[UP]
[1][TOP] >UniRef100_B2ZUU1 Beta-glucosidase D2 n=1 Tax=Lotus japonicus RepID=B2ZUU1_LOTJA Length = 514 Score = 102 bits (254), Expect = 1e-20 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWF NFLKRY Sbjct: 469 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFTNFLKRY 514 [2][TOP] >UniRef100_B2ZUU0 Beta-glucosidase D4 n=1 Tax=Lotus japonicus RepID=B2ZUU0_LOTJA Length = 514 Score = 100 bits (250), Expect = 4e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSLLDNYEWSSGYTVRFGMNFVDY+NGLKRYKKLSAKWF NFLKRY Sbjct: 469 WSLLDNYEWSSGYTVRFGMNFVDYENGLKRYKKLSAKWFTNFLKRY 514 [3][TOP] >UniRef100_B2ZUU2 Beta-glucosidase D7 (Fragment) n=1 Tax=Lotus japonicus RepID=B2ZUU2_LOTJA Length = 516 Score = 91.3 bits (225), Expect = 3e-17 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSLLDN+EW+SGYT+RFG+NF DYKNG KRY+KLSAKWF NFLKRY Sbjct: 471 WSLLDNFEWASGYTLRFGINFADYKNGSKRYQKLSAKWFKNFLKRY 516 [4][TOP] >UniRef100_B9RI70 Beta-glucosidase, putative n=1 Tax=Ricinus communis RepID=B9RI70_RICCO Length = 500 Score = 87.4 bits (215), Expect = 4e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWSSGYTVRFG+N+VDYKNG+KRY KLSA+WF FLK+ Sbjct: 456 WSLLDNFEWSSGYTVRFGINYVDYKNGMKRYPKLSARWFKKFLKK 500 [5][TOP] >UniRef100_A7NZY0 Chromosome chr6 scaffold_3, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7NZY0_VITVI Length = 497 Score = 87.4 bits (215), Expect = 4e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+SGYTVRFG+NFVDYK+GLKRY KLSA WF NFLK+ Sbjct: 453 WSLLDNFEWNSGYTVRFGINFVDYKDGLKRYPKLSATWFKNFLKK 497 [6][TOP] >UniRef100_A7NZX5 Chromosome chr6 scaffold_3, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7NZX5_VITVI Length = 512 Score = 87.4 bits (215), Expect = 4e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+SGYTVRFG+NFVDYK+GLKRY KLSA WF NFLK+ Sbjct: 468 WSLLDNFEWNSGYTVRFGINFVDYKDGLKRYPKLSATWFKNFLKK 512 [7][TOP] >UniRef100_A5ACU0 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5ACU0_VITVI Length = 464 Score = 87.4 bits (215), Expect = 4e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+SGYTVRFG+NFVDYK+GLKRY KLSA WF NFLK+ Sbjct: 420 WSLLDNFEWNSGYTVRFGINFVDYKDGLKRYPKLSATWFKNFLKK 464 [8][TOP] >UniRef100_UPI00019836F1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019836F1 Length = 509 Score = 85.1 bits (209), Expect = 2e-15 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWSSGYTVRFG+NFVDYK+GL+R+ KLSA WF NFLK+ Sbjct: 465 WSLLDNFEWSSGYTVRFGINFVDYKDGLRRHPKLSALWFKNFLKK 509 [9][TOP] >UniRef100_Q0GA85 Glycoside hydrolase family 1 protein (Fragment) n=1 Tax=Leucaena leucocephala RepID=Q0GA85_LEUGL Length = 394 Score = 85.1 bits (209), Expect = 2e-15 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSLLDN+EW+SGYTVRFG+NFVDYK+G +RY KLSA+WF NFL++Y Sbjct: 349 WSLLDNFEWASGYTVRFGINFVDYKHGNQRYHKLSAQWFRNFLQKY 394 [10][TOP] >UniRef100_B9RI71 Beta-glucosidase, putative n=1 Tax=Ricinus communis RepID=B9RI71_RICCO Length = 515 Score = 85.1 bits (209), Expect = 2e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW+SG+TVRFG+NFVDYKNGLKRY KLSA WF NFL Sbjct: 467 WSLLDNFEWNSGFTVRFGINFVDYKNGLKRYPKLSAHWFKNFL 509 [11][TOP] >UniRef100_B0LJR5 Coniferrin beta glucosidase n=1 Tax=Leucaena leucocephala RepID=B0LJR5_LEUGL