[UP]
[1][TOP] >UniRef100_B7FIY1 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FIY1_MEDTR Length = 263 Score = 88.2 bits (217), Expect = 3e-16 Identities = 44/69 (63%), Positives = 44/69 (63%), Gaps = 11/69 (15%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT-----------GYPPAAYPPP 307 VGYAPQPA YGQ YGYPPAPPPAQGYPAT GYPP AYPP Sbjct: 206 VGYAPQPA-----------YGQNYGYPPAPPPAQGYPATGYPSAAYPPQQGYPPTAYPPQ 254 Query: 306 GYPPSGYSR 280 GYPPSGYSR Sbjct: 255 GYPPSGYSR 263 [2][TOP] >UniRef100_A9PCV7 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9PCV7_POPTR Length = 253 Score = 79.7 bits (195), Expect = 9e-14 Identities = 38/58 (65%), Positives = 40/58 (68%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 280 VGYAPQ YGQP YGQPYGYPP P QGYP GYPP+ YPPP YPPSGY + Sbjct: 206 VGYAPQT--YGQP------YGQPYGYPPQPH--QGYPVAGYPPSNYPPPAYPPSGYPK 253 [3][TOP] >UniRef100_C6SXX5 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SXX5_SOYBN Length = 248 Score = 73.6 bits (179), Expect = 7e-12 Identities = 38/58 (65%), Positives = 39/58 (67%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 280 VGYAPQPA YGQPA GYP A GYP TGYPPAAYPPPGYPPSGY + Sbjct: 206 VGYAPQPA-YGQPAQ---------GYP-----APGYPPTGYPPAAYPPPGYPPSGYPK 248 [4][TOP] >UniRef100_A9RJ18 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RJ18_PHYPA Length = 377 Score = 71.2 bits (173), Expect = 3e-11 Identities = 36/62 (58%), Positives = 38/62 (61%), Gaps = 5/62 (8%) Frame = -2 Query: 450 GYAPQPA--PYGQPAPQPA---PYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 GY PQ P G P PQ P G P GYPPA P GYP +GYPP+ YPP GYPPSGY Sbjct: 209 GYPPQQGYPPQGYP-PQGGHAYPPGAPAGYPPAGYPPAGYPPSGYPPSGYPPSGYPPSGY 267 Query: 285 SR 280 R Sbjct: 268 PR 269 [5][TOP] >UniRef100_B9GKE8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GKE8_POPTR Length = 94 Score = 70.9 bits (172), Expect = 4e-11 Identities = 33/52 (63%), Positives = 34/52 (65%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 280 P G P P YGQPYGYPP AQGYPA GYPP AYPP YPPSGY + Sbjct: 49 PPSVGYP---PQGYGQPYGYPPQ---AQGYPAAGYPPPAYPPSNYPPSGYPK 94 [6][TOP] >UniRef100_A9PIT6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PIT6_9ROSI Length = 248 Score = 70.9 bits (172), Expect = 4e-11 Identities = 33/52 (63%), Positives = 34/52 (65%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 280 P G P P YGQPYGYPP AQGYPA GYPP AYPP YPPSGY + Sbjct: 203 PPSVGYP---PQGYGQPYGYPPQ---AQGYPAAGYPPPAYPPSNYPPSGYPK 248 [7][TOP] >UniRef100_A9NZ96 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NZ96_PICSI Length = 257 Score = 68.9 bits (167), Expect = 2e-10 Identities = 36/61 (59%), Positives = 39/61 (63%), Gaps = 3/61 (4%) Frame = -2 Query: 453 VGYAPQ-PA--PYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 283 VGYAP PA PYGQPA Y QPYGYP Q YPA GYPP+ YP GYPP+GY Sbjct: 207 VGYAPSYPAQPPYGQPA-----YPQPYGYP-----TQNYPAQGYPPSGYPSSGYPPAGYK 256 Query: 282 R 280 + Sbjct: 257 K 257 [8][TOP] >UniRef100_A0JMY8 Plscr2 protein n=1 Tax=Xenopus laevis RepID=A0JMY8_XENLA Length = 354 Score = 67.4 bits (163), Expect = 5e-10 Identities = 32/56 (57%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -2 Query: 450 GYAPQPAPYG-QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 GY P PYG QPA P QP GYPPA GYP GY PA YPP GY P+GY Sbjct: 27 GYPPPQNPYGYQPAGYPPAGYQPTGYPPAGYQPAGYPPAGYQPAGYPPAGYQPAGY 82 Score = 62.0 bits (149), Expect = 2e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 GY Q P G P P PYGY PA P GY TGYPPA Y P GYPP+GY Sbjct: 14 GYGNQGYP-GADYPGYPPPQNPYGYQPAGYPPAGYQPTGYPPAGYQPAGYPPAGY 67 [9][TOP] >UniRef100_Q8H8G4 Putative uncharacterized protein OJ1126B12.17 n=1 Tax=Oryza sativa Japonica Group RepID=Q8H8G4_ORYSJ Length = 241 Score = 67.4 bits (163), Expect = 5e-10 Identities = 38/59 (64%), Positives = 38/59 (64%), Gaps = 8/59 (13%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 289 P P P G QPA YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G Sbjct: 168 PIPPPVGYTPQQPA-YGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 224 [10][TOP] >UniRef100_Q10SG5 Os03g0123600 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10SG5_ORYSJ Length = 274 Score = 67.4 bits (163), Expect = 5e-10 Identities = 38/59 (64%), Positives = 38/59 (64%), Gaps = 8/59 (13%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 289 P P P G QPA YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G Sbjct: 201 PIPPPVGYTPQQPA-YGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 257 [11][TOP] >UniRef100_B8ALY9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8ALY9_ORYSI Length = 274 Score = 67.4 bits (163), Expect = 5e-10 Identities = 38/59 (64%), Positives = 38/59 (64%), Gaps = 8/59 (13%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 289 P P P G QPA YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G Sbjct: 201 PIPPPVGYTPQQPA-YGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 257 [12][TOP] >UniRef100_B9RDV3 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RDV3_RICCO Length = 248 Score = 67.0 bits (162), Expect = 6e-10 Identities = 35/55 (63%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPG-YPPSGYSR 280 P P P G P PQPA YG PP PP AQGYP GYPP YPPPG YPPSGY + Sbjct: 201 PIPPPIGYP-PQPA-----YGQPP-PPYAQGYPPAGYPPPQYPPPGAYPPSGYPK 248 [13][TOP] >UniRef100_B4N6T9 GK24096 n=1 Tax=Drosophila willistoni RepID=B4N6T9_DROWI Length = 536 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/55 (58%), Positives = 33/55 (60%), Gaps = 4/55 (7%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPYGQP---YGYPPAPPPAQGY-PATGYPPAAYPPPGYPPS 292 AP P P P PQ Y P YGYPP PPP QGY PA GYPP AY PP PP+ Sbjct: 19 APPPQPMVYPPPQYEGYAPPPPQYGYPPQPPPGQGYPPAAGYPPQAYAPPQPPPN 73 [14][TOP] >UniRef100_B9N0Q7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N0Q7_POPTR Length = 175 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/52 (59%), Positives = 31/52 (59%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY PQP Y PQ P P GYPP P QGYP GYPP AYPP GYPP Sbjct: 29 GYPPQPGAY---PPQGYP---PQGYPPQGYPPQGYPPAGYPPGAYPPSGYPP 74 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = -2 Query: 426 YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 +G AP P QP YPP P QGYP GYPP YPP GYPP Y Sbjct: 23 FGHGAPGYPP--QPGAYPPQGYPPQGYPPQGYPPQGYPPAGYPPGAY 67 [15][TOP] >UniRef100_A9P8F5 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9P8F5_POPTR Length = 189 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/52 (59%), Positives = 31/52 (59%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY PQP Y PQ P P GYPP P QGYP GYPP AYPP GYPP Sbjct: 29 GYPPQPGAY---PPQGYP---PQGYPPQGYPPQGYPPAGYPPGAYPPSGYPP 74 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = -2 Query: 426 YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 +G AP P QP YPP P QGYP GYPP YPP GYPP Y Sbjct: 23 FGHGAPGYPP--QPGAYPPQGYPPQGYPPQGYPPQGYPPAGYPPGAY 67 [16][TOP] >UniRef100_A9GFP5 Putative membrane protein n=1 Tax=Sorangium cellulosum 'So ce 56' RepID=A9GFP5_SORC5 Length = 263 Score = 64.7 bits (156), Expect = 3e-09 Identities = 37/64 (57%), Positives = 39/64 (60%), Gaps = 8/64 (12%) Frame = -2 Query: 450 GYAPQPAPYGQPAP--QPAPYGQPYGY--PPAPPPAQGY-PATGY--PPAAYPPPGY-PP 295 G PQPAP+G PAP PAPYGQ GY PP P GY P GY PP PPPGY PP Sbjct: 51 GAEPQPAPHGAPAPYGAPAPYGQQPGYYPPPGYAPPPGYAPPPGYAPPPGYAPPPGYAPP 110 Query: 294 SGYS 283 GY+ Sbjct: 111 PGYA 114 [17][TOP] >UniRef100_C0PCD9 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PCD9_MAIZE Length = 239 Score = 64.7 bits (156), Expect = 3e-09 Identities = 43/81 (53%), Positives = 44/81 (54%), Gaps = 27/81 (33%) Frame = -2 Query: 450 GYAPQPAPYGQP-APQPAPYGQPY------GYPPA--------PPPAQGYP-ATGYPP-- 325 GYAPQPA YGQP P+P GQ Y GYPPA PPPAQGYP GYPP Sbjct: 89 GYAPQPA-YGQPYGGYPSPPGQGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHGGGYPPPG 147 Query: 324 --------AAYPPPG-YPPSG 289 AYPPPG YPP G Sbjct: 148 QGYPQGQGGAYPPPGSYPPQG 168 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/67 (52%), Positives = 36/67 (53%), Gaps = 16/67 (23%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQPYGYPPA-------PPPAQGYPATGYPP-AAYPPP------- 307 P P P G APQPA YGQPYG P+ PPP QGYP GY AYPPP Sbjct: 83 PMPPPAGY-APQPA-YGQPYGGYPSPPGQGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHG 140 Query: 306 -GYPPSG 289 GYPP G Sbjct: 141 GGYPPPG 147 [18][TOP] >UniRef100_C0HFT3 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0HFT3_MAIZE Length = 357 Score = 64.7 bits (156), Expect = 3e-09 Identities = 43/81 (53%), Positives = 44/81 (54%), Gaps = 27/81 (33%) Frame = -2 Query: 450 GYAPQPAPYGQP-APQPAPYGQPY------GYPPA--------PPPAQGYP-ATGYPP-- 325 GYAPQPA YGQP P+P GQ Y GYPPA PPPAQGYP GYPP Sbjct: 207 GYAPQPA-YGQPYGGYPSPPGQGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHGGGYPPPG 265 Query: 324 --------AAYPPPG-YPPSG 289 AYPPPG YPP G Sbjct: 266 QGYPQGQGGAYPPPGSYPPQG 286 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/67 (52%), Positives = 36/67 (53%), Gaps = 16/67 (23%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQPYGYPPA-------PPPAQGYPATGYPP-AAYPPP------- 307 P P P G APQPA YGQPYG P+ PPP QGYP GY AYPPP Sbjct: 201 PMPPPAGY-APQPA-YGQPYGGYPSPPGQGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHG 258 Query: 306 -GYPPSG 289 GYPP G Sbjct: 259 GGYPPPG 265 [19][TOP] >UniRef100_Q0D320 Rhodopsin (Fragment) n=1 Tax=Enoploteuthis higginsi RepID=Q0D320_9MOLL Length = 134 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/46 (65%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 289 Q A QPA Y P GYPP PPP QGYP GYPP YPP GYPP G Sbjct: 78 QQAQQPA-YPPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQG 122 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPYGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSG 289 A QPA P PQ P P GYPP P P QGYP GYPP YPP G PP+G Sbjct: 80 AQQPA---YPPPQGYP---PQGYPPPPQGYPPQGYPPQGYPPQGYPPQGAPPAG 127 [20][TOP] >UniRef100_Q9LF59 Glycine/proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9LF59_ARATH Length = 173 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPP-APPPAQGYPATGYPPAAYPPPGYPPSGY 286 GY YG P P P P+GYPP A PP GYP GYPPA YPP GYP GY Sbjct: 31 GYGHHGHGYGSSYPYPPP-PPPHGYPPVAYPPHGGYPPAGYPPAGYPPAGYPAHGY 85 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -2 Query: 447 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 280 Y P P P+G P P+G GYPPA GYP GYPPA YP GYP GY R Sbjct: 45 YPPPPPPHGYPPVAYPPHG---GYPPA-----GYPPAGYPPAGYPAHGYPSHGYPR 92 [21][TOP] >UniRef100_Q0WWS8 Glycine/proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q0WWS8_ARATH Length = 173 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPP-APPPAQGYPATGYPPAAYPPPGYPPSGY 286 GY YG P P P P+GYPP A PP GYP GYPPA YPP GYP GY Sbjct: 31 GYGHHGHGYGSSYPYPPP-PPPHGYPPVAYPPHGGYPPAGYPPAGYPPAGYPAHGY 85 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -2 Query: 447 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 280 Y P P P+G P P+G GYPPA GYP GYPPA YP GYP GY R Sbjct: 45 YPPPPPPHGYPPVAYPPHG---GYPPA-----GYPPAGYPPAGYPAHGYPSHGYPR 92 [22][TOP] >UniRef100_C4R4X2 Protein involved in positive regulation of both 1,3-beta-glucan synthesis and the Pkc1p-MAPK pathway n=1 Tax=Pichia pastoris GS115 RepID=C4R4X2_PICPG Length = 1338 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/61 (50%), Positives = 34/61 (55%), Gaps = 6/61 (9%) Frame = -2 Query: 450 GYAPQP-----APYGQPAP-QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 GY+PQ +P G P P+ P GYPP P QGYP GYPP YPP GYPP G Sbjct: 972 GYSPQANLQEYSPKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 1031 Query: 288 Y 286 Y Sbjct: 1032 Y 1032 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/56 (53%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = -2 Query: 447 YAPQPAPY-GQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Y+P+ P G P+ P G P GYPP P QGYP GYPP YPP GYPPSG+ Sbjct: 982 YSPKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPSGF 1037 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 GY PQ P PQ P P GYPP P QGYP GYPP YPP G+PP Y Sbjct: 996 GYPPQGYP-----PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPSGFPPQSY 1042 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/55 (45%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -2 Query: 447 YAPQPAPYGQPAPQP-APYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Y PQ P P+ +P Y P P +GYP+ GYPP YPP GYPP GY Sbjct: 958 YPPQNYPPRDYPPRGYSPQANLQEYSPKGYPTEGYPSQGYPPQGYPPQGYPPQGY 1012 [23][TOP] >UniRef100_Q32L53 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Bos taurus RepID=GRINA_BOVIN Length = 366 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/56 (58%), Positives = 35/56 (62%), Gaps = 3/56 (5%) Frame = -2 Query: 444 APQP-APYGQPAPQPAPYGQPYGYP--PAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 AP P APY Q QP+PYGQP GYP P+P P GYP YPP YP YPP GY Sbjct: 30 APYPGAPYPQAPFQPSPYGQP-GYPQGPSPYPQGGYPQGPYPPGGYPQGPYPPGGY 84 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/53 (58%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Frame = -2 Query: 438 QPAPYGQPA-PQ-PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 QP+PYGQP PQ P+PY Q GYP P P GYP YPP YP YPP GY Sbjct: 43 QPSPYGQPGYPQGPSPYPQG-GYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGY 94 [24][TOP] >UniRef100_UPI0001B4FF17 hypothetical protein SvirD4_26967 n=1 Tax=Streptomyces viridochromogenes DSM 40736 RepID=UPI0001B4FF17 Length = 585 Score = 63.9 bits (154), Expect = 5e-09 Identities = 33/63 (52%), Positives = 34/63 (53%), Gaps = 8/63 (12%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYP----ATGYPPAAYPPPGY----PPSG 289 AP PAPYGQP Q PYGQ G PPP GYP A P A PPPGY PP G Sbjct: 274 