 1135 PPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPP 1175 [212][TOP] >UniRef100_O15417-2 Isoform 2 of Trinucleotide repeat-containing gene 18 protein n=1 Tax=Homo sapiens RepID=O15417-2 Length = 1134 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYS-PSRRPP*PPPP-PSPYPPPP 297 PPPPPPP P PPP PP P R PP PPPP P P+PPPP Sbjct: 957 PPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPP 997 [213][TOP] >UniRef100_Q84ZL0-2 Isoform 2 of Formin-like protein 5 n=1 Tax=Oryza sativa Japonica Group RepID=Q84ZL0-2 Length = 1627 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*RE---PPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPP PP + S PP PPPPPSP PPPP Sbjct: 1016 PPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPP 1057 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPSPP PS PP PPP P PPPP Sbjct: 1030 PPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPP 1068 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 9/47 (19%) Frame = +1 Query: 184 PPPPPPLP*RE---------PPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPP P R PPP PP PS P PPPPP P PPPP Sbjct: 916 PPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPP 962 [214][TOP] >UniRef100_Q84ZL0 Formin-like protein 5 n=1 Tax=Oryza sativa Japonica Group RepID=FH5_ORYSJ Length = 1627 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*RE---PPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP PPP PP + S PP PPPPPSP PPPP Sbjct: 1016 PPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPP 1057 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPSPP PS PP PPP P PPPP Sbjct: 1030 PPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPP 1068 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 9/47 (19%) Frame = +1 Query: 184 PPPPPPLP*RE---------PPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPP P R PPP PP PS P PPPPP P PPPP Sbjct: 916 PPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPP 962 [215][TOP] >UniRef100_UPI0001757FBF PREDICTED: similar to T19B10.5 n=1 Tax=Tribolium castaneum RepID=UPI0001757FBF Length = 1588 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGGYG GGGGG+GG + +GG GGG G GGG GGG+ Sbjct: 1453 GGGGYGGGGGGGFGGGHDDHHGGGGGGFGGGFGGGFGGGH 1492 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGG+GG G + GG YG GGGGG G Sbjct: 1403 GGGGYGGGGGGGFGGGFGGGHDDHHGGGGYGGGGGGGFG 1441 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGG+GG G + GG YG GGGGG G Sbjct: 1428 GGGGYGGGGGGGFGGGFGGGHDDHHGGGGYGGGGGGGFG 1466 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 2/42 (4%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGD--GGGSRYGNGGGGGGGN 177 GGGG+G G GGG+GG + +GG GGG YG GGG GGG+ Sbjct: 1476 GGGGFGGGFGGGFGGGHDDHHGGGGFGGGGGYGGGGGHGGGH 1517 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGG-DGGGSRYGNGGGGGGG 180 GGGGYG GGGGG+GG G + GGG YG GGGGG G Sbjct: 1377 GGGGYGGGGGGGFGGGFGGGHDDHHGGGGGYGGGGGGGFG 1416 [216][TOP] >UniRef100_UPI00015B5EB5 PREDICTED: similar to CG3606-PB n=1 Tax=Nasonia vitripennis RepID=UPI00015B5EB5 Length = 407 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWR 171 GGGG G GGGGG GG G GG GG YG GGGGGGG R Sbjct: 235 GGGGGGGGGGGGRGGGGGGRGGGRGGSGGYGGGGGGGGGGGR 276 [217][TOP] >UniRef100_B9EN93 Cold-inducible RNA-binding protein n=1 Tax=Salmo salar RepID=B9EN93_SALSA Length = 161 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/48 (64%), Positives = 32/48 (66%), Gaps = 5/48 (10%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGN-----GGGGGGGNWRS 168 GGGGYG GGGGYGG E YGG GGG YG GGGGGGG +RS Sbjct: 100 GGGGYG--GGGGYGG-GERSYGGGGGGRSYGGEDRGYGGGGGGGGYRS 144 [218][TOP] >UniRef100_A2C5L0 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9303 RepID=A2C5L0_PROM3 Length = 202 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G YGG GGG YG GGGGGGG Sbjct: 102 GGGGYG-GGGGGYGG-GGGGYGGGGGG--YGGGGGGGGG 136 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/41 (68%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = -2 Query: 296 GGGGYGEGGGG-GYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGGYG GGGG G GG G GG GGG YG GGGGGGG+ Sbjct: 109 GGGGYGGGGGGYGGGGGGYGGGGGGGGGGGYGGGGGGGGGD 149 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G YGG GGG YG GGGG GG Sbjct: 88 GGGGYG-GGGGGYGG-GGGGYGGGGGG--YGGGGGGYGG 122 [219][TOP] >UniRef100_Q41518 Single-stranded nucleic acid binding protein n=1 Tax=Triticum aestivum RepID=Q41518_WHEAT Length = 167 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/52 (55%), Positives = 32/52 (61%), Gaps = 9/52 (17%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRR--EGEYGGDGG-------GSRYGNGGGGGGGNWRS 168 GGGGYG GGGGYGG+R G YGG GG G + G GGG GG WR+ Sbjct: 116 GGGGYGGQGGGGYGGQRGGGGGYGGGGGYGGGGGYGGQRGGGGGDSGGQWRN 167 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/45 (64%), Positives = 30/45 (66%), Gaps = 6/45 (13%) Frame = -2 Query: 296 GGGGYG-----EGGGGGYGGRREGEYGGD-GGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG+ G YGG GGG YG GGG GGG Sbjct: 103 GGGGYGGGGGYGGGGGGYGGQGGGGYGGQRGGGGGYGGGGGYGGG 147 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/47 (63%), Positives = 31/47 (65%), Gaps = 5/47 (10%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGD-GGGSRYGN----GGGGGGGNWR 171 GGGGYG GGGGGYGG+ G YGG GGG YG GGGGG G R Sbjct: 109 GGGGYG-GGGGGYGGQGGGGYGGQRGGGGGYGGGGGYGGGGGYGGQR 154 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG GGGGGYGG+R G GG GGG YG GGGG GG Sbjct: 88 GGGG---GGGGGYGGQRGGG-GGYGGGGGYGGGGGGYGG 122 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/44 (65%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = -2 Query: 296 GGGGYG--EGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWR 171 GGGGYG GGGGGYGG G YGG GGG YG GGGG G R Sbjct: 93 GGGGYGGQRGGGGGYGGG--GGYGGGGGG--YGGQGGGGYGGQR 132 [220][TOP] >UniRef100_A9SB49 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SB49_PHYPA Length = 148 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG EGGGGG GG EG GG GGG G GGGGGGG Sbjct: 99 GGGGGDEGGGGGGGGGDEGGGGGGGGGDEGGGGGGGGGG 