Length = 410 Score = 85.1 bits (209), Expect = 2e-15 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSLLDN+EW+SGYTVRFG+NFVDYK+G +RY KLSA+WF NFL++Y Sbjct: 365 WSLLDNFEWASGYTVRFGINFVDYKHGNQRYHKLSAQWFRNFLQKY 410 [12][TOP] >UniRef100_A9Z0X2 Glycosylhydrolase 1 n=1 Tax=Leucaena leucocephala RepID=A9Z0X2_LEUGL Length = 507 Score = 85.1 bits (209), Expect = 2e-15 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSLLDN+EW+SGYTVRFG+NFVDYK+G +RY KLSA+WF NFL++Y Sbjct: 462 WSLLDNFEWASGYTVRFGINFVDYKHGNQRYHKLSAQWFRNFLQKY 507 [13][TOP] >UniRef100_A7NZX7 Chromosome chr6 scaffold_3, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7NZX7_VITVI Length = 510 Score = 85.1 bits (209), Expect = 2e-15 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWSSGYTVRFG+NFVDYK+GL+R+ KLSA WF NFLK+ Sbjct: 466 WSLLDNFEWSSGYTVRFGINFVDYKDGLRRHPKLSALWFKNFLKK 510 [14][TOP] >UniRef100_Q43014 Beta-glucosidase (Fragment) n=1 Tax=Prunus avium RepID=Q43014_PRUAV Length = 531 Score = 83.6 bits (205), Expect = 6e-15 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+N+VDY NGLKR+ KLS WF NFLKR Sbjct: 462 WSLLDNFEWSEGYTVRFGINYVDYDNGLKRHSKLSTHWFKNFLKR 506 [15][TOP] >UniRef100_B7FLM5 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FLM5_MEDTR Length = 520 Score = 82.4 bits (202), Expect = 1e-14 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW GYTVRFGM FVDYKNGLKRY+KLS WF NFL Sbjct: 466 WSLLDNFEWHKGYTVRFGMTFVDYKNGLKRYQKLSGLWFKNFL 508 [16][TOP] >UniRef100_A8TVQ5 Beta-glucosidase G2 n=1 Tax=Medicago truncatula RepID=A8TVQ5_MEDTR Length = 520 Score = 82.4 bits (202), Expect = 1e-14 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW GYTVRFGM FVDYKNGLKRY+KLS WF NFL Sbjct: 466 WSLLDNFEWHKGYTVRFGMTFVDYKNGLKRYQKLSGLWFKNFL 508 [17][TOP] >UniRef100_Q7F9K4 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7F9K4_ORYSJ Length = 533 Score = 80.9 bits (198), Expect = 4e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+NFVDY NG+KRY K SA+WF FL++ Sbjct: 489 WSLLDNFEWSEGYTVRFGINFVDYDNGMKRYPKNSARWFKKFLRK 533 [18][TOP] >UniRef100_Q01KB4 OSIGBa0135C13.5 protein n=1 Tax=Oryza sativa RepID=Q01KB4_ORYSA Length = 533 Score = 80.9 bits (198), Expect = 4e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+NFVDY NG+KRY K SA+WF FL++ Sbjct: 489 WSLLDNFEWSEGYTVRFGINFVDYDNGMKRYPKNSARWFKKFLRK 533 [19][TOP] >UniRef100_B8AVE8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AVE8_ORYSI Length = 533 Score = 80.9 bits (198), Expect = 4e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+NFVDY NG+KRY K SA+WF FL++ Sbjct: 489 WSLLDNFEWSEGYTVRFGINFVDYDNGMKRYPKNSARWFKKFLRK 533 [20][TOP] >UniRef100_A7NZX3 Chromosome chr6 scaffold_3, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7NZX3_VITVI Length = 512 Score = 80.5 bits (197), Expect = 5e-14 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+SGYTVRFG+NFVDYK+ L+R+ KLSA WF NFLK+ Sbjct: 468 WSLLDNFEWNSGYTVRFGINFVDYKDRLRRHPKLSAFWFKNFLKK 512 [21][TOP] >UniRef100_A7QRD6 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QRD6_VITVI Length = 508 Score = 80.1 bits (196), Expect = 7e-14 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW SGYTVRFG ++DYK+GLKRY K SAKWF NFLK Sbjct: 463 