APAPAPYGQPGRQQPPYGQAPGQTAPPPPGYGYPQAPQAPQAPQAPAPPPGYGQPTPPPG 333 Query: 288 YSR 280 Y + Sbjct: 334 YGQ 336 [25][TOP] >UniRef100_Q0D316 Rhodopsin (Fragment) n=1 Tax=Megalocranchia fisheri RepID=Q0D316_9MOLL Length = 298 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 Q QPA Y P GYPP P QGYP GYPP YPP GYPP G Sbjct: 240 QQQQQPAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 283 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -2 Query: 420 QPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 QPA P P G P GYPP P QGYP GYPP YPP G PP G Sbjct: 244 QPAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 288 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/49 (53%), Positives = 27/49 (55%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPS 292 QPA Y PA P P GYPP P QGYP GYPP PP G PP+ Sbjct: 244 QPAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPPA 292 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 390 QPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 QP GYPP PA GYP GYPP YPP GYPP GY Sbjct: 244 QPAGYPP---PA-GYPPQGYPPQGYPPQGYPPQGY 274 [26][TOP] >UniRef100_Q1DWE3 Putative uncharacterized protein n=1 Tax=Coccidioides immitis RepID=Q1DWE3_COCIM Length = 442 Score = 63.9 bits (154), Expect = 5e-09 Identities = 32/57 (56%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAP--PPAQGYPATGYPPAAYPPPG-YPPSG 289 GY P PA Y QP QP P+G PP PP QGYP GYPP YPP G YPP G Sbjct: 13 GYNPNPA-YAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGYPPQGQYPPPG 68 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/49 (53%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -2 Query: 423 GQPAPQPAP-YGQPYGYPPAPPPAQGYPATGY--PPAAYPPPGYPPSGY 286 G P P P Y QP PP PP G P GY PP YPP GYPP GY Sbjct: 10 GAPGYNPNPAYAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGY 58 [27][TOP] >UniRef100_C5PBW6 XYPPX repeat family protein n=1 Tax=Coccidioides posadasii C735 delta SOWgp RepID=C5PBW6_COCP7 Length = 442 Score = 63.9 bits (154), Expect = 5e-09 Identities = 32/57 (56%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAP--PPAQGYPATGYPPAAYPPPG-YPPSG 289 GY P PA Y QP QP P+G PP PP QGYP GYPP YPP G YPP G Sbjct: 13 GYNPNPA-YAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGYPPQGQYPPPG 68 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/49 (53%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -2 Query: 423 GQPAPQPAP-YGQPYGYPPAPPPAQGYPATGY--PPAAYPPPGYPPSGY 286 G P P P Y QP PP PP G P GY PP YPP GYPP GY Sbjct: 10 GAPGYNPNPAYAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGY 58 [28][TOP] >UniRef100_P09241 Rhodopsin n=1 Tax=Enteroctopus dofleini RepID=OPSD_ENTDO Length = 455 Score = 63.5 bits (153), Expect = 7e-09 Identities = 32/52 (61%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPP--APPPAQGYPATGYPPAAYPPPGYPPSG 289 Q A Y QP P P Y P GYPP A PP QGYP GYPP YPP GYPP G Sbjct: 383 QQAAY-QPPPPPQGY-PPQGYPPQGAYPPPQGYPPQGYPPQGYPPQGYPPQG 432 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/54 (50%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = -2 Query: 447 YAPQPAPYGQPA---PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 Y P P P G P P Y P GYPP QGYP GYPP YPP G PP Sbjct: 387 YQPPPPPQGYPPQGYPPQGAYPPPQGYPP-----QGYPPQGYPPQGYPPQGAPP 435 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAPPPAQGY--PATGYPPAAYPPPGYPPSGY 286 Q A QP P P GYPP P QG P GYPP YPP GYPP GY Sbjct: 384 QAAYQPPP--PPQGYPPQGYPPQGAYPPPQGYPPQGYPPQGYPPQGY 428 [29][TOP] >UniRef100_UPI00003BE83A hypothetical protein DEHA0G23474g n=1 Tax=Debaryomyces hansenii CBS767 RepID=UPI00003BE83A Length = 440 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/59 (49%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -2 Query: 444 APQPAP-----YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 283 AP P P YG P Y P GYPP P QGYP GY P YPP GY P GY+ Sbjct: 14 APPPGPPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGYPPQGYAPQGYA 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/57 (50%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -2 Query: 447 YAPQPAPYGQ-PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 280 Y P P GQ P PQ P P GYPP P QGY GYPP Y P GY P GY + Sbjct: 25 YGPPPGAQGQYPPPQGYP---PQGYPPQGYPPQGYAPQGYPPQGYAPQGYAPQGYQQ 78 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 3/51 (5%) Frame = -2 Query: 426 YGQPAPQPAPYGQPYGYPPAPPP-AQGY--PATGYPPAAYPPPGYPPSGYS 283 Y Q AP P P P GY PPP AQG P GYPP YPP GYPP GY+ Sbjct: 10 YRQQAPPPGP---PNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYA 57 [30][TOP] >UniRef100_B9RCF3 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RCF3_RICCO Length = 244 Score = 63.2 bits (152), Expect = 9e-09 Identities = 32/54 (59%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAA-YPPPGYPPSGYSR 280 Q P P A YGQPY AQGYPA+GYPP + YPPPGYPPSGYSR Sbjct: 199 QAIPPSVGYPPQAAYGQPY--------AQGYPASGYPPPSNYPPPGYPPSGYSR 244 [31][TOP] >UniRef100_A9NZ64 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NZ64_PICSI Length = 218 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/55 (52%), Positives = 32/55 (58%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 GY P P P+ P P GYPPA P GYP +GYPP+ YP GYPPSGY Sbjct: 30 GYPPSGYP---PSGYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGY 81 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = -2 Query: 450 GYAPQ---PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 GY P P+ Y PA Y P GYPP+ P GYP++GYPP+ YPP GYPP G Sbjct: 35 GYPPSGYPPSGYPPSGYPPAGY-PPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQG 90 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSGYS 283 GY P P PA P P GYPP+ P+ GYP +GYPPA YPP GYPP ++ Sbjct: 45 GYPPSGYP---PAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQGGYPPPAHN 98 [32][TOP] >UniRef100_Q6BH13 Metacaspase-1 n=1 Tax=Debaryomyces hansenii RepID=MCA1_DEBHA Length = 440 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/59 (49%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -2 Query: 444 APQPAP-----YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 283 AP P P YG P Y P GYPP P QGYP GY P YPP GY P GY+ Sbjct: 14 APPPGPPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGYPPQGYAPQGYA 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/57 (50%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -2 Query: 447 YAPQPAPYGQ-PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 280 Y P P GQ P PQ P P GYPP P QGY GYPP Y P GY P GY + Sbjct: 25 YGPPPGAQGQYPPPQGYP---PQGYPPQGYPPQGYAPQGYPPQGYAPQGYAPQGYQQ 78 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 3/51 (5%) Frame = -2 Query: 426 YGQPAPQPAPYGQPYGYPPAPPP-AQGY--PATGYPPAAYPPPGYPPSGYS 283 Y Q AP P P P GY PPP AQG P GYPP YPP GYPP GY+ Sbjct: 10 YRQQAPPPGP---PNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYA 57 [33][TOP] >UniRef100_UPI0000D57386 PREDICTED: similar to phospholipid scramblase 1, putative n=1 Tax=Tribolium castaneum RepID=UPI0000D57386 Length = 214 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 5/57 (8%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQPYGYPP----APPPAQGYPATGYPPAAYPPPG-YPPSGY 286 P P PY P P P GQ YG PP PPP G P GYPP YPPPG YPP G+ Sbjct: 13 PYPTPYNGQYP-PMPPGQGYGTPPPPGYGPPPGYGPPPQGYPPGQYPPPGQYPPPGH 68 [34][TOP] >UniRef100_A9NRB0 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NRB0_PICSI Length = 208 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = -2 Query: 396 YGQ-PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 +GQ P GYPP+ P GYP GYPPA YPP GYPPSGY Sbjct: 24 HGQSPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGY 61 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -2 Query: 387 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 P GYPP+ P GYP GYPPA YPP GYPP+GY Sbjct: 33 PSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGY 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -2 Query: 426 YGQ-PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 +GQ P+ P P GYPPA P GYP GYPP+ YPP GYPP G Sbjct: 24 HGQSPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYPPQG 70 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = -2 Query: 432 APYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPP-GYPP 295 +P G P P G P GYPPA P GYP +GYPPA YPP GYPP Sbjct: 27 SPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYPPQGGYPP 74 [35][TOP] >UniRef100_B4DFJ6 cDNA FLJ53033, highly similar to Homo sapiens glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1, transcript variant 2, mRNA n=1 Tax=Homo sapiens RepID=B4DFJ6_HUMAN Length = 351 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/57 (56%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = -2 Query: 447 YAPQP-APYGQPAPQPAPYGQPYGYP--PAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Y P P APY QP QP+PYGQP GYP P+P P GYP YP YP YP GY Sbjct: 14 YPPYPGAPYPQPPFQPSPYGQP-GYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQEGY 69 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -2 Query: 438 QPAPYGQP----APQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 QP+PYGQP P P P G GYP P P GYP YP YP YP GY Sbjct: 28 QPSPYGQPGYPHGPSPYPQG---GYPQGPYPQGGYPQGPYPQEGYPQGPYPQGGY 79 [36][TOP] >UniRef100_UPI00006D2AFA PREDICTED: similar to glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 isoform 3 n=1 Tax=Macaca mulatta RepID=UPI00006D2AFA Length = 371 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/59 (55%), Positives = 35/59 (59%), Gaps = 5/59 (8%) Frame = -2 Query: 447 YAPQP---APYGQPAPQPAPYGQPYGYP--PAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 YA P APY QP QP+PYGQP GYP P+P P GYP YP AYP YP GY Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSPYPQGGYPQGPYPQGAYPQGPYPQEGY 89 [37][TOP] >UniRef100_Q0D321 Rhodopsin (Fragment) n=1 Tax=Abraliopsis pacificus RepID=Q0D321_9MOLL Length = 299 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 289 Q A QPA Y P GYPP PP QGYP GYPP YPP GYPP G Sbjct: 244 QQAQQPA-YPPPQGYPPQGYPPPQGYPPQGYPPQGYPPQGYPPQG 287 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPS 292 P P G P P Y P GYPP P QGYP GYPP PP G PP+ Sbjct: 252 PPPQGYP---PQGYPPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPPA 296 [38][TOP] >UniRef100_Q0D319 Rhodopsin (Fragment) n=1 Tax=Octopoteuthis nielseni RepID=Q0D319_9MOLL Length = 130 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/49 (57%), Positives = 28/49 (57%) Frame = -2 Query: 432 APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 A Q PQ P P GYPP P QGYP GYPP YPP GYPP GY Sbjct: 77 AQQAQAPPQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 122 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/48 (58%), Positives = 28/48 (58%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 Q P G P PQ P P GYPP P QGYP GYPP YPP GYPP Sbjct: 81 QAPPQGYP-PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPP 124 [39][TOP] >UniRef100_Q0D323 Rhodopsin (Fragment) n=1 Tax=Architeuthis sp. JMS-2004 RepID=Q0D323_9MOLL Length = 137 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/46 (63%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = -2 Query: 420 QPA-PQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 289 QPA P PA Y P GYPP PP QGYP GYPP YPP G PP G Sbjct: 82 QPAYPPPAGYPPPQGYPPQGYPPPQGYPPQGYPPQGYPPQGAPPQG 127 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPA-AYPPPGYPPSGY 286 Q A QPA Y P GYPP QGYP GYPP YPP GYPP GY Sbjct: 78 QQAQQPA-YPPPAGYPPP----QGYPPQGYPPPQGYPPQGYPPQGY 118 [40][TOP] >UniRef100_Q0D318 Rhodopsin (Fragment) n=1 Tax=Bathyteuthis abyssicola RepID=Q0D318_9MOLL Length = 170 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/46 (63%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 289 Q A QPA P GYPP PPP QGYP GYPP YPP GYPP G Sbjct: 111 QQAAQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQG 154 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSG 289 QPA P Y P GYPP P P QGYP GYPP YPP G PP G Sbjct: 115 QPAYPPQGY-PPQGYPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 159 [41][TOP] >UniRef100_A0C5H2 Chromosome undetermined scaffold_15, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0C5H2_PARTE Length = 198 Score = 61.2 bits (147), Expect = 3e-08 Identities = 37/73 (50%), Positives = 38/73 (52%), Gaps = 19/73 (26%) Frame = -2 Query: 447 YAPQPAP-YGQ-PAPQPAPYGQP------YGYPPA---PPPAQGYPATGYPPA-AYPP-- 310 Y P P P YGQ P PQ Y QP Y YPP PPP GYP GYPP YPP Sbjct: 17 YPPPPPPAYGQTPYPQQPGYQQPPPPPAGYPYPPTPGYPPPVGGYPQQGYPPTPGYPPTP 76 Query: 309 -----PGYPPSGY 286 PGYPP+GY Sbjct: 77 GYPPTPGYPPAGY 89 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/82 (41%), Positives = 34/82 (41%), Gaps = 27/82 (32%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPY----------------------GYPPAP--PPAQGYP 343 G P P G P P P G PY GYPP P PP GYP Sbjct: 26 GQTPYPQQPGYQQPPPPPAGYPYPPTPGYPPPVGGYPQQGYPPTPGYPPTPGYPPTPGYP 85 Query: 342 ATGYPPAAYPP--PGY-PPSGY 286 GYPPA YPP PGY PP Y Sbjct: 86 PAGYPPAGYPPPQPGYVPPPNY 107 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/66 (50%), Positives = 33/66 (50%), Gaps = 14/66 (21%) Frame = -2 Query: 441 PQPAPYG------QPAPQPAPYGQ-PY----GYPPAPPPAQGYPATGYPPA-AYPPP--G 304 P P PYG P P P YGQ PY GY PPP GYP YPP YPPP G Sbjct: 4 PPPPPYGGYPQGQYPPPPPPAYGQTPYPQQPGYQQPPPPPAGYP---YPPTPGYPPPVGG 60 Query: 303 YPPSGY 286 YP GY Sbjct: 61 YPQQGY 66 [42][TOP] >UniRef100_A8J6J7 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J6J7_CHLRE Length = 539 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/70 (50%), Positives = 36/70 (51%), Gaps = 16/70 (22%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYG-----QPYGYPP-----APPPAQG------YPATGYPPAA 319 G PQ PYG P PQ PYG QPYG PP APPPA G P G+P Sbjct: 400 GAPPQQQPYGAP-PQQQPYGAPPQQQPYGAPPQQPYGAPPPAYGAPVGYAQPPAGHPAYG 