137 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGG EGGGGG GG EG GG GGG G GGGGGG Sbjct: 110 GGGGGDEGGGGGGGGGDEGGGGGGGGGGGGGGGGGGGG 147 [221][TOP] >UniRef100_A9RI93 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RI93_PHYPA Length = 159 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG EGGGGG GG EG GG GGG G GGGGGGG Sbjct: 110 GGGGGDEGGGGGGGGGDEGGGGGGGGGDEGGGGGGGGGG 148 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGG EGGGGG GG EG GG GGG G GGGGGG Sbjct: 99 GGGGGDEGGGGGGGGGDEGGGGGGGGGDEGGGGGGGGG 136 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGG EGGGGG GG EG GG GGG G GGGGGG Sbjct: 121 GGGGGDEGGGGGGGGGDEGGGGGGGGGGGGGGGGGGGG 158 [222][TOP] >UniRef100_A3BDN5 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3BDN5_ORYSJ Length = 321 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG R G GG GGG G GGGGGGG Sbjct: 105 GGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGGG 143 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG GE GG GGG G GGGGGGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGG 139 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG R G GGGGGGG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGG 131 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 104 GGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGG 142 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGG 130 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG+ GG G GGGGGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGG 135 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = -2 Query: 296 GGGGYGEGGGGG-YGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGG G GGGGG GG G GG GGG G GGGGGGGN Sbjct: 108 GGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGGGGGGGN 148 [223][TOP] >UniRef100_B6KME4 RRM domain-containing protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KME4_TOXGO Length = 513 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/41 (65%), Positives = 28/41 (68%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 G GGYG GGGGGYGG G YGG GGG YG GGG G G + Sbjct: 351 GNGGYGGGGGGGYGG-GGGGYGGYGGGGGYGGGGGFGSGGY 390 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGG-SRYGNGGGGGGG 180 GGGGYG GG GGYGG G YGG GGG YG GGG GGG Sbjct: 344 GGGGYG-GGNGGYGGGGGGGYGGGGGGYGGYGGGGGYGGG 382 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGGYG GG GGYGG G YGG G G G GGGGGG + Sbjct: 324 GGGGYG-GGNGGYGGGGNGGYGGGGYGGGNGGYGGGGGGGY 363 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGGYG GGGGGYGG G GG GGG +G+GG GGGG + Sbjct: 359 GGGGYG-GGGGGYGGYGGG--GGYGGGGGFGSGGYGGGGGY 396 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGGYG GG GG GG G YGG G G GNGG GGGGN Sbjct: 303 GGGGYGGGGYGGGGGYGGGGYGGGGYGG--GNGGYGGGGN 340 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = -2 Query: 296 GGGGYGEGGGGGYG----GRREGEYGGDGGGSRYGNGGGGGGG 180 G GGYG GG GGYG G G YGG GGG YG GGGG GG Sbjct: 331 GNGGYGGGGNGGYGGGGYGGGNGGYGGGGGGG-YGGGGGGYGG 372 [224][TOP] >UniRef100_B1X5L4 RNA-binding protein RbpD n=1 Tax=Paulinella chromatophora RepID=B1X5L4_PAUCH Length = 132 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/43 (69%), Positives = 31/43 (72%), Gaps = 3/43 (6%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYG-GDGGGSRYGNGGG--GGGGN 177 GGGG G GGGGGYGG R G G G GGG YG+GGG GGGGN Sbjct: 88 GGGGGGGGGGGGYGGGRGGGGGYGGGGGGGYGSGGGGYGGGGN 130 [225][TOP] >UniRef100_Q5KLE2 Putative uncharacterized protein n=1 Tax=Filobasidiella neoformans RepID=Q5KLE2_CRYNE Length = 312 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 4/47 (8%) Frame = -2 Query: 296 GGGGYG-EGGGGGYGGRREGE-YGGDGGGSRYG--NGGGGGGGNWRS 168 GGGG+G GGGGG+GG G YGG GGG +G GGGGGGG WR+ Sbjct: 75 GGGGFGGPGGGGGFGGPGGGGGYGGPGGGGGFGGPGGGGGGGGRWRN 121 [226][TOP] >UniRef100_C9SP10 ATP-dependent RNA helicase DBP2 n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9SP10_9PEZI Length = 577 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/52 (55%), Positives = 29/52 (55%), Gaps = 13/52 (25%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGD-------------GGGSRYGNGGGGGGG 180 GGGGYG GGGGGYGG G YGG GGG YG G GGGGG Sbjct: 20 GGGGYGGGGGGGYGGGGRGGYGGGRNDRDRGDDRGGYGGGGGYGGGYGGGGG 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/48 (60%), Positives = 29/48 (60%), Gaps = 9/48 (18%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRRE--------GEYGGDGG-GSRYGNGGGGGGG 180 GGGGYG GG GGYGG R G YGG GG G YG GGG GGG Sbjct: 28 GGGGYGGGGRGGYGGGRNDRDRGDDRGGYGGGGGYGGGYGGGGGYGGG 75 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/43 (67%), Positives = 30/43 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWRS 168 GGGGYG GGGGGYGG G YGG GGG YG GG GG G R+ Sbjct: 6 GGGGYG-GGGGGYGG-GGGGYGGGGGGG-YGGGGRGGYGGGRN 45 [227][TOP] >UniRef100_UPI000180D259 PREDICTED: similar to WAS protein family homolog 1 (Protein FAM39E) (CXYorf1-like protein on chromosome 2) n=1 Tax=Ciona intestinalis RepID=UPI000180D259 Length = 450 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP PPP P PPP PP PS PP PPPP P PPPP Sbjct: 287 PPPGPPPPPENTPPPPPP--PSNIPPPPPPPSEPIPPPP 323 [228][TOP] >UniRef100_UPI00017603E5 PREDICTED: diaphanous 2 n=1 Tax=Danio rerio RepID=UPI00017603E5 Length = 885 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PP PP P PP PPPPP PPPP Sbjct: 561 PPPPPPPFPASLGPPPPPPPPGCGPPPPPPPPGGGPPPP 599 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSP-SRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPP PP P S PP PPPPP PPPP Sbjct: 549 PPPPPPPIGGAPPPPPPPPFPASLGPPPPPPPPGCGPPPP 588 [229][TOP] >UniRef100_UPI0001A2D186 UPI0001A2D186 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D186 Length = 166 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PP PP P PP PPPPP PPPP Sbjct: 32 PPPPPPPFPASLGPPPPPPPPGCGPPPPPPPPGGGPPPP 70 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSP-SRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPP PP P S PP PPPPP PPPP Sbjct: 20 PPPPPPPIGGAPPPPPPPPFPASLGPPPPPPPPGCGPPPP 59 [230][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP PP PPPPP P PPPP Sbjct: 652 PPPPPPPPPPPPPPPPPP------PPPPPPPPPPPPPPP 684 [231][TOP] >UniRef100_B4Y9V9 Intracellular mobility A n=1 Tax=Burkholderia pseudomallei RepID=B4Y9V9_BURPS Length = 365 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/54 (57%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Frame = +1 Query: 142 KP*GKQTI*LLQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPS--PYPPPP 297 KP G +T+ PPPPPPP PPP PP PS PP PPPPPS P PPPP Sbjct: 72 KPVGDRTLPNKVPPPPPPPP-----PPPPPPPPPSTTPP-PPPPPSTTPSPPPP 119 [232][TOP] >UniRef100_Q7XMC9 OSJNBb0018A10.6 protein n=1 Tax=Oryza sativa RepID=Q7XMC9_ORYSA Length = 909 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PP PP +PS PP PPPPP P PP P Sbjct: 468 PPPPPPPAPSPPAPPPPPPAPS--PPAPPPPPPPCPPAP 504 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/42 (57%), Positives = 26/42 (61%), Gaps = 4/42 (9%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPP----SPYPPPP 297 PPPPPP+P PP PP P+ PP PPPPP P PPPP Sbjct: 455 PPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPP 496 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPP P P PPP PP +PS P PPPPP+P PP P Sbjct: 456 PPPPPVPSPSGPPPPPPPPAPSPPAP-PPPPPAPSPPAP 493 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PP P P PPP P SPS PP PPPPP+P PP P Sbjct: 444 PPSPPAPSPPAPPPPPPVPSPSGPPP-PPPPPAPSPPAP 481 [233][TOP] >UniRef100_Q10R34 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q10R34_ORYSJ Length = 880 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PP PP +PS PP PPPPP P PP P Sbjct: 416 PPPPPPPAPSPPAPPPPPPAPS--PPAPPPPPPPCPPAP 452 [234][TOP] >UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum bicolor RepID=C5XPK9_SORBI Length = 613 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP----PSPYPPPP 297 PPPP PP P PP PP SPS PP PPPP PSP PPPP Sbjct: 448 PPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP 490 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPP P PPPSP P PP PPPPSP PPPP Sbjct: 411 PPSPPPPSP---PPPSPSPPPPSPPPPSPPPPSPSPPPP 446 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSP P PP PPPPSP PPPP Sbjct: 470 PPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP 507 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP----PSPYPPPP 297 PPPP PP P PPP P PS PP PPPP PSP PPPP Sbjct: 431 PPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPP 473 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPY-SPSRRPP*PPP--PPSPYPPPP 297 PPP P P P PPPSPP SPS PP PPP PP P PPPP Sbjct: 420 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPP 461 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 184 PPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP P P PPPSP P PP PPPPSP PP P Sbjct: 426 PPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSP 463 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPP----PSPYPPPP 297 PPP P P P PPPSPP PS PP PPPP P P PPPP Sbjct: 437 PPPSPSPPPPSPPPPSPP-PPSPPPPSPPPPSPSPPPPSPPPP 478 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPP P P P PPPSPP PP PPPPSP PP P Sbjct: 464 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 502 [235][TOP] >UniRef100_Q4DD51 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi RepID=Q4DD51_TRYCR Length = 603 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/48 (54%), Positives = 29/48 (60%), Gaps = 6/48 (12%) Frame = +1 Query: 172 LQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPP------SPYPPPP 297 L+ PPPPPPP P PPP PP + PP PPPPP +P PPPP Sbjct: 380 LEAPPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPP 427 [236][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPPLP PPP PP PP PPPPP P PPPP Sbjct: 1217 PPPPPPPLP---PPPPPP------PPLPPPPPPPPPPPP 1246 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 181 PP--PPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP PPPPPLP PPP PP P PP P PPP P PPPP Sbjct: 1205 PPLTPPPPPLP-PPPPPPPPLPPPPPPPPPLPPPPPPPPPP 1244 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPP P P PPP PP P P PPPPP P PPP Sbjct: 1209 PPPPPLPPPPPPPPPLPPPPPPPPPLPPPPPPPPPPPP 1246 [237][TOP] >UniRef100_B4MA64 GJ15849 n=1 Tax=Drosophila virilis RepID=B4MA64_DROVI Length = 1545 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPP PP +P+ PP PPP P PPPP Sbjct: 964 PPPPPPPMLKAVPPPPPPMAPAMLPPPPPPCPGAPPPPP 1002 [238][TOP] >UniRef100_B4JX44 GH17880 n=1 Tax=Drosophila grimshawi RepID=B4JX44_DROGR Length = 1516 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP+ PPP PP +P+ PP PPP P PPPP Sbjct: 940 PPPPPPPMLKTVPPPPPPMAPAMLPPPPPPCPGAPPPPP 978 [239][TOP] >UniRef100_A7SGL4 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SGL4_NEMVE Length = 620 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSR---RPP*PPPPPSPYPPPP 297 PPPPP P+P PPP PP P PP PPPPPSP PPPP Sbjct: 419 PPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPP 460 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPP 294 PPPPPPP P PPP PP PS PP PPPPP P P P Sbjct: 433 PPPPPPPCPVPCPPPPPPPPPS--PPPPPPPPCPIPCP 468 [240][TOP] >UniRef100_C0NIM8 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NIM8_AJECG Length = 281 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = +1 Query: 172 LQFPPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 L + PPPPPP PPSPP SPS PP PPPPP P PPPP Sbjct: 116 LSYSPPPPPP------PPSPP-SPSPSPPPPPPPPPPPPPPP 150 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PP P PPL PPP PP SP P PPPPP P PPPP Sbjct: 109 PPSPSPPLSYSPPPPPPPPSPPSPSPSPPPPPPPPPPPP 147 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P P PSPP P PP PPPPP P PP P Sbjct: 121 PPPPPPPSP-PSPSPSPPPPPPPPPP-PPPPPPPSPPAP 157 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPP PP P PPP PP P PP PP PP+P P P Sbjct: 124 PPPPSPPSPSPSPPPPPPPPPPPPPPPPPSPPAPAPSNP 162 [241][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPP 291 PPPPPPP P PPP PP S PP PPPPP P PP Sbjct: 1042 PPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPP 1078 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P PPPPP P PPPP Sbjct: 1039 PPPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPP 1077 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*P----PPPPSPYPPPP 297 PPPPPPP P PPP PP P PP PPPP P PPPP Sbjct: 1034 PPPPPPPPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPP 1076 [242][TOP] >UniRef100_B2AUP9 Predicted CDS Pa_1_19860 n=1 Tax=Podospora anserina RepID=B2AUP9_PODAN Length = 217 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/48 (56%), Positives = 30/48 (62%), Gaps = 9/48 (18%) Frame = +1 Query: 181 PPPPPPPLP*RE-----PPPSPPYSPSRRPP*PPPPP----SPYPPPP 297 PPPPPPPLP E PPP PP + + PP PPPPP +P PPPP Sbjct: 127 PPPPPPPLPVTETPAPPPPPPPPVTETPAPPPPPPPPPPVTTPAPPPP 174 [243][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +1 Query: 181 PPPPPPPLP*REPPPSPPYSPSRRPP*PPPPPSPYPPPP 297 PPPPPPP P PPP PP P+ P PPPP S PPPP Sbjct: 150 PPPPPPPPPPPPPPPPPPPPPTTLEPPPPPPTSSEPPPP 188 [244][TOP] >UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI000155382B Length = 492 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG R G GG GGG G+GGGGGGG Sbjct: 213 GGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGG 251 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG R G GGGGGGG Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 220 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGGS G GGGGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGG 101 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G+GGGGG GG G GG GGG G GGGGGGG Sbjct: 238 GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 276 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGGS G GGGGGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGG 358 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 61 GGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGG 99 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 74 GGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGG 112 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWR 171 GGGG G GGGGG GG G GG GGG G GGGGGGG R Sbjct: 169 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 210 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGG G GGGGG GG G GG GGG G GGGGGGG+ Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGS 90 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 113 GGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGG 151 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 121 GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGG 174 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 145 GGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGG 183 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 153 GGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGG 191 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 161 GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 328 GGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGG 366 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 330 GGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGG 368 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 341 GGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 379 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 219 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 198 GGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGG 236 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGG G GGGGG GG G GG GGG G GGGGGGG+ Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGS 347 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G+GGGGGGG Sbjct: 316 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGG 354 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 318 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGG 356 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGG 357 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGG 362 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 327 GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGG 365 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 331 GGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGG 369 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 332 GGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGG 370 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 335 GGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 373 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 343 GGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 381 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGG 134 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 146 GGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGG 184 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 148 GGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGG 186 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 159 GGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 217 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG R G GG GGG G+GGG GGG Sbjct: 194 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGG 232 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GGDGGG G GGGGGGG Sbjct: 204 GGGGGGRGGGGGGGGGGGG--GGDGGGRGGGGGGGGGGG 240 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 232 GGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGG 270 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 240 GGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 278 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 245 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 283 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 246 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 284 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 247 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 285 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 248 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 286 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 249 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 250 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 288 