WSLLDNFEWISGYTVRFGSYYIDYKDGLKRYPKSSAKWFKNFLK 506 [22][TOP] >UniRef100_A5C5R0 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5C5R0_VITVI Length = 52 Score = 80.1 bits (196), Expect = 7e-14 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW SGYTVRFG ++DYK+GLKRY K SAKWF NFLK Sbjct: 7 WSLLDNFEWISGYTVRFGSYYIDYKDGLKRYPKSSAKWFKNFLK 50 [23][TOP] >UniRef100_Q9M5X5 Prunasin hydrolase isoform PHA n=1 Tax=Prunus serotina RepID=Q9M5X5_PRUSE Length = 537 Score = 79.7 bits (195), Expect = 9e-14 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WS+LDN+EW+SGYTVRFG+N+VDY NGLKR K SA W NFLK Y Sbjct: 468 WSVLDNFEWNSGYTVRFGINYVDYDNGLKRRSKFSAHWLKNFLKNY 513 [24][TOP] >UniRef100_Q9M5X4 Putative prunasin hydrolase isoform PH-L1 n=1 Tax=Prunus serotina RepID=Q9M5X4_PRUSE Length = 544 Score = 79.7 bits (195), Expect = 9e-14 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EWS GYTVRFG+N+VDY NGLKR+ KLS WF +FLK Sbjct: 475 WSLLDNFEWSEGYTVRFGINYVDYDNGLKRHSKLSTHWFKSFLK 518 [25][TOP] >UniRef100_Q945I4 Prunasin hydrolase isoform PH C (Fragment) n=1 Tax=Prunus serotina RepID=Q945I4_PRUSE Length = 517 Score = 79.7 bits (195), Expect = 9e-14 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+N++DY NGL+R+ KLS WF +FLKR Sbjct: 448 WSLLDNFEWSEGYTVRFGINYIDYDNGLERHSKLSTHWFKSFLKR 492 [26][TOP] >UniRef100_Q945I3 Prunasin hydrolase isoform PH A (Fragment) n=1 Tax=Prunus serotina RepID=Q945I3_PRUSE Length = 511 Score = 79.7 bits (195), Expect = 9e-14 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WS+LDN+EW+SGYTVRFG+N+VDY NGLKR K SA W NFLK Y Sbjct: 442 WSVLDNFEWNSGYTVRFGINYVDYDNGLKRRSKFSAHWLKNFLKNY 487 [27][TOP] >UniRef100_Q945G6 Putative prunasin hydrolase (Fragment) n=1 Tax=Prunus serotina RepID=Q945G6_PRUSE Length = 516 Score = 79.7 bits (195), Expect = 9e-14 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EWS GYTVRFG+N+VDY NGLKR+ KLS WF +FLK Sbjct: 447 WSLLDNFEWSEGYTVRFGINYVDYDNGLKRHSKLSTHWFKSFLK 490 [28][TOP] >UniRef100_Q945G5 Prunasin hydrolase isoform PH I (Fragment) n=1 Tax=Prunus serotina RepID=Q945G5_PRUSE Length = 513 Score = 79.7 bits (195), Expect = 9e-14 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+N++DY NGL+R+ KLS WF +FLKR Sbjct: 444 WSLLDNFEWSEGYTVRFGINYIDYDNGLERHSKLSTHWFKSFLKR 488 [29][TOP] >UniRef100_Q8W594 Prunasin hydrolase isoform PH C n=1 Tax=Prunus serotina RepID=Q8W594_PRUSE Length = 542 Score = 79.7 bits (195), Expect = 9e-14 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+N++DY NGL+R+ KLS WF +FLKR Sbjct: 473 WSLLDNFEWSEGYTVRFGINYIDYDNGLERHSKLSTHWFKSFLKR 517 [30][TOP] >UniRef100_Q43073 Prunasin hydrolase isoform PH I n=1 Tax=Prunus serotina RepID=Q43073_PRUSE Length = 549 Score = 79.7 bits (195), Expect = 9e-14 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+N++DY NGL+R+ KLS WF +FLKR Sbjct: 480 WSLLDNFEWSEGYTVRFGINYIDYDNGLERHSKLSTHWFKSFLKR 524 [31][TOP] >UniRef100_Q7XKV2 Os04g0474900 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XKV2_ORYSJ Length = 506 Score = 79.0 bits (193), Expect = 2e-13 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS+GYTVRFG+NFVDY +G KRY K+SA WF FL++ Sbjct: 462 WSLLDNFEWSNGYTVRFGINFVDYNDGAKRYPKMSAHWFKEFLQK 506 [32][TOP] >UniRef100_C5YAD8 Putative uncharacterized