458 Query: 318 YPPPGYPPSG 289 PPPGYPP G Sbjct: 459 APPPGYPPYG 468 Score = 55.1 bits (131), Expect = 2e-06 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 9/64 (14%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQP--AP---YGQPYGY--PPAPPPAQGYPATGYPPAAYPP--PGYP 298 G PQ PYG P QP AP YG P GY PPA PA G P GYPP PP GY Sbjct: 418 GAPPQQQPYGAPPQQPYGAPPPAYGAPVGYAQPPAGHPAYGAPPPGYPPYGPPPGAQGYT 477 Query: 297 PSGY 286 P+ Y Sbjct: 478 PAHY 481 [43][TOP] >UniRef100_Q0D313 Rhodopsin (Fragment) n=1 Tax=Illex coindetii RepID=Q0D313_9MOLL Length = 286 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/51 (56%), Positives = 29/51 (56%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Q A Y QP P P GYPP P QGYP GYPP YPP GYPP GY Sbjct: 225 QQAAYPQPPP-------PQGYPPPP---QGYPPQGYPPQGYPPQGYPPQGY 265 [44][TOP] >UniRef100_A7PSK5 Chromosome chr6 scaffold_28, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PSK5_VITVI Length = 191 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/65 (53%), Positives = 37/65 (56%), Gaps = 10/65 (15%) Frame = -2 Query: 450 GYAPQ--PAPYGQPAPQPAPYGQPYGYPPAP-PPAQGYPATGYPP------AAYPPP-GY 301 GY P P P G P P+ Y P GYPP+ PP GYP GYPP A YPPP GY Sbjct: 40 GYPPSAYPPPGGYP---PSGYPPPGGYPPSGYPPPGGYPPAGYPPPGGYPPAPYPPPGGY 96 Query: 300 PPSGY 286 PPSGY Sbjct: 97 PPSGY 101 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/55 (49%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = -2 Query: 447 YAPQPAPYGQPAPQPAPYGQPYGYPPAP-PPAQGYPATGY-PPAAYPPPGYPPSG 289 Y P Y P+ Y P GYPP+ PP GYP +GY PP YPP GYPP G Sbjct: 29 YRPPHGAYHSQGYPPSAYPPPGGYPPSGYPPPGGYPPSGYPPPGGYPPAGYPPPG 83 [45][TOP] >UniRef100_Q3BDP1 Rhodopsin (Fragment) n=1 Tax=Sepioteuthis lessoniana RepID=Q3BDP1_SEPLE Length = 288 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Q Q A Y P GYPP PP QGYP GYPP YPP GYPP GY Sbjct: 243 QQQQQQAAY-PPQGYPPPPP--QGYPPQGYPPQGYPPQGYPPQGY 284 [46][TOP] >UniRef100_B4YS99 Rhodopsin (Fragment) n=1 Tax=Afrololigo mercatoris RepID=B4YS99_9MOLL Length = 303 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPPS 292 Q QPA Y P GYPP PPP QGYP GYPP YPP GYPP+ Sbjct: 243 QQQQQPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPA 287 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/47 (57%), Positives = 27/47 (57%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 P P G P PQ P P GYPP P QGYP GYPPA PPP PP Sbjct: 251 PPPQGYP-PQGYPPPPPQGYPPQGYPPQGYPPQGYPPAQGPPPQGPP 296 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAPP---PAQGYPATGYPPAAYPPP-GYPPSG 289 QPA P P GYPP PP P QGYP GYPP YPP G PP G Sbjct: 247 QPAYPPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPAQGPPPQG 294 [47][TOP] >UniRef100_UPI00015611AB PREDICTED: similar to glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 n=1 Tax=Equus caballus RepID=UPI00015611AB Length = 366 Score = 60.1 bits (144), Expect = 8e-08 Identities = 34/68 (50%), Positives = 37/68 (54%), Gaps = 14/68 (20%) Frame = -2 Query: 441 PQPA-------PYGQPAPQPAPYGQPYGYPPAPPP------AQG-YPATGYPPAAYPPPG 304 PQP+ PY QP QP+PYGQP GYP P P QG YP GYP YP G Sbjct: 25 PQPSMPPYPGVPYPQPPFQPSPYGQP-GYPQGPSPYPQGGYPQGPYPQGGYPQGPYPQGG 83 Query: 303 YPPSGYSR 280 YPP YS+ Sbjct: 84 YPPDPYSQ 91 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/53 (54%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = -2 Query: 438 QPAPYGQPA-PQ-PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 QP+PYGQP PQ P+PY Q GYP P P GYP YP YPP Y GY Sbjct: 43 QPSPYGQPGYPQGPSPYPQG-GYPQGPYPQGGYPQGPYPQGGYPPDPYSQGGY 94 [48][TOP] >UniRef100_C1WS34 Predicted metal-dependent membrane protease n=1 Tax=Kribbella flavida DSM 17836 RepID=C1WS34_9ACTO Length = 432 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAY-PPPGYPPSG 289 G+A Q PYGQP PAPYGQ YG PP PP Y P Y PPPG PP G Sbjct: 44 GWAGQQPPYGQPPNAPAPYGQQYGQPPQGPP--------YGPGPYGPPPGQPPYG 90 [49][TOP] >UniRef100_Q6QE83 Rhodopsin (Fragment) n=1 Tax=Sthenoteuthis oualaniensis RepID=Q6QE83_9MOLL Length = 295 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/53 (54%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP--GYPPSGY 286 Q A Y P P P Y P GYPP P QGYP GYPP YPPP G PP+G+ Sbjct: 232 QQAAY--PPPPPQGYPPPQGYPPQGYPPQGYPPQGYPPQGYPPPPQGPPPAGW 282 [50][TOP] >UniRef100_Q0D025 Putative uncharacterized protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0D025_ASPTN Length = 548 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/56 (51%), Positives = 31/56 (55%), Gaps = 5/56 (8%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPYGQPYGYPP-----APPPAQGYPATGYPPAAYPPPGYPPS 292 AP P P P +P+P P GYPP APPP QGYP PP PPPG PPS Sbjct: 52 APSPQPQAYPGARPSPSPAPQGYPPSPYSQAPPPPQGYPQA--PPYGQPPPGPPPS 105 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYP-PAPPPAQGYPATG-YPPAAYPPPGYPP 295 GY P P P PQ P PYG P P PPP+Q Y A G YPP PP YPP Sbjct: 73 GYPPSPYSQAPPPPQGYPQAPPYGQPPPGPPPSQQYGAPGQYPP--QPPSHYPP 124 [51][TOP] >UniRef100_Q7Z429 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Homo sapiens RepID=GRINA_HUMAN Length = 371 Score = 60.1 bits (144), Expect = 8e-08 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 5/59 (8%) Frame = -2 Query: 447 YAPQP---APYGQPAPQPAPYGQPYGYP--PAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 YA P APY QP QP+PYGQP GYP P+P P GYP YP YP YP GY Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQEGY 89 [52][TOP] >UniRef100_B9N0V9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N0V9_POPTR Length = 143 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/60 (50%), Positives = 31/60 (51%), Gaps = 7/60 (11%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGY-------PPSGY 286 AP P P+ P P P GYPP PPP GYP GYPP PPPGY PP GY Sbjct: 29 APPPPPHEGYPPPPPPPPPHEGYPPPPPPPPGYP--GYPPPGPPPPGYPGYPPPGPPRGY 86 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/60 (48%), Positives = 32/60 (53%), Gaps = 5/60 (8%) Frame = -2 Query: 450 GYA-PQPAP-YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPP---AAYPPPGYPPSGY 286 GY+ P P P Y AP P P+ PP PPP +GYP PP YPPPG PP GY Sbjct: 15 GYSSPYPPPGYSPSAPPPPPHEGYPPPPPPPPPHEGYPPPPPPPPGYPGYPPPGPPPPGY 74 [53][TOP] >UniRef100_A9P8I3 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8I3_POPTR Length = 125 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 3/55 (5%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPY---GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 283 Q AP+ QP P P+ Y PY GYPP PP GYP T P YPPPG PP GYS Sbjct: 4 QKAPH-QPYP-PSGYSPPYPPPGYPPTTPPYGGYPPTTPPYGGYPPPGAPPPGYS 56 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/58 (53%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPP---AAYPPPGYPPSGY 286 GY+P P G P P PYG GYPP PP GYP G PP + YPPPG PP GY Sbjct: 15 GYSPPYPPPGYP-PTTPPYG---GYPPTTPPYGGYPPPGAPPPGYSGYPPPG-PPRGY 67 [54][TOP] >UniRef100_Q3BDP2 Rhodopsin (Fragment) n=1 Tax=Sepioteuthis australis RepID=Q3BDP2_9MOLL Length = 294 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/41 (65%), Positives = 27/41 (65%) Frame = -2 Query: 408 QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Q A Y P GYPP PP QGYP GYPP YPP GYPP GY Sbjct: 246 QQAAY-PPQGYPPPPP--QGYPPQGYPPQGYPPQGYPPQGY 283 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -2 Query: 411 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSG 289 PQ P P GYPP P QGYP GYPP YPPP G PP G Sbjct: 252 PQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGYPPPQGPPPQG 293 [55][TOP] >UniRef100_UPI0001984D5A PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984D5A Length = 300 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGY-PPAAYPPPGYPPSGY 286 QP P P YGQP+GYPP P Q YPA GY PP AYPP YPP Y Sbjct: 200 QPIPPLVGHPSEPSYGQPHGYPP-PGQVQDYPAAGYPPPQAYPPHAYPPQAY 250 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/66 (42%), Positives = 32/66 (48%), Gaps = 10/66 (15%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPAP----------YGQPYGYPPAPPPAQGYPATGYPPAAYPPPG 304 VG+ +P+ YGQP P P Y P YPP P Q YP YPP AYPP Sbjct: 206 VGHPSEPS-YGQPHGYPPPGQVQDYPAAGYPPPQAYPPHAYPPQAYPPQAYPPQAYPPQA 264 Query: 303 YPPSGY 286 +PP Y Sbjct: 265 HPPQAY 270 [56][TOP] >UniRef100_A1UKQ7 Putative uncharacterized protein n=2 Tax=Mycobacterium RepID=A1UKQ7_MYCSK Length = 317 Score = 59.3 bits (142), Expect = 1e-07 Identities = 31/64 (48%), Positives = 33/64 (51%), Gaps = 9/64 (14%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPA---PYGQPYGYPPAPPPAQGYPAT---GYPPAAY---PPPGYP 298 GY P P P G P P P P GYPP PPP GYP YPPA Y P GYP Sbjct: 19 GYPPPPPPGGYPPPPTQGGYPPPHPGGYPPPPPPQGGYPPPPQGNYPPAGYPVRPQGGYP 78 Query: 297 PSGY 286 P+G+ Sbjct: 79 PAGF 82 [57][TOP] >UniRef100_Q84TC1 Putative uncharacterized protein OJ1754_E06.10 n=1 Tax=Oryza sativa Japonica Group RepID=Q84TC1_ORYSJ Length = 185 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT--GYPPAAYPP------PGYPPSGY 286 P P G P+ P Y GYP A P GYP + GYPP AYPP PGYPP+GY Sbjct: 43 PTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPGAYPPSGYPQQPGYPPAGY 100 Score = 54.7 bits (130), Expect = 3e-06 Identities = 34/67 (50%), Positives = 35/67 (52%), Gaps = 12/67 (17%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQ-PAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG 304 GY P P Q P P Y P GYP APP PA GYP YPP+ YP PPG Sbjct: 24 GY-PGAYPLMQGYPNSPGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPG 82 Query: 303 -YPPSGY 286 YPPSGY Sbjct: 83 AYPPSGY 89 [58][TOP] >UniRef100_Q10BG2 Os03g0819300 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10BG2_ORYSJ Length = 180 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT--GYPPAAYPP------PGYPPSGY 286 P P G P+ P Y GYP A P GYP + GYPP AYPP PGYPP+GY Sbjct: 43 PTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPGAYPPSGYPQQPGYPPAGY 100 Score = 54.7 bits (130), Expect = 3e-06 Identities = 34/67 (50%), Positives = 35/67 (52%), Gaps = 12/67 (17%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQ-PAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG 304 GY P P Q P P Y P GYP APP PA GYP YPP+ YP PPG Sbjct: 24 GY-PGAYPLMQGYPNSPGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPG 82 Query: 303 -YPPSGY 286 YPPSGY Sbjct: 83 AYPPSGY 89 [59][TOP] >UniRef100_B9SDA8 Glycine-rich protein A3, putative n=1 Tax=Ricinus communis RepID=B9SDA8_RICCO Length = 177 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/60 (50%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Frame = -2 Query: 447 YAPQPAPYGQPAPQPAPYGQ---PYGYPPAPPPAQGYPATGYP-PAAYPPPGYPPSGYSR 280 Y PQ P PA P+PYG P YPP+ PP + Y TG+P P YPP YPP+GY R Sbjct: 47 YPPQGFP---PAGYPSPYGYSSPPSAYPPSYPPQKPYGPTGFPSPGGYPPVAYPPAGYPR 103 [60][TOP] >UniRef100_A7PZM5 Chromosome chr15 scaffold_40, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PZM5_VITVI Length = 276 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGY-PPAAYPPPGYPPSGY 286 QP P P YGQP+GYPP P Q YPA GY PP AYPP YPP Y Sbjct: 176 QPIPPLVGHPSEPSYGQPHGYPP-PGQVQDYPAAGYPPPQAYPPHAYPPQAY 226 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/66 (42%), Positives = 32/66 (48%), Gaps = 10/66 (15%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPAP----------YGQPYGYPPAPPPAQGYPATGYPPAAYPPPG 304 VG+ +P+ YGQP P P Y P YPP P Q YP YPP AYPP Sbjct: 182 VGHPSEPS-YGQPHGYPPPGQVQDYPAAGYPPPQAYPPHAYPPQAYPPQAYPPQAYPPQA 240 Query: 303 YPPSGY 286 +PP Y Sbjct: 241 HPPQAY 246 [61][TOP] >UniRef100_Q0D324 Rhodopsin (Fragment) n=1 Tax=Onychoteuthis sp. B3-JMS-2004 RepID=Q0D324_9MOLL Length = 303 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -2 Query: 432 APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 A Q A P P P GYPP P QGYP GYPP YPP GYPP G Sbjct: 243 AQQAQQAAYPPP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 287 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -2 Query: 420 QPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 Q A P P G P GYPP P QGYP GYPP YPP G PP G Sbjct: 248 QAAYPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 292 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 366 PPPAQGYPATGYPPAAYPPPGYPPSGY 286 PPP QGYP GYPP YPP GYPP GY Sbjct: 252 PPPPQGYPPQGYPPQGYPPQGYPPQGY 278 [62][TOP] >UniRef100_A0BKH8 Chromosome undetermined scaffold_112, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BKH8_PARTE Length = 271 Score = 59.3 bits (142), Expect = 1e-07 Identities = 37/74 (50%), Positives = 38/74 (51%), Gaps = 15/74 (20%) Frame = -2 Query: 450 GYAPQPAPY--GQPAPQPAPYGQPY----GYPPAP--PPAQGYPAT-GYPPA-AYPP--- 310 GY PQP P G P QP QPY GYPP P PP GYP GYPP YPP Sbjct: 198 GYPPQPYPQQPGYPPQQPGYPAQPYPPQQGYPPQPGYPPQPGYPPQPGYPPQPGYPPQQP 257 Query: 309 --PGYPPSGYSR*F 274 PGYP GY + F Sbjct: 258 GYPGYPQQGYQKPF 271 [63][TOP] >UniRef100_Q3BDP7 Rhodopsin (Fragment) n=1 Tax=Bathyteuthis berryi RepID=Q3BDP7_9MOLL Length = 267 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPP 295 Q A QPA P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 226 QQAAQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPP 267 [64][TOP] >UniRef100_Q3BDN9 Rhodopsin (Fragment) n=1 Tax=Loliolus sp. JMS-2004 RepID=Q3BDN9_9MOLL Length = 297 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = -2 Query: 408 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPPSG 289 Q A Y P GYPP PPP QGYP GYPP YPP GYPP G Sbjct: 246 QQAAY-PPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPQG 287 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/47 (55%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAPP---PAQGYPATGYPPAAYPPPGYPPSG 289 Q A P P GYPP PP P QGYP GYPP YPP G PP G Sbjct: 246 QQAAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 292 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -2 Query: 429 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 P G P PQ P P GYPP P