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 251 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 289 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 252 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 290 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 253 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 291 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 254 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 292 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 255 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 293 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 256 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 294 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 257 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 295 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 258 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 296 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 259 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 297 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 260 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 298 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 299 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 300 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 301 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 302 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 265 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 303 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 266 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 304 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 267 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 305 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 306 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 307 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 270 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 308 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 271 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 309 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 310 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 311 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 312 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 275 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 313 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 276 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 314 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 277 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 315 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 278 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 316 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 279 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 317 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 280 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 318 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 281 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 319 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 282 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 320 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 283 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 321 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 284 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 285 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 286 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 324 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 287 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 325 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 288 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 326 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 289 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 327 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 290 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 291 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 329 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 292 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 293 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 294 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 295 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 296 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 297 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 335 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 298 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 336 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 299 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 337 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 300 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 338 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 301 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 339 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 302 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 340 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 303 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 341 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 304 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 342 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 343 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 306 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 344 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 345 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 348 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 386 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 349 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 387 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 350 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 388 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 351 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 389 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 390 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 391 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 354 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 392 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 355 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 393 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 356 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 394 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 357 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 395 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 358 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 396 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 359 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 397 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 398 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 361 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 399 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 362 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 400 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 363 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 401 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 364 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 402 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 365 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 403 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 366 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 404 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 367 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 405 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 368 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 406 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 369 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 407 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 370 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 408 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 371 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 409 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 372 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 410 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 373 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 411 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 374 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 412 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 375 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 413 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 376 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 414 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 377 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 415 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 378 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 416 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 379 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 417 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 380 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 418 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 381 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 419 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 382 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 420 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 383 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 421 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 384 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 422 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 385 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 423 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 386 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 424 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 387 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 425 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 388 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 426 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 389 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 427 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 390 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 428 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 391 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 429 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 392 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 430 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 393 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 431 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 394 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 432 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 395 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 433 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 396 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 434 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 397 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 435 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 398 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 436 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 399 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 437 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 400 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 438 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 401 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 439 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 402 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 440 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGG 175 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 149 GGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGG 187 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 150 GGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGG 188 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 221 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G G GGG GG G GGDGGG G GGGGGGG Sbjct: 221 GGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGG 259 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGG G GGGGG GG G+ GG GGG G GGGGGGG Sbjct: 226 GGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGG 263 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGGS G GGGGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSG 91 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 102 GGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGG 140 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGG 176 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGG 180 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGG 183 GGGG G GGGGG GG G+ GG GGG G GGGGGG Sbjct: 206 GGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGG 243 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGG 172 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDG------GGSRYGNGGGGGGG 180 GGGG G GGGGG GGR G GG G GG R G GGGGGGG Sbjct: 195 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGG 239 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GG GG GG G GG GGG G GGGGGGG Sbjct: 71 GGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGG 109 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGG GG G GG GGG G GGGGGGG Sbjct: 73 GGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGG 111 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GG G G GGGGG GG +G GG GGG G GGGGGGG Sbjct: 227 GGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGG 265 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 G GG G GGGGG GG G GG GGG G+GGGGGGG Sbjct: 49 GSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGG 87 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G G GGGGG Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGG 95 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G G GGG G+GGGGGGG Sbjct: 59 GGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGG 97 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG GGGGGGG Sbjct: 60 GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGG 98 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG GG GGG G GGGGGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGG 100 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG G G GG GGG G GGGGGGG Sbjct: 67 GGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGG 105 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G G GGG G GGGGGGG Sbjct: 68 GGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGG 106 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGG G GG G GG GGG G GGGGGGG Sbjct: 70 GGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGG 108 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG GGGGG GG G GG GGG G GGGGGGG Sbjct: 75 GGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG G G GG GGG G GGGGGGG Sbjct: 76 GGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GG G G GGGGG GG G GG GGG G GGGGGGG Sbjct: 78 GGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 107 GGGGGGGGGGGGVGG--GGGVGGGGGGGGGGGGGGGGGG 143 [245][TOP] >UniRef100_UPI0000DA3D7B PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3D7B Length = 211 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG +G GG GGG G GGGGGGG Sbjct: 89 GGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGG 127 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GGDGGG G GGGGGGG Sbjct: 24 GGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGG 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GGDGGG G GGGGGGG Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGG 147 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWR 171 GGGG G+GGGGG GG G GG GGG G GGGGGGG R Sbjct: 126 GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 167 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGNWR 171 GGGG G GGGGG GG G GG GGG G+GGGGGGG R Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGDGGGGGGGGGR 179 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G+GGGGG GG G GGDGGG G GGGGG G Sbjct: 41 GGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDG 79 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G+ GG GGG G GGGGGGG Sbjct: 113 GGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGG 151 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG +G GG GGG G GGGGGGG Sbjct: 115 GGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGG 153 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 66 GGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGG 104 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 91 GGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGG 129 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 35 GGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGG 73 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G+GGGGG GG G GG GGG+ G GGGGG G Sbjct: 58 GGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSG 96 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 112 GGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGG 150 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 116 GGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGG 154 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 117 GGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGG 155 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 120 GGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G+ GG GGG G GGGG GG Sbjct: 28 GGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGG 66 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG +G GG GGG G GG GGGG Sbjct: 30 GGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGG 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGG GG G GG GGG G GGGGGGG Sbjct: 