protein Sb06g019860 n=1 Tax=Sorghum bicolor RepID=C5YAD8_SORBI Length = 485 Score = 78.6 bits (192), Expect = 2e-13 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW++GYTVRFG+NFV+Y +GLKRY K SA WF FLK+ Sbjct: 441 WSLLDNFEWANGYTVRFGINFVEYNDGLKRYPKSSAHWFTEFLKK 485 [33][TOP] >UniRef100_C5YAD7 Putative uncharacterized protein Sb06g019850 n=1 Tax=Sorghum bicolor RepID=C5YAD7_SORBI Length = 517 Score = 78.2 bits (191), Expect = 3e-13 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+SGYTVRFG+ FVDY +GLKRY K SA WF FLK+ Sbjct: 473 WSLLDNFEWASGYTVRFGIYFVDYNDGLKRYPKSSAHWFTEFLKK 517 [34][TOP] >UniRef100_A7QWY7 Chromosome chr13 scaffold_210, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QWY7_VITVI Length = 374 Score = 77.8 bits (190), Expect = 3e-13 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDNYEW+SGYTVRFG+ FVDY +GLKRY K SA+WF FL++ Sbjct: 330 WSLLDNYEWNSGYTVRFGIVFVDYDHGLKRYPKHSARWFKKFLQK 374 [35][TOP] >UniRef100_UPI00001B1B2F Os04g0474600 n=1 Tax=Oryza sativa Japonica Group RepID=UPI00001B1B2F Length = 424 Score = 77.4 bits (189), Expect = 5e-13 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+ GYTVRFG+NFVDY +G+KRY K SA+WF FL++ Sbjct: 361 WSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSARWFKKFLQK 405 [36][TOP] >UniRef100_Q9FSY8 Beta-glucosidase (Fragment) n=1 Tax=Cicer arietinum RepID=Q9FSY8_CICAR Length = 439 Score = 77.4 bits (189), Expect = 5e-13 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN+EW GY RFG+N++DYK+GLKRY K+SA+W+ NFLKR Sbjct: 394 WSLFDNFEWGGGYQHRFGLNYIDYKDGLKRYPKVSAQWYQNFLKR 438 [37][TOP] >UniRef100_Q7XKV5 OSJNBa0022H21.2 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XKV5_ORYSJ Length = 529 Score = 77.4 bits (189), Expect = 5e-13 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+ GYTVRFG+NFVDY +G+KRY K SA+WF FL++ Sbjct: 466 WSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSARWFKKFLQK 510 [38][TOP] >UniRef100_Q01KB3 OSIGBa0135C13.6 protein n=1 Tax=Oryza sativa RepID=Q01KB3_ORYSA Length = 529 Score = 77.4 bits (189), Expect = 5e-13 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+ GYTVRFG+NFVDY +G+KRY K SA+WF FL++ Sbjct: 466 WSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSARWFKKFLQK 510 [39][TOP] >UniRef100_Q01IX2 OSIGBa0106G07.1 protein n=1 Tax=Oryza sativa RepID=Q01IX2_ORYSA Length = 506 Score = 77.4 bits (189), Expect = 5e-13 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS+GYTVRFG+NFVDY +G KRY K SA WF FL++ Sbjct: 462 WSLLDNFEWSNGYTVRFGINFVDYNDGAKRYPKKSAHWFKEFLQK 506 [40][TOP] >UniRef100_B9GMA6 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GMA6_POPTR Length = 513 Score = 77.4 bits (189), Expect = 5e-13 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW+SGYTVRFG+ ++DYKNGLKR KLSA+WF NFL++ Sbjct: 466 WSFLDDFEWNSGYTVRFGIIYIDYKNGLKRIPKLSARWFKNFLEK 510 [41][TOP] >UniRef100_B9FMC4 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FMC4_ORYSJ Length = 442 Score = 77.4 bits (189), Expect = 5e-13 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+ GYTVRFG+NFVDY +G+KRY K SA+WF FL++ Sbjct: 379 WSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSARWFKKFLQK 423 [42][TOP] >UniRef100_B8AVF1 