QGYP GYPP PP G PP Sbjct: 252 PQGYP-PQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPP 295 [65][TOP] >UniRef100_Q0D314 Rhodopsin (Fragment) n=1 Tax=Cranchia scabra RepID=Q0D314_9MOLL Length = 278 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 387 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 P GYPP P QGYP GYPP YPP GYPP GY Sbjct: 238 PAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 271 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 Q PA Y P GYPP P QGYP GYPP YPP GYPP G Sbjct: 233 QAQAPPAGY-PPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 275 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 Q P G P PQ P P GYPP P QGYP GYPP YPP G PP Sbjct: 235 QAPPAGYP-PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGAPP 278 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 375 PPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 PPA P QGYP GYPP YPP GYPP GY Sbjct: 237 PPAGYPPQGYPPQGYPPQGYPPQGYPPQGY 266 [66][TOP] >UniRef100_UPI00017928E3 PREDICTED: hypothetical protein n=1 Tax=Acyrthosiphon pisum RepID=UPI00017928E3 Length = 259 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/58 (48%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = -2 Query: 450 GYAPQPA-PYGQPAPQ--PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 GY P P+ PY PQ P P P YPP P YP YPP +YPPP YPP Y Sbjct: 151 GYYPPPSYPYPSYPPQQYPQPSYPPPSYPPPSYPQPSYPPPSYPPPSYPPPSYPPPSY 208 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/51 (49%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 P Y QP+ P Y P Y P PPP+ YP YPP +YPPP YPP Y Sbjct: 165 PQQYPQPSYPPPSYPPPSYPQPSYPPPS--YPPPSYPPPSYPPPSYPPPAY 213 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/53 (50%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP-PSGY 286 PQP+ Y P+ P Y QP YPP P YP YPP +YPPP YP PS Y Sbjct: 169 PQPS-YPPPSYPPPSYPQP-SYPPPSYPPPSYPPPSYPPPSYPPPAYPQPSPY 219 [67][TOP] >UniRef100_Q70YQ5 PGYRP protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q70YQ5_CHLRE Length = 169 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/61 (59%), Positives = 36/61 (59%), Gaps = 6/61 (9%) Frame = -2 Query: 450 GYAPQP---APYGQPAPQPAPYGQPYGYPPAP--PPAQGYPATGYPPAAYPPPGYPPS-G 289 GY PQP AP G P PQP QP GYPP P PP GYP PPA YP PGYPP G Sbjct: 23 GYPPQPGYPAPAGYP-PQPGYPPQP-GYPPQPGYPPQPGYP----PPAGYPAPGYPPQPG 76 Query: 288 Y 286 Y Sbjct: 77 Y 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 35/61 (57%), Positives = 35/61 (57%), Gaps = 6/61 (9%) Frame = -2 Query: 450 GYAP-QPAPYGQPAPQPAPYGQPYGYPPAP--PPAQGYPAT-GYPPA-AYPPP-GYPPSG 289 GY P P P G P PQP Y P GYPP P PP GYP GYPP YPPP GYP G Sbjct: 13 GYPPGYPPPAGYP-PQPG-YPAPAGYPPQPGYPPQPGYPPQPGYPPQPGYPPPAGYPAPG 70 Query: 288 Y 286 Y Sbjct: 71 Y 71 [68][TOP] >UniRef100_B8AMB4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AMB4_ORYSI Length = 180 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT--GYPPAAYPP------PGYPPSGY 286 P P G P+ P Y GYP A P GYP + GYPP AYPP PGYPP+GY Sbjct: 43 PTPGGYPSAPPGQYPPAGGYPGAQYPPGGYPPSQGGYPPGAYPPSGYPQQPGYPPAGY 100 Score = 54.3 bits (129), Expect = 4e-06 Identities = 34/67 (50%), Positives = 34/67 (50%), Gaps = 12/67 (17%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQ-PAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG 304 GY P P Q P P Y P GYP APP PA GYP YPP YP PPG Sbjct: 24 GY-PGAYPLMQGYPNSPGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPGGYPPSQGGYPPG 82 Query: 303 -YPPSGY 286 YPPSGY Sbjct: 83 AYPPSGY 89 [69][TOP] >UniRef100_A2XNE8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XNE8_ORYSI Length = 185 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT--GYPPAAYPP------PGYPPSGY 286 P P G P+ P Y GYP A P GYP + GYPP AYPP PGYPP+GY Sbjct: 43 PTPGGYPSAPPGQYPPADGYPGAQYPPGGYPPSQGGYPPGAYPPSGYPQQPGYPPAGY 100 Score = 55.1 bits (131), Expect = 2e-06 Identities = 34/67 (50%), Positives = 34/67 (50%), Gaps = 12/67 (17%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQ-PAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG 304 GY P P Q P P Y P GYP APP PA GYP YPP YP PPG Sbjct: 24 GY-PGAYPLMQGYPNSPGQYPTPGGYPSAPPGQYPPADGYPGAQYPPGGYPPSQGGYPPG 82 Query: 303 -YPPSGY 286 YPPSGY Sbjct: 83 AYPPSGY 89 [70][TOP] >UniRef100_Q6QE84 Rhodopsin (Fragment) n=1 Tax=Loligo forbesi RepID=Q6QE84_LOLFO Length = 305 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 295 Q Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 241 QAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 285 [71][TOP] >UniRef100_Q3BDP0 Rhodopsin (Fragment) n=1 Tax=Photololigo sp. JMS-2004 RepID=Q3BDP0_9MOLL Length = 305 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 295 Q Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 241 QAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 285 [72][TOP] >UniRef100_Q3BDN7 Rhodopsin (Fragment) n=1 Tax=Heteroteuthis hawaiiensis RepID=Q3BDN7_9MOLL Length = 294 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/47 (63%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPPSG 289 Q A QPA P GYPP PPP QGYP GYPP AYPP GYPP G Sbjct: 234 QQAQQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPPQG 278 [73][TOP] >UniRef100_A7S7Y1 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S7Y1_NEMVE Length = 349 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/63 (47%), Positives = 30/63 (47%), Gaps = 11/63 (17%) Frame = -2 Query: 441 PQPAPYGQPAPQPAP--YGQPYGYPPAPPPAQGYPATGY---------PPAAYPPPGYPP 295 P P G P P P Y P GYPP P Q YPA Y PP AYP PGYPP Sbjct: 150 PYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPP 209 Query: 294 SGY 286 GY Sbjct: 210 QGY 212 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/60 (51%), Positives = 34/60 (56%), Gaps = 7/60 (11%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPY-GQPY---GYPPAPPPAQGYPATGYPPAAYPPPG-YPPS--GYS 283 P P Y + P PY QPY GYPP PPP Q YP GYPP YPP G YP + GY+ Sbjct: 168 PPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPP-QAYPQPGYPPQGYPPTGPYPQTQPGYA 226 [74][TOP] >UniRef100_C8VNA3 Annexin, putative (Eurofung) n=2 Tax=Emericella nidulans RepID=C8VNA3_EMENI Length = 501 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/63 (52%), Positives = 33/63 (52%), Gaps = 13/63 (20%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPYGQ------------PYGYPPAPPPAQGYPATGYPPAA-YPPPG 304 A PAPY QP P YGQ PYG PP PP A YP YPPAA YPP G Sbjct: 94 AQPPAPYQQPPSGPGSYGQANPPYGSAPPPNPYGTPP-PPHAAPYPPGQYPPAAGYPPQG 152 Query: 303 YPP 295 YPP Sbjct: 153 YPP 155 [75][TOP] >UniRef100_Q17094 Rhodopsin (Fragment) n=1 Tax=Alloteuthis subulata RepID=OPSD_LOLSU Length = 439 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 295 Q Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 374 QAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 418 [76][TOP] >UniRef100_P24603 Rhodopsin n=1 Tax=Loligo forbesi RepID=OPSD_LOLFO Length = 452 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 295 Q Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 381 QAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 425 [77][TOP] >UniRef100_UPI0001B5174A hypothetical protein SgriT_24334 n=1 Tax=Streptomyces griseoflavus Tu4000 RepID=UPI0001B5174A Length = 323 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQ--PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 QP PYG QP PYGQ PYG P P G P GYP A PPPG P GY Sbjct: 5 QPGPYGGQPQQPGPYGQPGPYGQQPQAPQPGGQPGYGYPQQA-PPPGQPGYGY 56 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/53 (60%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQP-YGYP-PAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 QP PYGQ P P GQP YGYP APPP G P GYP A PPPG P GY Sbjct: 21 QPGPYGQQPQAPQPGGQPGYGYPQQAPPP--GQPGYGYPQQA-PPPGQPGYGY 70 [78][TOP] >UniRef100_UPI0000E21CE9 PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 (glutamate binding) isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E21CE9 Length = 304 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = -2 Query: 447 YAPQP---APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 YA P APY QP QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSP---YPQGGYPQGPYPQGGYPQGPY 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -2 Query: 438 QPAPYGQP----APQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 QP+PYGQP P P P G GYP P P GYP YP YP YP GY Sbjct: 48 QPSPYGQPGYPHGPSPYPQG---GYPQGPYPQGGYPQGPYPQEVYPQGPYPQGGY 99 [79][TOP] >UniRef100_UPI0000E21CE8 PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 (glutamate binding) isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E21CE8 Length = 328 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = -2 Query: 447 YAPQP---APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 YA P APY QP QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSP---YPQGGYPQGPYPQGGYPQGPY 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -2 Query: 438 QPAPYGQP----APQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 QP+PYGQP P P P G GYP P P GYP YP YP YP GY Sbjct: 48 QPSPYGQPGYPHGPSPYPQG---GYPQGPYPQGGYPQGPYPQEVYPQGPYPQGGY 99 [80][TOP] >UniRef100_UPI0000E21CE7 PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 (glutamate binding) isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E21CE7 Length = 371 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = -2 Query: 447 YAPQP---APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 YA P APY QP QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSP---YPQGGYPQGPYPQGGYPQGPY 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -2 Query: 438 QPAPYGQP----APQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 QP+PYGQP P P P G GYP P P GYP YP YP YP GY Sbjct: 48 QPSPYGQPGYPHGPSPYPQG---GYPQGPYPQGGYPQGPYPQEVYPQGPYPQGGY 99 [81][TOP] >UniRef100_UPI0000E21CE6 PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 (glutamate binding) isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E21CE6 Length = 352 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = -2 Query: 447 YAPQP---APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 YA P APY QP QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSP---YPQGGYPQGPYPQGGYPQGPY 84 [82][TOP] >UniRef100_B6SHN0 Adhesive/proline-rich protein n=1 Tax=Zea mays RepID=B6SHN0_MAIZE Length = 93 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/58 (51%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPAPYGQPY---GYPPA--PPPAQGYPATGYPPAAYPPPGYPP 295 + Y Q P G P Q P Y GYPPA PPPAQGYP GYP YP GYPP Sbjct: 1 MSYYGQQPPVGVPPQQGYPGKDGYPPAGYPPAGYPPPAQGYPPQGYPQQGYPQQGYPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/53 (52%), Positives = 28/53 (52%), Gaps = 6/53 (11%) Frame = -2 Query: 426 YGQPAPQPAPYGQPY----GYPPAPPPAQGYP--ATGYPPAAYPPPGYPPSGY 286 YGQ P P Q Y GYPPA P GYP A GYPP YP GYP GY Sbjct: 4 YGQQPPVGVPPQQGYPGKDGYPPAGYPPAGYPPPAQGYPPQGYPQQGYPQQGY 56 [83][TOP] >UniRef100_C4JQ73 RfeF protein n=1 Tax=Uncinocarpus reesii 1704 RepID=C4JQ73_UNCRE Length = 618 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/67 (50%), Positives = 37/67 (55%), Gaps = 12/67 (17%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPAP---YGQPYG---YPPA---PPPAQGYP---ATGYPPAAYPP 310 +G PQ +PYGQP PQ P YGQP YPP PP QGYP A+GYPP P Sbjct: 177 MGSLPQQSPYGQPYPQQQPQPYYGQPPQQGQYPPQSPHPPQGQGYPPQGASGYPPQGSPY 236 Query: 309 PGYPPSG 289 PG P G Sbjct: 237 PGAPQYG 243 [84][TOP] >UniRef100_A1SHX4 TM2 domain containing protein+B7201 n=1 Tax=Nocardioides sp. JS614 RepID=A1SHX4_NOCSJ Length = 155 Score = 57.8 bits (138), Expect = 4e-07 Identities = 37/80 (46%), Positives = 41/80 (51%), Gaps = 9/80 (11%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPP---------AAYPPPGYPPS 292 AP P PYG AP P PYGQP GYP PPPA GYP TG P +P G P S Sbjct: 29 APAPPPYG--APAPPPYGQPSGYP--PPPAGGYPPTGAAPYGASPAAPYGVHPVTGIPYS 84 Query: 291 GYSR*FI*HMLCVGLLRQLI 232 ++ L GLL+ LI Sbjct: 85 DKTK------LVAGLLQILI 98 [85][TOP] >UniRef100_Q3BDP4 Rhodopsin (Fragment) n=1 Tax=Ommastrephes bartramii RepID=Q3BDP4_9MOLL Length = 296 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/52 (55%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP--GYPPSG 289 Q A Y P PQ P P GYPP P QGYP GYPP YPPP G PP G Sbjct: 237 QQAAYPPPPPQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPPPQGPPPQG 285 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = -2 Query: 390 QPYGYPPAPP---PAQGYPATGYPPAAYPPPGYPPSGY 286 Q YPP PP P QGYP GYPP YPP GYPP GY Sbjct: 237 QQAAYPPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 274 [86][TOP] >UniRef100_Q0D322 Rhodopsin (Fragment) n=1 Tax=Histioteuthis oceanica RepID=Q0D322_9MOLL Length = 299 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/56 (51%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPYG--QPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 289 A A Q A P P P GYPP PPP QGYP GYPP YPP G PP G Sbjct: 233 AKMQAQQAQQAAYPPPQQGYPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGAPPQG 288 [87][TOP] >UniRef100_A9VE52 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VE52_MONBE Length = 458 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/60 (43%), Positives = 28/60 (46%), Gaps = 6/60 (10%) Frame = -2 Query: 447 YAPQPAPYGQPA------PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Y PQ PY P PQ PY P YPP P+Q + YPP AYPP YP Y Sbjct: 373 YPPQAYPYNPPQTHPHDPPQAYPYNPPQAYPPQAHPSQAHSPQAYPPQAYPPQAYPSQAY 432 [88][TOP] >UniRef100_Q2H239 Putative uncharacterized protein n=1 Tax=Chaetomium globosum RepID=Q2H239_CHAGB Length = 904 Score = 57.8 bits (138), Expect = 4e-07 Identities = 37/67 (55%), Positives = 38/67 (56%), Gaps = 12/67 (17%) Frame = -2 Query: 450 GYAPQPAP--YGQ----PAP----QPAPYGQPYGYPPAP-PPAQGYPATG-YPPAAYPPP 307 GY P P P YGQ PAP Q +PYG P YPPA