79 GGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGG 117 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG GGGGG GG G GG GG R G GGGGGGG Sbjct: 80 GGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGG 118 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG GGGGGGG Sbjct: 102 GGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGG 140 [246][TOP] >UniRef100_UPI0000DA1BD4 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA1BD4 Length = 250 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGG G GGGGG GG G GGDGGG G GGGGGGG+ Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGD 161 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G+GGGGG GG G GG GGG G+GGGGGGG Sbjct: 114 GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGG 152 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G+GGGGG GG G GG GGG G GGGGGGG Sbjct: 91 GGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGG 129 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G+ GG GGG G GGGGGGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGG 139 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG +G GG GGG G GGGGGGG Sbjct: 103 GGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGG 141 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/42 (66%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGD---GGGSRYGNGGGGGGG 180 GGGG G GGGGG GG +G GGD GGGS G+GGGGGGG Sbjct: 178 GGGGDGGGGGGGGGGGGDGSGGGDGGVGGGSGGGDGGGGGGG 219 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GG G G+GGGGG GG G GGDGGG G GGGGGGG Sbjct: 74 GGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGGGGGGGGG 112 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGG G GGGGG GG G GGDGGG G GGGGGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGG 135 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 93 GGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGG 131 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGG 138 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 104 GGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGG 142 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 105 GGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGG 143 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 116 GGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGG 154 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGG G GG G GGDGGG G+GGGGGGG Sbjct: 151 GGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGG 189 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G+GGGG GG G+ GG GGG G GGGGGGG Sbjct: 155 GGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGG 193 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G+G GGG GG G GGDGGG G GGGGGGG Sbjct: 189 GGGGGGDGSGGGDGGVGGGSGGGDGGGG--GGGGGGGGG 225 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G+GGG G GG G GG GGG G GGGGGGG Sbjct: 70 GGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGGGGG 108 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G+ GG GGG G GGG GGG Sbjct: 126 GGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGG 164 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGG G GGGGG GG G GG GGG G GGGGGGG Sbjct: 77 GGGDGGGGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGG 115 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGG GGG Sbjct: 85 GGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGG 123 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGGG GG G GG GGG G GGGG GG Sbjct: 146 GGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGG 184 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGGG GG G GG GGG G GGGGGGG Sbjct: 154 GGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGG 192 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGG G GGG G GG G GG GGG G GGGGGGG Sbjct: 185 GGGGGGGGGGDGSGGGDGGVGGGSGGGDGGGGGGGGGGG 223 [247][TOP] >UniRef100_A6G1X8 Single-stranded DNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G1X8_9DELT Length = 198 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = -2 Query: 296 GGGGY-GEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGGGY G GGGGGYGG G G GGGS YG GG GGGG Sbjct: 121 GGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGG 160 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/44 (65%), Positives = 30/44 (68%), Gaps = 4/44 (9%) Frame = -2 Query: 296 GGGGYGEGGGGGY-GGRREGEYGGDGGGSRYGNGGG---GGGGN 177 GGGG G GGGGGY GG G YGG GGG YG GGG GGGG+ Sbjct: 113 GGGGGGRGGGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGS 156 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = -2 Query: 296 GGGGYG-EGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN 177 GGGGYG GGGGGYGG YGG G G G GGGGGGGN Sbjct: 130 GGGGYGGGGGGGGYGGGGGSSYGGGGSGGG-GYGGGGGGGN 169 [248][TOP] >UniRef100_B4FTV4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FTV4_MAIZE Length = 196 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/42 (66%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = -2 Query: 296 GGGGYGEGGG-GGYGGRREGEYGGDGGGSRYGNGGGGGGGNW 174 GGGGYG GGG GGYGG GG GGG YG GGGGGGG + Sbjct: 37 GGGGYGGGGGYGGYGG------GGGGGGGGYGGGGGGGGGGY 72 [249][TOP] >UniRef100_A9NML8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NML8_PICSI Length = 172 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/38 (76%), Positives = 29/38 (76%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 GGG G GG GGYGGR G YGG GGGSRYG GGGGG G Sbjct: 122 GGGRGGGGSGGYGGR--GGYGG-GGGSRYGGGGGGGYG 156 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = -2 Query: 296 GGGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGGN---WR 171 GGG G GG GGYGG YGG GGG G G GGGGG+ WR Sbjct: 127 GGGSGGYGGRGGYGGGGGSRYGGGGGGGYGGGGYGGGGGSEGAWR 171 [250][TOP] >UniRef100_Q7SC61 Predicted protein n=1 Tax=Neurospora crassa RepID=Q7SC61_NEUCR Length = 988 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = -2 Query: 293 GGGYGEGGGGGYGGRREGEYGGDGGGSRYGNGGGGGGG 180 G G+G GGGG GGR GE+GG GGG G GGGGGGG Sbjct: 471 GRGFGGGGGGAGGGRGSGEWGGGGGGGGAGGGGGGGGG 508