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AVF1_ORYSI Length = 527 Score = 77.4 bits (189), Expect = 5e-13 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS+GYTVRFG+NFVDY +G KRY K SA WF FL++ Sbjct: 483 WSLLDNFEWSNGYTVRFGINFVDYNDGAKRYPKKSAHWFKEFLQK 527 [43][TOP] >UniRef100_A2XUK4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XUK4_ORYSI Length = 374 Score = 77.4 bits (189), Expect = 5e-13 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+ GYTVRFG+NFVDY +G+KRY K SA+WF FL++ Sbjct: 311 WSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSARWFKKFLQK 355 [44][TOP] >UniRef100_UPI0001984A0D PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984A0D Length = 505 Score = 77.0 bits (188), Expect = 6e-13 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDNYEW+ GYT+RFG+ F+DY NGLKRY K SA WF FLK+ Sbjct: 461 WSLLDNYEWNFGYTLRFGIIFIDYDNGLKRYPKYSAMWFKKFLKK 505 [45][TOP] >UniRef100_B1B611 Beta-glucosidase n=1 Tax=Rosa hybrid cultivar RepID=B1B611_ROSHC Length = 532 Score = 77.0 bits (188), Expect = 6e-13 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSL DN+EW+ GY+VRFG+N+VDY +GLKRY KLSA WF NFL+ Sbjct: 488 WSLFDNFEWNMGYSVRFGINYVDYNDGLKRYPKLSAHWFKNFLE 531 [46][TOP] >UniRef100_A7QRF8 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QRF8_VITVI Length = 511 Score = 77.0 bits (188), Expect = 6e-13 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDNYEW+ GYT+RFG+ F+DY NGLKRY K SA WF FLK+ Sbjct: 467 WSLLDNYEWNFGYTLRFGIIFIDYDNGLKRYPKYSAMWFKKFLKK 511 [47][TOP] >UniRef100_Q945G7 Amygdalin hydrolase isoform AH I (Fragment) n=1 Tax=Prunus serotina RepID=Q945G7_PRUSE Length = 528 Score = 76.6 bits (187), Expect = 8e-13 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WS LDN+EW +GYTVRFG+N+VDY + LKR+ KLS WF +FLK+Y Sbjct: 447 WSFLDNFEWDAGYTVRFGINYVDYNDNLKRHSKLSTYWFTSFLKKY 492 [48][TOP] >UniRef100_Q40984 Amygdalin hydrolase isoform AH I n=1 Tax=Prunus serotina RepID=Q40984_PRUSE Length = 553 Score = 76.6 bits (187), Expect = 8e-13 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WS LDN+EW +GYTVRFG+N+VDY + LKR+ KLS WF +FLK+Y Sbjct: 472 WSFLDNFEWDAGYTVRFGINYVDYNDNLKRHSKLSTYWFTSFLKKY 517 [49][TOP] >UniRef100_UPI0001984A0A PREDICTED: hypothetical protein isoform 1 n=2 Tax=Vitis vinifera RepID=UPI0001984A0A Length = 505 Score = 76.3 bits (186), Expect = 1e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDNYEWS GYTVRFG+ FVDY+NGLKRY K SA WF FL Sbjct: 462 WSLLDNYEWSFGYTVRFGIFFVDYENGLKRYPKHSAIWFKKFL 504 [50][TOP] >UniRef100_A7QRF2 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QRF2_VITVI Length = 500 Score = 76.3 bits (186), Expect = 1e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDNYEWS GYTVRFG+ FVDY+NGLKRY K SA WF FL Sbjct: 457 WSLLDNYEWSFGYTVRFGIFFVDYENGLKRYPKHSAIWFKKFL 499 [51][TOP] >UniRef100_B9REG9 Beta-glucosidase, putative n=1 Tax=Ricinus communis RepID=B9REG9_RICCO Length = 508 Score = 75.9 bits (185), Expect = 1e-12 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW++ YT+R+G+N VDYKNGLKRY K SA WF NFL++ Sbjct: 464 WSLLDNFEWAAAYTMRYGINVVDYKNGLKRYPKKSAIWFNNFLQK 508 [52][TOP] >UniRef100_B9NCD2 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9NCD2_POPTR Length = 389 Score = 75.9 bits (185), Expect = 