PPA GY A G PP A PPP Sbjct: 282 GYQPPPPPPHYGQYPAPPAPPQYVQQSPYGPP-SYPPAQYPPAPGYYAPGAAPPPAPPPP 340 Query: 306 GYPPSGY 286 YPP Y Sbjct: 341 SYPPGTY 347 Score = 55.1 bits (131), Expect = 2e-06 Identities = 35/81 (43%), Positives = 37/81 (45%), Gaps = 26/81 (32%) Frame = -2 Query: 450 GYAPQPAPYG-QPAPQPAPYGQ--------------PYGYPPAPPPAQGYPATGY----- 331 GY P P P G QP P P YGQ PYG PP+ PPAQ PA GY Sbjct: 273 GYPPNPYPGGYQPPPPPPHYGQYPAPPAPPQYVQQSPYG-PPSYPPAQYPPAPGYYAPGA 331 Query: 330 ------PPAAYPPPGYPPSGY 286 PP +YPP YPP Y Sbjct: 332 APPPAPPPPSYPPGTYPPQQY 352 [89][TOP] >UniRef100_UPI0001925977 PREDICTED: similar to galectin-3 n=1 Tax=Hydra magnipapillata RepID=UPI0001925977 Length = 231 Score = 57.4 bits (137), Expect = 5e-07 Identities = 33/63 (52%), Positives = 37/63 (58%), Gaps = 8/63 (12%) Frame = -2 Query: 450 GYAPQP-APYGQPAPQPAPYGQPYGYPPAP--PPAQG-----YPATGYPPAAYPPPGYPP 295 G AP P AP GQ P P G P G+ P P PP QG +P T YPP+ YPP G+PP Sbjct: 55 GQAPYPGAPLGQ-VPYP---GAPSGHAPYPGGPPTQGPYPGGHPQTNYPPSGYPPTGHPP 110 Query: 294 SGY 286 SGY Sbjct: 111 SGY 113 [90][TOP] >UniRef100_UPI0001739304 unknown protein n=1 Tax=Arabidopsis thaliana RepID=UPI0001739304 Length = 124 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/67 (50%), Positives = 35/67 (52%), Gaps = 13/67 (19%) Frame = -2 Query: 450 GYAPQ----PAPYGQPAPQPAPYGQPYGYPPA--PPP----AQGYPATGYPPAAYP---P 310 GY P+ PA Y PA P P GYPPA PPP QGYPA GYPP YP P Sbjct: 17 GYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQYPQGHP 76 Query: 309 PGYPPSG 289 P YP G Sbjct: 77 PQYPYQG 83 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 12/55 (21%) Frame = -2 Query: 414 APQPAPYGQPYGYPPA--PPPA----QGYPATGYPPAAYPPP------GYPPSGY 286 AP P Y GYPPA PPPA YP GYPPA YPPP GYP GY Sbjct: 12 APPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGY 66 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/59 (45%), Positives = 28/59 (47%), Gaps = 9/59 (15%) Frame = -2 Query: 435 PAPYGQPAPQ---PAPYGQPYGYPPAPPPAQGYPATGYPPA------AYPPPGYPPSGY 286 P P G P + PA Y P GYPP P GYP GYPP YP GYPP Y Sbjct: 13 PPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQY 71 [91][TOP] >UniRef100_UPI0000587BAF PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000587BAF Length = 144 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/67 (52%), Positives = 36/67 (53%), Gaps = 14/67 (20%) Frame = -2 Query: 450 GYAPQPAPYGQP-----APQPAPYGQPYGYPPAP---PPAQG--YP----ATGYPPAAYP 313 GY PQ Y QP AP PA Y GYPPA PPA G YP A GYPPA P Sbjct: 18 GYPPQAGGYPQPGGYPQAPAPAGYPPQGGYPPAAGGYPPAAGGGYPPPAGAGGYPPAPAP 77 Query: 312 PPGYPPS 292 PGYPP+ Sbjct: 78 APGYPPA 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/67 (52%), Positives = 36/67 (53%), Gaps = 14/67 (20%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAP-----PPAQGYP--ATGYPPAA---YPPP-- 307 G AP P G PQ Y QP GYP AP PP GYP A GYPPAA YPPP Sbjct: 8 GGAPYPQQGGGYPPQAGGYPQPGGYPQAPAPAGYPPQGGYPPAAGGYPPAAGGGYPPPAG 67 Query: 306 --GYPPS 292 GYPP+ Sbjct: 68 AGGYPPA 74 [92][TOP] >UniRef100_Q9M2X4 Putative uncharacterized protein T16K5.190 n=1 Tax=Arabidopsis thaliana RepID=Q9M2X4_ARATH Length = 651 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/67 (50%), Positives = 35/67 (52%), Gaps = 13/67 (19%) Frame = -2 Query: 450 GYAPQ----PAPYGQPAPQPAPYGQPYGYPPA--PPP----AQGYPATGYPPAAYP---P 310 GY P+ PA Y PA P P GYPPA PPP QGYPA GYPP YP P Sbjct: 544 GYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQYPQGHP 603 Query: 309 PGYPPSG 289 P YP G Sbjct: 604 PQYPYQG 610 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 12/55 (21%) Frame = -2 Query: 414 APQPAPYGQPYGYPPA--PPPA----QGYPATGYPPAAYPPP------GYPPSGY 286 AP P Y GYPPA PPPA YP GYPPA YPPP GYP GY Sbjct: 539 APPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGY 593 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/59 (45%), Positives = 28/59 (47%), Gaps = 9/59 (15%) Frame = -2 Query: 435 PAPYGQPAPQ---PAPYGQPYGYPPAPPPAQGYPATGYPPA------AYPPPGYPPSGY 286 P P G P + PA Y P GYPP P GYP GYPP YP GYPP Y Sbjct: 540 PPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQY 598 [93][TOP] >UniRef100_Q0WPY7 Putative uncharacterized protein At3g49840 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q0WPY7_ARATH Length = 111 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/67 (50%), Positives = 35/67 (52%), Gaps = 13/67 (19%) Frame = -2 Query: 450 GYAPQ----PAPYGQPAPQPAPYGQPYGYPPA--PPP----AQGYPATGYPPAAYP---P 310 GY P+ PA Y PA P P GYPPA PPP QGYPA GYPP YP P Sbjct: 4 GYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQYPQGHP 63 Query: 309 PGYPPSG 289 P YP G Sbjct: 64 PQYPYQG 70 [94][TOP] >UniRef100_Q6QE96 Rhodopsin (Fragment) n=1 Tax=Octopus bimaculoides RepID=Q6QE96_OCTBM Length = 294 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/52 (57%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPP-PAQGYPATG-YPPAAYPPPGYPPSG 289 Q A Y QP PQ P P GYPP P QGYP G YPP YPP GYPP G Sbjct: 243 QQAAYQQPPPQGYP---PQGYPPQGAYPPQGYPPQGAYPPQGYPPQGYPPQG 291 [95][TOP] >UniRef100_Q3BDP3 Rhodopsin (Fragment) n=1 Tax=Lolliguncula brevis RepID=Q3BDP3_9MOLL Length = 296 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/46 (63%), Positives = 29/46 (63%), Gaps = 4/46 (8%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPA-AYPPPGYPP 295 Q A QPA Y P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 243 QQAAQPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPPQGYPPQGYPP 287 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 5/57 (8%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPYGQPYGYPPAPP---PAQGYPAT-GYPPAAYPPP-GYPPSG 289 A Q A P PQ P P GYPP PP P QGYP GYPP YPPP G PP+G Sbjct: 242 AQQAAQPAYPPPQGYP---PQGYPPPPPQGYPPQGYPPPQGYPPQGYPPPQGPPPAG 295 [96][TOP] >UniRef100_A5PLE2 UPF0467 protein C5orf32 homolog n=1 Tax=Danio rerio RepID=CE032_DANRE Length = 118 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/51 (52%), Positives = 27/51 (52%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 QP Y P P P Q GYP P QGYPA GYPP YP GYP GY Sbjct: 5 QPPAYTGPGPAPGYPAQ--GYPAQGYPTQGYPAQGYPPQGYPAQGYPAQGY 53 [97][TOP] >UniRef100_C8XIP8 Membrane-flanked domain protein n=1 Tax=Nakamurella multipartita DSM 44233 RepID=C8XIP8_9ACTO Length = 479 Score = 57.0 bits (136), Expect = 6e-07 Identities = 34/75 (45%), Positives = 37/75 (49%), Gaps = 18/75 (24%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPA-----------PYGQPYGYPPAPPPAQGYPA-------TGYPP 325 GY P A Y QP PA P GQP GYPP P P Q YPA GYPP Sbjct: 229 GYPPA-AGYAQPGYGPAHPQTGPTQGYPPPGQPQGYPP-PGPTQSYPAGHQPTQSPGYPP 286 Query: 324 AAYPPPGYPPSGYSR 280 + Y GYPP+GY + Sbjct: 287 SGYATGGYPPNGYQQ 301 [98][TOP] >UniRef100_C0IN06 Proline-rich family protein n=1 Tax=Cicer arietinum RepID=C0IN06_CICAR Length = 186 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = -2 Query: 405 PAPYGQPYGYPPAP--PPAQGYPATGYPPA-AYPPPGYPPSGY 286 P Y +GYPP PP QGYP +GYPP YPP GYPP+GY Sbjct: 37 PGAYPPQHGYPPQQGYPPQQGYPPSGYPPQQGYPPQGYPPAGY 79 [99][TOP] >UniRef100_A8J964 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J964_CHLRE Length = 148 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/58 (48%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPP-APPPAQGYPATGYPPAAYPPPGYPPSGYSR 280 GY P YG P P+PY P GYPP PPP GY P YPPPG PP Y++ Sbjct: 50 GYPPPGPGYGAPPAYPSPYSAPPGYPPQGPPPPPGY------PGGYPPPG-PPGAYAQ 100 [100][TOP] >UniRef100_Q0D326 Rhodopsin (Fragment) n=2 Tax=Euprymna RepID=Q0D326_9MOLL Length = 298 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 295 Q A Q A Y P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 244 QQAQQQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 287 [101][TOP] >UniRef100_B8Q2W3 Opsin n=1 Tax=Euprymna scolopes RepID=B8Q2W3_9MOLL Length = 448 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 295 Q A Q A Y P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 384 QQAQQQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 427 [102][TOP] >UniRef100_B8Q2W2 Opsin n=1 Tax=Euprymna scolopes RepID=B8Q2W2_9MOLL Length = 448 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 295 Q A Q A Y P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 384 QQAQQQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 427 [103][TOP] >UniRef100_A2EVN2 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2EVN2_TRIVA Length = 231 Score = 57.0 bits (136), Expect = 6e-07 Identities = 33/58 (56%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Frame = -2 Query: 444 APQPAPYGQPAPQ--PAPYGQPY-GYPPAPP-PAQGYPATGYPPAAYPPPGYPP-SGY 286 AP AP+ QP PQ P G P GYPP P QGYP GYPP YP PGYPP GY Sbjct: 124 APNEAPF-QPRPQGYPPMGGYPQAGYPPQGGYPPQGYPQAGYPPQGYPQPGYPPQQGY 180 [104][TOP] >UniRef100_B9I6F5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I6F5_POPTR Length = 192 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/62 (51%), Positives = 34/62 (54%), Gaps = 8/62 (12%) Frame = -2 Query: 450 GYAPQPAPYG-----QPAPQPAPYGQPYGYPPAP-PPAQGYPATGYPP-AAYPPP-GYPP 295 G+ P APY Q PA Y P GYPP+ PP GYP GYPP YPPP GYPP Sbjct: 27 GHYPPSAPYPPHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGYPPPGGYPPPGGYPP 86 Query: 294 SG 289 G Sbjct: 87 PG 88 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/61 (54%), Positives = 35/61 (57%), Gaps = 6/61 (9%) Frame = -2 Query: 450 GYAPQ--PAPYGQPAPQPAPYGQPYGYPPAP-PPAQGYPATGY--PPAAYPPPG-YPPSG 289 GY P P P G P P+ Y P GYPPA PP GYP G PP YPPPG YPP+G Sbjct: 44 GYPPAGYPPPGGYP---PSGYPPPGGYPPAGYPPPGGYPPPGGYPPPGGYPPPGAYPPAG 100 Query: 288 Y 286 Y Sbjct: 101 Y 101 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/33 (75%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Frame = -2 Query: 378 YPP-APPPAQGYPATGYPPAAYPPP-GYPPSGY 286 YPP AP P GYP GYPPA YPPP GYPPSGY Sbjct: 29 YPPSAPYPPHGYPQQGYPPAGYPPPGGYPPSGY 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/44 (59%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = -2 Query: 411 PQPAPYGQPYGYPPAPPPAQGYPATG-YPPAAYPPPG-YPPSGY 286 P APY P+GYP P GYP G YPP+ YPPPG YPP+GY Sbjct: 30 PPSAPY-PPHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGY 72 [105][TOP] >UniRef100_Q581B0 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei RepID=Q581B0_9TRYP Length = 370 Score = 56.6 bits (135), Expect = 8e-07 Identities = 39/84 (46%), Positives = 41/84 (48%), Gaps = 27/84 (32%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-----YGYPP------APPPAQGY----PATGY----P 328 G P PA YGQP P PA YGQP YG PP PPP GY P GY P Sbjct: 94 GQPPPPAGYGQP-PPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPP 152 Query: 327 PAAY----PPPGY----PPSGYSR 280 PA Y PP GY PP+GY + Sbjct: 153 PAGYGQPPPPAGYGQPPPPAGYGQ 176 Score = 55.1 bits (131), Expect = 2e-06 Identities = 38/81 (46%), Positives = 40/81 (49%), Gaps = 27/81 (33%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQP-----YGYPP------APPPAQGY----PATGY----PPAA 319 P PA YGQP P PA YGQP YG PP PPP GY P GY PPA Sbjct: 88 PPPAGYGQPPP-PAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAG 146 Query: 318 Y----PPPGY----PPSGYSR 280 Y PP GY PP+GY + Sbjct: 147 YGQPPPPAGYGQPPPPAGYGQ 167 [106][TOP] >UniRef100_A2ED24 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2ED24_TRIVA Length = 232 Score = 56.6 bits (135), Expect = 8e-07 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -2 Query: 450 GYAPQPA--PYGQPAPQPAPYGQPY---GYPPAP--PPAQGYPATGYPPAAYPP-PGYPP 295 GY PQ P G P QP P QPY GYPP PP Q YP GYPP YPP P YPP Sbjct: 142 GYPPQGPYPPQGYPQ-QPYPPQQPYPPQGYPPQQSYPPQQPYPPQGYPPQPYPPQPAYPP 200 Query: 294 SGYSR 280 S+ Sbjct: 201 QSNSQ 205 [107][TOP] >UniRef100_A0CRV7 Chromosome undetermined scaffold_25, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CRV7_PARTE Length = 177 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/54 (55%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPA-AYPP-PGYPP 295 G P P P QP P PY GY PPP GYP GYPPA YPP PGYPP Sbjct: 25 GQPPYPQPGYQPPPTGYPYPPTPGY---PPPVGGYPQPGYPPAPGYPPTPGYPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = -2 Query: 447 YAPQPAP-YGQPA-PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPP-PGYPPS-GY 286 Y P P P YGQP PQP P GYP P P P GYP YPP PGYPP+ GY Sbjct: 16 YPPPPPPAYGQPPYPQPGYQPPPTGYPYPPTPGYPPPVGGYPQPGYPPAPGYPPTPGY 73 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/64 (50%), Positives = 33/64 (51%), Gaps = 12/64 (18%) Frame = -2 Query: 441 PQPAPYGQPA-----PQPAPYGQP-YGYPPAPPPAQGYP---ATGYPP--AAYPPPGYPP 295 P P PYG P P P YGQP Y P PP GYP GYPP YP PGYPP Sbjct: 4 PPPPPYGYPPAQYPPPPPPAYGQPPYPQPGYQPPPTGYPYPPTPGYPPPVGGYPQPGYPP 63 Query: 294 S-GY 286 + GY Sbjct: 64 APGY 67 [108][TOP] >UniRef100_B2B343 Predicted CDS Pa_6_1130 n=1 Tax=Podospora anserina RepID=B2B343_PODAN Length = 505 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/60 (53%), Positives = 33/60 (55%), Gaps = 10/60 (16%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQP--APYGQPYGYPP------APPPAQGY--PATGYPPAAYPPPGY 301 G P P PYG P+PQP AP QPYG PP APPPAQ Y P G P A PP Y Sbjct: 48 GQPPPPQPYGAPSPQPYGAPSPQPYGAPPPAQPYGAPPPAQPYGAPPPGQPYGAPPPQPY 107 [109][TOP] >UniRef100_Q8LCL8 UPF0467 protein B n=1 Tax=Arabidopsis thaliana RepID=U647B_ARATH Length = 101 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/75 (41%), Positives = 36/75 (48%) Frame = -2 Query: 429 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR*FI*HMLCVG 250 P GQP PQ Y P GYP P QGYP GYP YP GYPP + G Sbjct: 28 PPGQPYPQQG-YPPPQGYPQQGYPPQGYPPQGYPEQGYPQQGYPPQQQQQ----QKHSPG 82 Query: 249 LLRQLIASVICFLQL 205 +L IA++ C+ L Sbjct: 83 MLEGCIAALCCYCVL 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/62 (50%), Positives = 33/62 (53%), Gaps = 6/62 (9%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPA--PYGQPY---GYPPAPP-PAQGYPATGYPPAAYPPPGYPPS 292 VG P A + P+ A P GQPY GYPP P QGYP GYPP YP GYP Sbjct: 8 VGVPPSHAYPAEGPPKDAYPPPGQPYPQQGYPPPQGYPQQGYPPQGYPPQGYPEQGYPQQ 67 Query: 291 GY 286 GY Sbjct: 68 GY 69 [110][TOP] >UniRef100_C9Z7F4 Putative membrane protein n=1 Tax=Streptomyces scabiei 87.22 RepID=C9Z7F4_STRSC Length = 319 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/61 (50%), Positives = 31/61 (50%), Gaps = 9/61 (14%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP---------YGYPPAPPPAQGYPATGYPPAAYPPPGYP 298 G QP PYGQP QP PYGQ YGYP PPAQ P GYP A P G P Sbjct: 11 GQPQQPGPYGQPGGQPGPYGQQPPQAAPQPGYGYPQQAPPAQ--PGYGYPQQA--PQGVP 66 Query: 297 P 295 P Sbjct: 67 P 67 [111][TOP] >UniRef100_A8IES3 Predicted protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8IES3_CHLRE Length = 699 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = -2 Query: 444 APQPAPYGQPAPQPA--PYGQPYGYPPAPPPAQGYPATGY-PPAAYPPPGYPP 295 AP P G AP P P G P GYPP P G P GY PP AYPPPG PP Sbjct: 565 APTMHPGGHAAPPPGAPPPGAPGGYPPPGAPPPGAPGGGYPPPGAYPPPGAPP 617 [112][TOP] >UniRef100_Q6QE98 Rhodopsin (Fragment) n=1 Tax=Octopus rubescens RepID=Q6QE98_9MOLL Length = 291 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/51 (60%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPP--APPPAQGYPATG-YPPAAYPPPGYPP 295 Q A Y QP P P Y P GYPP A PP QGYP G YPP YPP GYPP Sbjct: 243 QQAAYQQPPP-PQGY-PPQGYPPQGAYPPQQGYPXQGAYPPQGYPPQGYPP 291 [113][TOP] >UniRef100_Q3BDN8 Rhodopsin (Fragment) n=1 Tax=Rossia pacifica RepID=Q3BDN8_ROSPA Length = 305 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 295 Q A QPA P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 244 QQAQQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 286 [114][TOP] >UniRef100_A9V0Y5 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V0Y5_MONBE Length = 117 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 P PYGQP P GYP P QGYP GYP YP GYP GY Sbjct: 19 PPPYGQPQYPQYPQYPQQGYPQQGYPQQGYPQQGYPQQGYPQQGYPQQGY 68 [115][TOP] >UniRef100_Q8S8M0 UPF0467 protein At2g41420 n=1 Tax=Arabidopsis thaliana RepID=U647A_ARATH Length = 98 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = -2 Query: 429 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 P G P PQ P P GYP P QGYP GYP YPP GYP GY Sbjct: 8 PVGVPPPQGYP---PEGYPKDAYPPQGYPPQGYPQQGYPPQGYPQQGY 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -2 Query: 426 YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Y QP P P GYPP P YP GYPP YP GYPP GY Sbjct: 4 YNQP---PVGVPPPQGYPPEGYPKDAYPPQGYPPQGYPQQGYPPQGY 47 [116][TOP] >UniRef100_Q6P6R0 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Rattus norvegicus RepID=GRINA_RAT Length = 348 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = -2 Query: 441 PQP-APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 P P APY Q A QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 36 PYPGAPYPQAAFQPSPYGQP-GYPHGPGP---YPQGGYPQGPYPQGGYPQGPY 84 [117][TOP] >UniRef100_Q9ESF4 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Mus musculus RepID=GRINA_MOUSE Length = 345 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -2 Query: 444 APQP-APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 AP P APY Q QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 32 APYPGAPYPQAPFQPSPYGQP-GYPHGPSP---YPQGGYPQGPYPQGGYPQGPY 81 [118][TOP] >UniRef100_UPI0000E49F56 PREDICTED: similar to annexin A6 n=2 Tax=Strongylocentrotus purpuratus RepID=UPI0000E49F56 Length = 302 Score = 55.8 bits (133), Expect = 1e-06 Identities = 34/62 (54%), Positives = 35/62 (56%), Gaps = 9/62 (14%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYP--ATGYPPAA---YPPP----GYP 298 G AP P G PQ Y QP GYP AP PA GYP GYPPAA YPPP GYP Sbjct: 8 GGAPYPQQGGGYPPQAGGYPQPGGYPQAPAPA-GYPPQGGGYPPAAGGGYPPPAGAGGYP 66 Query: 297 PS 292 P+ Sbjct: 67 PA 68 Score = 55.1 bits (131), Expect = 2e-06 Identities = 35/64 (54%), Positives = 36/64 (56%), Gaps = 11/64 (17%) Frame = -2 Query: 450 GYAPQPAPYGQPA--PQ-PAPYGQPY---GYPPA-----PPPAQGYPATGYPPAAYPPPG 304 GY PQ Y QP PQ PAP G P GYPPA PPPA A GYPPA P PG Sbjct: 18 GYPPQAGGYPQPGGYPQAPAPAGYPPQGGGYPPAAGGGYPPPAG---AGGYPPAPAPAPG 74 Query: 303 YPPS 292 YPP+ Sbjct: 75 YPPA 78 [119][TOP] >UniRef100_C1ZAA7 FHA domain-containing protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZAA7_PLALI Length = 350 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/63 (47%), Positives = 30/63 (47%), Gaps = 8/63 (12%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPY----GQPYGYPPAPPPAQGYPATGYP----PAAYPPPGYPP 295 GY PQP P G P Q Y GYP A PA YP GYP PA YP PGYP Sbjct: 196 GYPPQPYPAGMPQYQNPQYPGMTNPGMGYPNAGYPAASYPPAGYPQGMYPAGYPMPGYPQ 255 Query: 294 SGY 286 Y Sbjct: 256 QAY 258 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/63 (47%), Positives = 32/63 (50%), Gaps = 8/63 (12%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPY----GYPPAPPPAQGYPATGYPPAAYPPPGYP----P 295 GYA AP PQP P G P YP P GYP GYP A+YPP GYP P Sbjct: 186 GYANVGAPPQGYPPQPYPAGMPQYQNPQYPGMTNPGMGYPNAGYPAASYPPAGYPQGMYP 245 Query: 294 SGY 286 +GY Sbjct: 246 AGY 248 [120][TOP] >UniRef100_Q0D312 Rhodopsin (Fragment) n=1 Tax=Todaropsis eblanae RepID=Q0D312_9MOLL Length = 300 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/50 (54%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSG 289 P Y QP P P GYPP P QGYP GYPP YPPP G PP G Sbjct: 250 PQGYAQPPP-------PQGYPPQGYPPQGYPQQGYPPQGYPPPQGAPPQG 292 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/39 (58%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = -2 Query: 390 QPYGYPPA----PPPAQGYPATGYPPAAYPPPGYPPSGY 286 Q YPP PPP QGYP GYPP YP GYPP GY Sbjct: 244 QQAAYPPQGYAQPPPPQGYPPQGYPPQGYPQQGYPPQGY 282 [121][TOP] >UniRef100_C3Y001 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3Y001_BRAFL Length = 288 Score = 55.8 bits (133), Expect = 1e-06 Identities = 38/71 (53%), Positives = 40/71 (56%), Gaps = 18/71 (25%) Frame = -2 Query: 450 GYAPQPA------PYGQPAPQ---PAPYGQPY--GYPPAP--PPAQGY-PATGYPPAA-- 319 GY P P PYG P P P P GQ + GYPPA PPA GY PA GYPPAA Sbjct: 28 GYPPAPGGYPPANPYGGPPPSSGPPPPPGQGFAGGYPPAGGYPPAGGYPPAGGYPPAAGG 87 Query: 318 YPPP--GYPPS 292 YPP GYPP+ Sbjct: 88 YPPAGGGYPPA 98 Score = 53.9 bits (128), Expect = 5e-06 Identities = 33/61 (54%), Positives = 35/61 (57%), Gaps = 7/61 (11%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYP-----PAPPPAQGYPATGYPPA-AYPPP-GYPPS 292 GY PQP PAP P PYG P P PPP QG+ A GYPPA YPP GYPP+ Sbjct: 21 GY-PQPTQGYPPAPGGYPPANPYGGPPPSSGPPPPPGQGF-AGGYPPAGGYPPAGGYPPA 78 Query: 291 G 289 G Sbjct: 79 G 79 [122][TOP] >UniRef100_B5DPT7 GA23811 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DPT7_DROPS Length = 561 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPY-GYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 G++ P P G P + P G P GYPP PAQGYP GYPP YP PG+ G Sbjct: 12 GFSSAP-PAGYPPQEYPPQGYPQQGYPPQGYPAQGYPQQGYPPQGYPQPGFIQQG 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/56 (46%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = -2 Query: 447 YAPQPAPYGQ--PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 +A PA + PA P P GYP P QGYPA GYP YPP GYP G+ Sbjct: 6 FAAPPAGFSSAPPAGYPPQEYPPQGYPQQGYPPQGYPAQGYPQQGYPPQGYPQPGF 61 [123][TOP] >UniRef100_A2DBY2 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2DBY2_TRIVA Length = 383 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/62 (41%), Positives = 31/62 (50%), Gaps = 12/62 (19%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQG------------YPATGYPPAAYPPPGYPPS 292 PA + + P PAPY GYPP P QG YP GYPP +PP G+PP Sbjct: 134 PANWTRQQPAPAPYPPQGGYPPQGYPPQGGYPPQGYPPQGAYPPQGYPPQGFPPQGFPPQ 193 Query: 291 GY 286 G+ Sbjct: 194 GF 195 [124][TOP] >UniRef100_B6GYL8 Pc12g12340 protein n=1 Tax=Penicillium chrysogenum Wisconsin 54-1255 RepID=B6GYL8_PENCW Length = 467 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 13/65 (20%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYG----QPYGY--PPAPPP----AQGYPATGYPPA---AYPPPGY 301 PQ YG P Q PYG QP+GY PPA PP GY G PPA YP PG Sbjct: 75 PQQGQYGAPPAQGGPYGATPPQPHGYHAPPAQPPYGQQPHGYAPPGQPPAGGPGYPAPGQ 134 Query: 300 PPSGY 286 PP GY Sbjct: 135 PPVGY 139 Score = 55.1 bits (131), Expect = 2e-06 Identities = 34/67 (50%), Positives = 36/67 (53%), Gaps = 17/67 (25%) Frame = -2 Query: 438 QPAPYGQPAPQP---------APYG-QPYGY-PPAPPPA--QGYPATGYPPAAY--PPPG 304 Q PYG PQP PYG QP+GY PP PPA GYPA G PP Y PPPG Sbjct: 86 QGGPYGATPPQPHGYHAPPAQPPYGQQPHGYAPPGQPPAGGPGYPAPGQPPVGYGAPPPG 145 Query: 303 --YPPSG 289 +PP G Sbjct: 146 GAFPPQG 152 [125][TOP] >UniRef100_UPI00005A29FC PREDICTED: similar to glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 n=1 Tax=Canis lupus familiaris RepID=UPI00005A29FC Length = 492 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = -2 Query: 441 PQP-APYGQPAPQPAPYGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSGY 286 P P APY QP QP+PYGQP GYP P P GYP YP YP YP GY Sbjct: 167 PYPGAPYPQPPFQPSPYGQP-GYPQGPGSYPQGGYPQGPYPQDPYPQGPYPQGGY 220 [126][TOP] >UniRef100_UPI00004A576B glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 n=1 Tax=Canis lupus familiaris RepID=UPI00004A576B Length = 356 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = -2 Query: 441 PQP-APYGQPAPQPAPYGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSGY 286 P P APY QP QP+PYGQP GYP P P GYP YP YP YP GY Sbjct: 31 PYPGAPYPQPPFQPSPYGQP-GYPQGPGSYPQGGYPQGPYPQDPYPQGPYPQGGY 84 [127][TOP] >UniRef100_B1XZX1 Putative uncharacterized protein n=1 Tax=Leptothrix cholodnii SP-6 RepID=B1XZX1_LEPCP Length = 307 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/58 (53%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Frame = -2 Query: 447 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT----GYPPAAYPPPGYPPSGY 286 +AP AP PAP PA + QP PP PA YPA GYP AA PPPGY P GY Sbjct: 105 FAPAYAPRAMPAPPPAQW-QP---PPMAAPAPYYPAAQVPPGYPGAAMPPPGYAPPGY 158 [128][TOP] >UniRef100_Q9C4Z8 Putative uncharacterized protein F27M3_5 n=1 Tax=Arabidopsis thaliana RepID=Q9C4Z8_ARATH Length = 176 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/59 (55%), Positives = 33/59 (55%), Gaps = 5/59 (8%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP--AAYPPPGYP-PSG 289 GY P P P PQ A Y P GYPP PPP GYP YPP AYPP GYP PSG Sbjct: 23 GYPPGAYP---PPPQGA-YPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSG 77 [129][TOP] >UniRef100_Q8LEP5 Putative glycine and proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q8LEP5_ARATH Length = 176 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/59 (55%), Positives = 33/59 (55%), Gaps = 5/59 (8%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP--AAYPPPGYP-PSG 289 GY P P P PQ A Y P GYPP PPP GYP YPP AYPP GYP PSG Sbjct: 23 GYPPGAYP---PPPQGA-YPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSG 77 [130][TOP] >UniRef100_C6SWT5 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SWT5_SOYBN Length = 170 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -2 Query: 429 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPA-TGYPPAAYPPPGYPPSGYS 283 P G P P Y GYPPA P GYP GYPPA YPP GYP S ++ Sbjct: 35 PPGAYPPPPGAYPPQQGYPPAGYPPAGYPPHQGYPPAGYPPAGYPGSSHA 84 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 10/47 (21%) Frame = -2 Query: 396 YGQPYG-YPPAP---PPAQGYPATGYPPAAYPP------PGYPPSGY 286 +G P G YPP P PP QGYP GYPPA YPP GYPP+GY Sbjct: 32 HGYPPGAYPPPPGAYPPQQGYPPAGYPPAGYPPHQGYPPAGYPPAGY 78 [131][TOP] >UniRef100_B9I8M8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I8M8_POPTR Length = 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/50 (60%), Positives = 31/50 (62%) Frame = -2 Query: 429 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 280 P+ APQ A YGQPYGYPP PP Q GYPPA P YPP GYSR Sbjct: 39 PHAGYAPQQA-YGQPYGYPP-PPQTQ-----GYPPAYPQPHAYPPHGYSR 81 [132][TOP] >UniRef100_Q6QE87 Rhodopsin (Fragment) n=1 Tax=Idiosepius notoides RepID=Q6QE87_9MOLL Length = 316 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/60 (53%), Positives = 32/60 (53%), Gaps = 7/60 (11%) Frame = -2 Query: 447 YAPQPA--PYGQPAPQPAPYGQPYGYPPAP----PPAQGYPATGYPPAAYPPP-GYPPSG 289 Y PQ A P G PQ P P GYPP P PP GYP GYPP YPPP G PP G Sbjct: 247 YPPQGAYPPQGAYPPQGYP-PPPAGYPPPPAGYPPPQGGYPPQGYPPQGYPPPQGAPPQG 305 [133][TOP] >UniRef100_Q3BDP5 Rhodopsin (Fragment) n=1 Tax=Joubiniteuthis sp. JMS-2004 RepID=Q3BDP5_9MOLL Length = 283 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 289 QPA Y GYPP PPAQGYP GYPP YPP G PP G Sbjct: 230 QPAYPQQGYPPAQGYPPQGYPPAQGYPPQGYPPQGYPPQGAPPXG 274 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPA-AYPPPGYPPSGY 286 Q A QPA Q Y PPAQGYP GYPPA YPP GYPP GY Sbjct: 226 QQAQQPAYPQQGY------PPAQGYPPQGYPPAQGYPPQGYPPQGY 265 [134][TOP] >UniRef100_C4LYI3 Putative uncharacterized protein n=1 Tax=Entamoeba histolytica HM-1:IMSS RepID=C4LYI3_ENTHI Length = 477 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/67 (44%), Positives = 32/67 (47%), Gaps = 11/67 (16%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT--------GYPPA---AYPPP 307 +G+ P AP G P P P P GYPP P QGYP GYPP PP Sbjct: 403 LGFKPSAAPMGMP-PMQQPGMPPMGYPPMGMPPQGYPPMQQPGMPPMGYPPMQQPGMPPQ 461 Query: 306 GYPPSGY 286 GYPP GY Sbjct: 462 GYPPMGY 468 [135][TOP] >UniRef100_B4YS71 Rhodopsin (Fragment) n=1 Tax=Alloteuthis africana RepID=B4YS71_9MOLL Length = 303 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPA-AYPPPGYPP 295 Q QPA Y P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 243 QQQQQPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPPQGYPPQGYPP 287 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPP 295 P P G P PQ P P GYPP PP QGYP GYPP PPP PP Sbjct: 251 PPPQGYP-PQGYPPPPPQGYPPQGYPPPQGYPPQGYPPPQGPPPQGPP 297 [136][TOP] >UniRef100_A2FGL4 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2FGL4_TRIVA Length = 614 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 6/57 (10%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQP---YGYPPAPPPAQGYPATGY-PPAAYPPPGY--PPSGY 286 QP+PYG P P +PYG P YGY PPP G P GY P PPPGY PP GY Sbjct: 525 QPSPYGAP-PSQSPYGSPPPGYGY---PPPGYGSPPPGYGAPYGAPPPGYGAPPPGY 577 [137][TOP] >UniRef100_B0CS37 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CS37_LACBS Length = 335 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 G P P G P P P P P G PP P G P G PP PPPG PPSG Sbjct: 170 GSPPPGPPPGSPPPGPPPGSPPPGSPPPGSPPPGSPPPGSPPPGSPPPGSPPSG 223 [138][TOP] >UniRef100_UPI000155636D PREDICTED: hypothetical protein n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155636D Length = 179 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/71 (42%), Positives = 33/71 (46%), Gaps = 15/71 (21%) Frame = -2 Query: 447 YAPQP---APYGQPAPQPAPYGQPY------------GYPPAPPPAQGYPATGYPPAAYP 313 YA P APY QP QP PYGQP GYP P P YP GYP YP Sbjct: 32 YAQPPYPVAPYPQPTFQPGPYGQPGYPQGPPGPYPQGGYPQGPYPQGPYPQGGYPQGPYP 91 Query: 312 PPGYPPSGYSR 280 +PP+ Y + Sbjct: 92 QGPFPPNPYGQ 102 [139][TOP] >UniRef100_Q569D7 MGC107973 protein n=1 Tax=Xenopus (Silurana) tropicalis RepID=Q569D7_XENTR Length = 347 Score = 55.1 bits (131), Expect = 2e-06 Identities = 35/60 (58%), Positives = 35/60 (58%), Gaps = 5/60 (8%) Frame = -2 Query: 450 GYAPQPAPYGQPA--PQPAPYGQPYGYPPAPPPAQGYPATGYP-PAAYP-PPGYP-PSGY 286 GY PQP Y QP PQP Y QP GYP PP A G PA YP P YP P GYP P GY Sbjct: 27 GY-PQPGGYPQPGGYPQPGGYPQPGGYP--PPGAYGQPAGYYPQPGGYPAPSGYPQPGGY 83 [140][TOP] >UniRef100_C6T3K1 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T3K1_SOYBN Length = 183 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -2 Query: 411 PQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYP-PPGYPPSGY 286 P PY P+GYPP+ PP GYP T YPP AYP P YP SGY Sbjct: 24 PSAPPYPPPHGYPPSGYPPPGGYPPTAYPPPAYPPPGVYPHSGY 67 [141][TOP] >UniRef100_B3LVA1 GF18588 n=1 Tax=Drosophila ananassae RepID=B3LVA1_DROAN Length = 273 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/57 (49%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = -2 Query: 453 VGYAPQP-----APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP 298 +GY QP P G PA P P G P GYP PPP G P GYP PPPG P Sbjct: 48 LGYPAQPPPPPGVPLGYPAQPPPPPGVPLGYPAQPPPPPGVP-LGYPAQPPPPPGVP 103 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/57 (49%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = -2 Query: 453 VGYAPQP-----APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP 298 +GY QP P G PA P P G P GYP PPP G P GYP PPPG P Sbjct: 76 LGYPAQPPPPPGVPLGYPAQPPPPPGVPLGYPAQPPPPPGVP-LGYPAQPPPPPGVP 131 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/57 (49%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = -2 Query: 453 VGYAPQP-----APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP 298 +GY QP P G PA P P G P GYP PPP G P GYP PPPG P Sbjct: 104 LGYPAQPPPPPGVPLGYPAQPPPPPGVPLGYPAQPPPPPGVP-LGYPAQPPPPPGVP 159 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/57 (49%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = -2 Query: 453 VGYAPQP-----APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP 298 +GY QP P G PA P P G P GYP PPP G P GYP PPPG P Sbjct: 118 LGYPAQPPPPPGVPLGYPAQPPPPPGVPLGYPAQPPPPPGVPL-GYPAQPPPPPGVP 173 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/57 (49%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = -2 Query: 453 VGYAPQP-----APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP 298 +GY QP P G PA P P G P GYP PPP G P GYP PPPG P Sbjct: 20 LGYPVQPPPPPGVPLGYPAQPPPPPGVPLGYPAQPPPPPGVP-LGYPAQPPPPPGVP 75 [142][TOP] >UniRef100_Q0CY55 Putative uncharacterized protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CY55_ASPTN Length = 446 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/62 (46%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP--YGYPPAPPPAQGYPATGYPPAAYPPPG------YPP 295 GY P P PY QP P P P P GYPPA PP GY T P + P G YPP Sbjct: 34 GYGPPPGPYQQPPPGPYPPHSPPPLGYPPAGPPGPGYHQTPPPQPVHSPYGGPQQTQYPP 93 Query: 294 SG 289 G Sbjct: 94 HG 95 [143][TOP] >UniRef100_B6Q7Z7 Annexin ANXC3.2 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q7Z7_PENMQ Length = 446 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/63 (50%), Positives = 33/63 (52%), Gaps = 6/63 (9%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPP-AAYPPP---GYPP--SG 289 GY P P P P P GQ GYPP PPP PA GYPP AYPPP YPP G Sbjct: 30 GYYPPPQQGHYPPPGGPPPGQYGGYPPGPPP----PAQGYPPHGAYPPPQHGAYPPQHGG 85 Query: 288 YSR 280 Y + Sbjct: 86 YGQ 88 [144][TOP] >UniRef100_P31356 Rhodopsin n=1 Tax=Todarodes pacificus RepID=OPSD_TODPA Length = 448 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = -2 Query: 390 QPYGYPP---APPPAQGYPATGYPPAAYPPPGYPPSGY 286 Q YPP APPP QGYP GYPP YPP GYPP GY Sbjct: 384 QQAAYPPQGYAPPP-QGYPPQGYPPQGYPPQGYPPQGY 420 [145][TOP] >UniRef100_A0R2X6 Putative uncharacterized protein n=1 Tax=Mycobacterium smegmatis str. MC2 155 RepID=A0R2X6_MYCS2 Length = 377 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/55 (54%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPA--PYGQPYGYPPAPPPAQG-YPATGYPPAA-YPPPGYP 298 GY P P P G P P P P GYPP PPP G YP P AA YPPPGYP Sbjct: 52 GYPPPPPPGGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPPPGYP 106 [146][TOP] >UniRef100_B7FMM9 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FMM9_MEDTR Length = 91 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/51 (50%), Positives = 26/51 (50%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Q P G P PQ P YPP P QGYP GYPP YP GYP GY Sbjct: 8 QQPPVGVPPPQGYPPKD--AYPPPGYPQQGYPQQGYPPQGYPQQGYPQQGY 56 [147][TOP] >UniRef100_A9RUJ4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RUJ4_PHYPA Length = 273 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 9/62 (14%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPY------GQPYGYPPAPPPAQGYPA---TGYPPAAYPPPGYPPS 292 AP P PY +P PQP Y PY +P + P G PA GY AY PGYPPS Sbjct: 206 APPPVPYPRPQPQPVAYVATPPAQPPYYHPASAPVHPGAPAYHNPGYQNPAYQNPGYPPS 265 Query: 291 GY 286 GY Sbjct: 266 GY 267 [148][TOP] >UniRef100_B4YS88 Rhodopsin (Fragment) n=1 Tax=Alloteuthis media RepID=B4YS88_9MOLL Length = 309 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSGY 286 Q QPA Y P GYPP PPP QGYP GYPP P GYPP GY Sbjct: 243 QQQQQPA-YPPPQGYPPQGYPPPPQGYPPQGYPP----PQGYPPQGY 284 [149][TOP] >UniRef100_UPI000180C957 PREDICTED: hypothetical protein n=1 Tax=Ciona intestinalis RepID=UPI000180C957 Length = 132 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/64 (45%), Positives = 31/64 (48%), Gaps = 8/64 (12%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPA-----PYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGY---PP 295 GY P P Y + P P G P GY P PP GYP YPPA PP GY PP Sbjct: 35 GYPPAPGGYPANSAGPGGFTAPPQGPPIGYVPPPPGTSGYPQPNYPPAG-PPGGYNYPPP 93 Query: 294 SGYS 283 GY+ Sbjct: 94 HGYN 97 [150][TOP] >UniRef100_UPI00017F0BD6 PREDICTED: similar to cyclin K n=1 Tax=Sus scrofa RepID=UPI00017F0BD6 Length = 582 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 507 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 559 [151][TOP] >UniRef100_UPI00017C39ED PREDICTED: similar to cyclin K n=1 Tax=Bos taurus RepID=UPI00017C39ED Length = 582 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 507 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 559 [152][TOP] >UniRef100_UPI0000E23AD2 PREDICTED: similar to cyclin K n=1 Tax=Pan troglodytes RepID=UPI0000E23AD2 Length = 539 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 464 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 516 [153][TOP] >UniRef100_UPI0000D9BD9F PREDICTED: similar to cyclin K n=1 Tax=Macaca mulatta RepID=UPI0000D9BD9F Length = 364 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 289 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 341 [154][TOP] >UniRef100_UPI00005A198E PREDICTED: similar to cyclin K n=1 Tax=Canis lupus familiaris RepID=UPI00005A198E Length = 524 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 399 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 451 [155][TOP] >UniRef100_UPI0001B7AFE8 similar to cyclin K (LOC500715), mRNA n=1 Tax=Rattus norvegicus RepID=UPI0001B7AFE8 Length = 554 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 479 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 531 [156][TOP] >UniRef100_UPI0001B7AFE7 UPI0001B7AFE7 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7AFE7 Length = 582 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 507 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 559 [157][TOP] >UniRef100_UPI00001C4FB6 cyclin K n=1 Tax=Mus musculus RepID=UPI00001C4FB6 Length = 554 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 479 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 531 [158][TOP] >UniRef100_UPI000179D978 UPI000179D978 related cluster n=1 Tax=Bos taurus RepID=UPI000179D978 Length = 584 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 509 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 561 [159][TOP] >UniRef100_Q3U3M5 Putative uncharacterized protein n=1 Tax=Mus musculus RepID=Q3U3M5_MOUSE Length = 582 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 507 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 559 [160][TOP] >UniRef100_A1L1L5 Ccnk protein n=1 Tax=Rattus norvegicus RepID=A1L1L5_RAT Length = 589 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 514 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 566 [161][TOP] >UniRef100_Q9FCJ3 Putative uncharacterized protein SCO5195 n=1 Tax=Streptomyces coelicolor RepID=Q9FCJ3_STRCO Length = 584 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/61 (49%), Positives = 31/61 (50%), Gaps = 6/61 (9%) Frame = -2 Query: 444 APQPAPYGQPAP--QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGY----PPSGYS 283 AP PAPYGQP Q PYGQ G PPP G P P A PPPGY P GY Sbjct: 275 APAPAPYGQPGQPGQQPPYGQVLGQTAPPPPGYGQPQA--PQAPAPPPGYGQPTAPPGYG 332 Query: 282 R 280 + Sbjct: 333 Q 333 [162][TOP] >UniRef100_B2HNB7 Proline and glycine rich transmembrane protein n=1 Tax=Mycobacterium marinum M RepID=B2HNB7_MYCMM Length = 377 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 27/55 (49%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 G P P YG P P P YG P PP PPP G GY P Y PP PP GY Sbjct: 52 GAPPPPPGYGTPPPPPG-YGTP---PPPPPPGYGQAPGGYAPPGYNPPPPPPPGY 102 [163][TOP] >UniRef100_B1HT22 Putative uncharacterized protein n=1 Tax=Lysinibacillus sphaericus C3-41 RepID=B1HT22_LYSSC Length = 153 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/51 (52%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Frame = -2 Query: 432 APYGQ--PAPQPAPYGQPY---GYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 AP G P P P PY PY YPP P P Q YP YPP YPP YPP Sbjct: 64 APPGNSYPPPYPPPYPTPYPPQPYPPRPYPPQPYPPRPYPPRPYPPQPYPP 114 [164][TOP] >UniRef100_Q5SDR1 Putative membrane protein n=1 Tax=Mycobacterium marinum RepID=Q5SDR1_MYCMR Length = 377 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 27/55 (49%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 G P P YG P P P YG P PP PPP G GY P Y PP PP GY Sbjct: 52 GAPPPPPGYGTPPPPPG-YGTP---PPPPPPGYGQAPGGYAPPGYNPPPPPPPGY 102 [165][TOP] >UniRef100_B5FW37 Cyclin K isoform 1 (Predicted) n=1 Tax=Otolemur garnettii RepID=B5FW37_OTOGA Length = 587 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 512 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 564 [166][TOP] >UniRef100_C9JI13 Putative uncharacterized protein CCNK n=1 Tax=Homo sapiens RepID=C9JI13_HUMAN Length = 600 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 525 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 577 [167][TOP] >UniRef100_A8N3U3 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8N3U3_COPC7 Length = 554 Score = 54.3 bits (129), Expect = 4e-06 Identities = 34/59 (57%), Positives = 34/59 (57%), Gaps = 5/59 (8%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPA----AYPP-PGYPPSG 289 G APQP Y P P AP GQ YPP P QGYP GYPPA AYP PGYPP G Sbjct: 27 GAAPQPGQY--PPPGGAPPGQ---YPPPPGAPQGYP--GYPPAQGYPAYPAYPGYPPPG 78 [168][TOP] >UniRef100_O88874 Cyclin-K n=1 Tax=Mus musculus RepID=CCNK_MOUSE Length = 554 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 479 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 531 [169][TOP] >UniRef100_O75909-4 Isoform 4 of Cyclin-K n=1 Tax=Homo sapiens RepID=O75909-4 Length = 600 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 525 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 577 [170][TOP] >UniRef100_O75909 Cyclin-K n=1 Tax=Homo sapiens RepID=CCNK_HUMAN Length = 580 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/53 (47%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 GY P P Y P P P P + PP PPP G P YPP A PP G PP Sbjct: 505 GYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPP 557 [171][TOP] >UniRef100_UPI0001AEECC4 hypothetical protein SalbJ_08409 n=1 Tax=Streptomyces albus J1074 RepID=UPI0001AEECC4 Length = 326 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/52 (50%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQ--PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 QP PYG QP PYGQ P G PP P GYP G P P GYP G Sbjct: 5 QPGPYGGQPQQPGPYGQQPPQGPPPGGQPGYGYPQQGGAPQQQPGYGYPQQG 56 [172][TOP] >UniRef100_B1VXA9 Putative uncharacterized protein n=1 Tax=Streptomyces griseus subsp. griseus NBRC 13350 RepID=B1VXA9_STRGG Length = 337 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Frame = -2 Query: 438 QPAPYGQPAPQ--PAPYGQ---PYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 QP PYG PQ P PYGQ PYG PP P QG P GYP A P G PP Sbjct: 5 QPGPYGGQPPQGQPGPYGQQPGPYGAPPPQGPPQGQPGYGYPQQA--PQGVPP 55 [173][TOP] >UniRef100_B6T850 Adhesive/proline-rich protein n=1 Tax=Zea mays RepID=B6T850_MAIZE Length = 102 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/54 (51%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -2 Query: 444 APQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPP-PGYPPSGY 286 AP Y P P P GY PPPAQGYP GYPP YPP GYP GY Sbjct: 13 APPAXGYPGKDAYPPPGYPPAGY---PPPAQGYPPQGYPPQGYPPQQGYPQQGY 63 [174][TOP] >UniRef100_B4FEM0 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FEM0_MAIZE Length = 102 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/62 (48%), Positives = 30/62 (48%), Gaps = 11/62 (17%) Frame = -2 Query: 447 YAPQPAPYGQPAPQPAPYGQPY---GYPPA--PPPAQGYPATGYPPAAYP------PPGY 301 Y Q P P Q P Y GYPPA PPPAQGYP GYPP YP GY Sbjct: 4 YGQQQPPVSAPPAQGYPGKDAYPPPGYPPAGYPPPAQGYPPQGYPPQGYPPQQGYPQQGY 63 Query: 300 PP 295 PP Sbjct: 64 PP 65 [175][TOP] >UniRef100_A9PEZ2 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PEZ2_POPTR Length = 240 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/71 (40%), Positives = 33/71 (46%), Gaps = 20/71 (28%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQ-------PAPYGQPYGYP----------PAPPPAQGYPATGYPP- 325 GYAP YG P PQ P +G PYG P P+ PP+ YP + YPP Sbjct: 136 GYAPSAPQYGAPVPQVSYYSAPPPAHGAPYGQPSTAYTGSSPYPSYPPSSAYPPSAYPPP 195 Query: 324 --AAYPPPGYP 298 A YPP YP Sbjct: 196 PAATYPPAPYP 206 [176][TOP] >UniRef100_A9NLR5 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NLR5_PICSI Length = 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 375 PPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 P PP QGYP GYP AYPPPGYPP GY Sbjct: 10 PVGVPPPQGYPPEGYPKDAYPPPGYPPQGY 39 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/56 (51%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = -2 Query: 447 YAPQPAPYGQPAPQP-APYGQPY-GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Y Q P G P PQ P G P YPP P QGYP GYPP YP GYP GY Sbjct: 4 YNQQQPPVGVPPPQGYPPEGYPKDAYPPPGYPPQGYPQ-GYPPQGYPAQGYPQQGY 58 [177][TOP] >UniRef100_Q6LE68 Rhodopsin (Fragment) n=1 Tax=Sepia officinalis RepID=Q6LE68_SEPOF Length = 357 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/61 (57%), Positives = 35/61 (57%), Gaps = 8/61 (13%) Frame = -2 Query: 447 YAPQPA--PYGQPAPQ--PAPYGQPYGYPPA--PPPAQGY-PATGYPPAAYPPP-GYPPS 292 Y PQ A P G PQ P P Q GYPP PPP QGY PA GYPP YPPP G PP Sbjct: 280 YPPQGAYPPQGGYPPQGYPPPPAQG-GYPPQGYPPPPQGYPPAQGYPPQGYPPPQGAPPQ 338 Query: 291 G 289 G Sbjct: 339 G 339 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/56 (51%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAP---PPAQGYPATGY-PPAAYPPPGYPP 295 GY P PA G P P GYPP P PPAQGYP GY PP PP G PP Sbjct: 296 GYPPPPAQGGYP---------PQGYPPPPQGYPPAQGYPPQGYPPPQGAPPQGAPP 342 [178][TOP] >UniRef100_B9Q1I7 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9Q1I7_TOXGO Length = 314 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -2 Query: 447 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPG--YPPSG 289 Y QP P PA P G P Y PPP YP+ G PP YPPPG YPP G Sbjct: 171 YVTQPVPTTPPAAAAVPTGIPPAYQ-TPPPGPYYPSPGQPPQYYPPPGGSYPPPG 224 [179][TOP] >UniRef100_O16005 Rhodopsin n=1 Tax=Sepia officinalis RepID=OPSD_SEPOF Length = 464 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/61 (57%), Positives = 35/61 (57%), Gaps = 8/61 (13%) Frame = -2 Query: 447 YAPQPA--PYGQPAPQ--PAPYGQPYGYPPA--PPPAQGY-PATGYPPAAYPPP-GYPPS 292 Y PQ A P G PQ P P Q GYPP PPP QGY PA GYPP YPPP G PP Sbjct: 387 YPPQGAYPPQGGYPPQGYPPPPAQG-GYPPQGYPPPPQGYPPAQGYPPQGYPPPQGAPPQ 445 Query: 291 G 289 G Sbjct: 446 G 446 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/56 (51%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAP---PPAQGYPATGY-PPAAYPPPGYPP 295 GY P PA G P P GYPP P PPAQGYP GY PP PP G PP Sbjct: 403 GYPPPPAQGGYP---------PQGYPPPPQGYPPAQGYPPQGYPPPQGAPPQGAPP 449 [180][TOP] >UniRef100_P37705 Glycine-rich protein A3 n=1 Tax=Daucus carota RepID=GRP3_DAUCA Length = 195 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/59 (49%), Positives = 31/59 (52%), Gaps = 11/59 (18%) Frame = -2 Query: 429 PYGQPAPQPAPYGQPYGYPPA---------PPPAQGYPATGYPPA--AYPPPGYPPSGY 286 P GQ P Y P GYPPA PP GYP GYPPA YPP GYPP+G+ Sbjct: 29 PPGQYPPAAGGY-PPQGYPPAGGGYPPQGYPPAGGGYPPQGYPPAGGGYPPQGYPPAGH 86 [181][TOP] >UniRef100_UPI0001B4CAEE hypothetical protein SvirD4_13591 n=1 Tax=Streptomyces viridochromogenes DSM 40736 RepID=UPI0001B4CAEE Length = 315 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/57 (52%), Positives = 30/57 (52%), Gaps = 9/57 (15%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQ--PYGYPP-APPPAQGYPATGYPPA---AYP---PPGYPP 295 QP PYG QP PYGQ PYG PP AP P GYP PP YP P G PP Sbjct: 5 QPGPYGGQPQQPGPYGQPGPYGQPPQAPQPGYGYPQQAPPPQPGYGYPQQAPQGVPP 61 [182][TOP] >UniRef100_UPI000180C95F PREDICTED: similar to LOC398095 protein n=1 Tax=Ciona intestinalis RepID=UPI000180C95F Length = 917 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/58 (53%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPP-PGYP--PSGY 286 GYAP P PA P P PYGYPP P GY GY AYPP PGYP P GY Sbjct: 841 GYAPFPGYGAPPAAAPYPQQPPYGYPPQP----GYAPQGY--GAYPPQPGYPTQPGGY 892 [183][TOP] >UniRef100_B2HKA7 Conserved membrane protein n=1 Tax=Mycobacterium marinum M RepID=B2HKA7_MYCMM Length = 420 Score = 53.5 bits (127), Expect = 7e-06 Identities = 34/59 (57%), Positives = 34/59 (57%), Gaps = 4/59 (6%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGY-PPAAY--PPPGY-PPSGY 286 GYA P YG P PA YG P GY APPP G P GY PP Y PPPGY PP GY Sbjct: 29 GYADPPPAYGPP---PA-YGPPPGYG-APPPGYGPPPPGYGPPPGYGPPPPGYGPPPGY 82 [184][TOP] >UniRef100_B1W1L2 Putative uncharacterized protein n=1 Tax=Streptomyces griseus subsp. griseus NBRC 13350 RepID=B1W1L2_STRGG Length = 439 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/58 (48%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP----YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 GY P AP GQ P P +G P +G PP PP QG P G PP PP G PP G Sbjct: 375 GYPPPQAPPGQQPPAPG-FGPPRDGGFGPPPQGPPPQGPPPQGPPPQGPPPQGPPPQG 431 [185][TOP] >UniRef100_B4YS96 Rhodopsin (Fragment) n=1 Tax=Alloteuthis subulata RepID=B4YS96_LOLSU Length = 299 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -2 Query: 420 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPA-AYPPPGYPP 295 QPA P P GYPP PP QGYP GYPP YPP GYPP Sbjct: 247 QPAYPPQQGYPPQGYPPPPP--QGYPPQGYPPPQGYPPQGYPP 287 [186][TOP] >UniRef100_B4LEQ7 GJ11716 n=1 Tax=Drosophila virilis RepID=B4LEQ7_DROVI Length = 562 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/53 (49%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPP-AAYPPPGYPPSGY 286 P P YG + AP G YPP P GYP GYPP +YP PGYPP Y Sbjct: 8 PDPPSYGFTS---APPGGSQNYPPQGYPQHGYPPQGYPPQTSYPQPGYPPQNY 57 [187][TOP] >UniRef100_A2EEE7 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2EEE7_TRIVA Length = 156 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/57 (47%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -2 Query: 447 YAPQPAPYGQPAPQPAPYGQPY---GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 286 Y PQ Y QP PQ Q Y YPP P P Q YP YP YPP YP GY Sbjct: 66 YPPQQY-YQQPYPQQPAQSQQYPPQSYPPQPYPPQNYPPQNYPQQEYPPQNYPQQGY 121 [188][TOP] >UniRef100_A0E2M3 Chromosome undetermined scaffold_75, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0E2M3_PARTE Length = 288 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/72 (45%), Positives = 34/72 (47%), Gaps = 13/72 (18%) Frame = -2 Query: 450 GYAPQPA----PYGQPAPQPAPYGQPYGYPPA----PPPAQGYPATGYPP-AAYPP---- 310 GY PQP G P QP Q GYPP PP GYPA YPP YPP Sbjct: 217 GYPPQPGYPPQQPGYPPQQPGYPPQQPGYPPQQPGYPPQQPGYPAQQYPPQQGYPPQPGY 276 Query: 309 PGYPPSGYSR*F 274 PGYP GY + F Sbjct: 277 PGYPQQGYQKPF 288 [189][TOP] >UniRef100_A0DJL3 Chromosome undetermined scaffold_53, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0DJL3_PARTE Length = 294 Score = 53.5 bits (127), Expect = 7e-06 Identities = 35/64 (54%), Positives = 36/64 (56%), Gaps = 12/64 (18%) Frame = -2 Query: 450 GYAPQPA--PYGQPA-----PQPAPYGQPYGYPPAP--PPAQGYPAT-GYPPA-AYPP-P 307 G+ PQP P G P PQP QP GYPP P PP QGYP GYPP YPP P Sbjct: 154 GHPPQPGYPPQGHPPQPGYPPQPGYPPQP-GYPPQPGYPPQQGYPPQPGYPPQPGYPPQP 212 Query: 306 GYPP 295 GYPP Sbjct: 213 GYPP 216 [190][TOP] >UniRef100_B0CVI1 Metacaspase n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CVI1_LACBS Length = 514 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/57 (50%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAY-PPPGYPPSGY 286 GYAP AP G P P G P GY P P P GY PP+ Y PPG PPSGY Sbjct: 36 GYAPSYAPPGGHPPNSGPPGPPPSGYGPPPGPPSGYGPPPGPPSGYGAPPGPPPSGY 92 [191][TOP] >UniRef100_Q3UMQ8 H/ACA ribonucleoprotein complex non-core subunit NAF1 n=2 Tax=Mus musculus RepID=NAF1_MOUSE Length = 489 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/51 (50%), Positives = 28/51 (54%) Frame = -2 Query: 441 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 289 P PAP G+P P PAP P G PP PPPA + A G PP P PP G Sbjct: 42 PPPAPSGRPPPPPAPSSDPGGRPP-PPPAPNWDAGGRPPPPPAPNSDPPPG 91 [192][TOP] >UniRef100_UPI0001B4D282 secreted protein n=1 Tax=Streptomyces viridochromogenes DSM 40736 RepID=UPI0001B4D282 Length = 591 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/65 (47%), Positives = 31/65 (47%), Gaps = 11/65 (16%) Frame = -2 Query: 450 GYAPQPAPYGQPA----------PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYP-PPG 304 GY QP PY QP PQP PYGQP P P GY GYPP YP PG Sbjct: 54 GYPQQPGPYAQPQQPQQPGPYGPPQPGPYGQP--QQPGPYAQPGY---GYPPPQYPGAPG 108 Query: 303 YPPSG 289 PP G Sbjct: 109 TPPPG 113 [193][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/52 (53%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -2 Query: 447 YAPQPAP-YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 YAP P P YG PAP P P P PP PPPA P PP AY PP PP Sbjct: 318 YAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPP---PPPAYAPPPPPP 366 [194][TOP] >UniRef100_B2HS38 Proline and glycine rich transmembrane protein n=1 Tax=Mycobacterium marinum M RepID=B2HS38_MYCMM Length = 222 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/74 (40%), Positives = 32/74 (43%), Gaps = 21/74 (28%) Frame = -2 Query: 444 APQPAPYGQPAPQP--APYGQPYGYPPAPPPAQGYPATGYPPAAY--------------- 316 A P P QP+ QP P P+ P A PA YPA YPP AY Sbjct: 16 AASPPPGEQPSEQPFSPPPDAPWAAPEAASPADDYPAPSYPPPAYPPEPVGPGGYPPDYA 75 Query: 315 ----PPPGYPPSGY 286 PPPGYPP GY Sbjct: 76 TGYPPPPGYPPPGY 89 [195][TOP] >UniRef100_Q3E939 Uncharacterized protein At5g26080.1 n=1 Tax=Arabidopsis thaliana RepID=Q3E939_ARATH Length = 141 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/61 (44%), Positives = 30/61 (49%), Gaps = 6/61 (9%) Frame = -2 Query: 447 YAPQPAPYGQPA---PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAY---PPPGYPPSGY 286 Y+P P PY P P P Y +P +PP PP P YPP Y PPP YPP Y Sbjct: 40 YSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIY 99 Query: 285 S 283 S Sbjct: 100 S 100 [196][TOP] >UniRef100_C4J6Q7 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4J6Q7_MAIZE Length = 112 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/61 (50%), Positives = 32/61 (52%), Gaps = 6/61 (9%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYG-YPPAP---PPAQGYPATG-YPP-AAYPPPGYPPSG 289 GY PQP Y P P Y P G YPP P PP GYP G YPP YPP GYP S Sbjct: 38 GYPPQPGAY---PPPPGAYPPPPGAYPPPPGAYPPQYGYPQPGGYPPQGGYPPAGYPGSS 94 Query: 288 Y 286 + Sbjct: 95 H 95 [197][TOP] >UniRef100_B6UG93 Glycine-rich protein A3 n=1 Tax=Zea mays RepID=B6UG93_MAIZE Length = 173 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/61 (50%), Positives = 32/61 (52%), Gaps = 6/61 (9%) Frame = -2 Query: 450 GYAPQPAPYGQPAPQPAPYGQPYG-YPPAP---PPAQGYPAT-GYPP-AAYPPPGYPPSG 289 GY PQ P PQP Y P G YPP P PP GYP GYPP YPP GYP S Sbjct: 28 GYPPQGYPPQGYPPQPGAYPPPPGAYPPPPGAYPPQYGYPQPGGYPPQGGYPPAGYPGSS 87 Query: 288 Y 286 + Sbjct: 88 H 88 [198][TOP] >UniRef100_B3IYJ5 SRC2 homolog (Fragment) n=4 Tax=Capsicum RepID=B3IYJ5_CAPCH Length = 262 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/53 (45%), Positives = 26/53 (49%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 + Y Q + Y P PQ G P GYPPA P P GYPP P GYPP Sbjct: 158 MAYNQQNSGYAYPPPQAHQGGYPAGYPPAGAPGYAQPGYGYPPVQQPGYGYPP 210 [199][TOP] >UniRef100_B1Q483 C2 domain-containing protein n=1 Tax=Capsicum chinense RepID=B1Q483_CAPCH Length = 250 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/58 (46%), Positives = 29/58 (50%), Gaps = 8/58 (13%) Frame = -2 Query: 435 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYP-------PAAYPPP-GYPPSGY 286 P P+ P A Y P YP PP + YP T YP P AYPPP GYPPS Y Sbjct: 159 PPPHVASCPPAATYQTPSPYPAYPPHSAAYPPTSYPPPQPTAYPPAYPPPSGYPPSSY 216 [200][TOP] >UniRef100_A4K8J5 SRC2-like protein n=1 Tax=Capsicum annuum RepID=A4K8J5_CAPAN Length = 276 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/53 (45%), Positives = 26/53 (49%) Frame = -2 Query: 453 VGYAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 295 + Y Q + Y P PQ G P GYPPA P P GYPP P GYPP Sbjct: 165 MAYNQQNSGYAYPPPQAHQGGYPAGYPPAGAPGYAQPGYGYPPVQQPGYGYPP 217 [201][TOP] >UniRef100_A2FA50 Proline-rich protein MP-2-related protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2FA50_TRIVA Length = 128 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/65 (47%), Positives = 32/65 (49%), Gaps = 12/65 (18%) Frame = -2 Query: 438 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGY----------PATGYPPAAY--PPPGYPP 295 QP PYG P P P P Q YG P PPP QGY YPP AY PPP PP Sbjct: 6 QPPPYGYP-PYPYPQPQAYGQQPPPPP-QGYGQQPPQNHYGAPPAYPPPAYGQPPPPPPP 63 Query: 294 SGYSR 280 GY + Sbjct: 64 QGYGQ 68