1e-12 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW SGY VRFG+ +VDYKN LKRY K S KWF FL+R Sbjct: 343 WSLMDNFEWGSGYAVRFGLYYVDYKNDLKRYPKQSVKWFKKFLRR 387 [53][TOP] >UniRef100_B9N6U4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N6U4_POPTR Length = 519 Score = 75.9 bits (185), Expect = 1e-12 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW SGY VRFG+ +VDYKN LKRY K S KWF FL+R Sbjct: 440 WSLMDNFEWGSGYAVRFGLYYVDYKNDLKRYPKKSVKWFKQFLRR 484 [54][TOP] >UniRef100_B9N6U2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N6U2_POPTR Length = 519 Score = 75.9 bits (185), Expect = 1e-12 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW SGY VRFG+ +VDYKN LKRY K S KWF FL+R Sbjct: 440 WSLMDNFEWGSGYAVRFGLYYVDYKNDLKRYPKKSVKWFKQFLRR 484 [55][TOP] >UniRef100_B9H3V8 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9H3V8_POPTR Length = 334 Score = 75.9 bits (185), Expect = 1e-12 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW SGY VRFG+ +VDYKN LKRY K S KWF FL+R Sbjct: 290 WSLMDNFEWGSGYAVRFGLYYVDYKNDLKRYPKQSVKWFKQFLRR 334 [56][TOP] >UniRef100_A7QRE1 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=2 Tax=Vitis vinifera RepID=A7QRE1_VITVI Length = 505 Score = 75.9 bits (185), Expect = 1e-12 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDNYEW SGYTVRFG+ FVDY NGLKRY K SA WF FL Sbjct: 462 WSLLDNYEWRSGYTVRFGIVFVDYDNGLKRYPKHSAIWFQKFL 504 [57][TOP] >UniRef100_UPI0001984A09 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984A09 Length = 435 Score = 75.5 bits (184), Expect = 2e-12 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW++G+TVRFG+N+VDYKNGLKRY K SA WF FL++ Sbjct: 391 WSFLDDFEWNAGFTVRFGLNYVDYKNGLKRYPKHSAYWFKKFLQK 435 [58][TOP] >UniRef100_Q7XKV4 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XKV4_ORYSJ Length = 510 Score = 75.5 bits (184), Expect = 2e-12 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EWS+GYTVRFG+NFVDY +G KRY K SA WF FL Sbjct: 466 WSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFL 508 [59][TOP] >UniRef100_Q0JCF3 Os04g0474800 protein (Fragment) n=2 Tax=Oryza sativa Japonica Group RepID=Q0JCF3_ORYSJ Length = 395 Score = 75.5 bits (184), Expect = 2e-12 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EWS+GYTVRFG+NFVDY +G KRY K SA WF FL Sbjct: 351 WSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFL 393 [60][TOP] >UniRef100_Q08IT7 Isoflavone conjugate-specific beta-glucosidase n=1 Tax=Glycine max RepID=Q08IT7_SOYBN Length = 514 Score = 75.5 bits (184), Expect = 2e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD EW +G+TVRFG+NFVDYK+GLKRY KL A+W+ NFLKR Sbjct: 469 WSFLDCNEWFAGFTVRFGLNFVDYKDGLKRYPKLFAQWYKNFLKR 513 [61][TOP] >UniRef100_C5YAD5 Putative uncharacterized protein Sb06g019840 n=1 Tax=Sorghum bicolor RepID=C5YAD5_SORBI Length = 512 Score = 75.5 bits (184), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW +GYTVRFG+ FVDY +GLKRY K SA WF FLK+ Sbjct: 468 WSLLDNFEWVNGYTVRFGIYFVDYSDGLKRYPKSSAHWFKKFLKK 512 [62][TOP] >UniRef100_Q01KB2 OSIGBa0135C13.7 protein n=2 Tax=Oryza sativa RepID=Q01KB2_ORYSA Length = 510 Score = 75.5 bits (184), Expect = 2e-12 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EWS+GYTVRFG+NFVDY +G KRY K SA WF FL Sbjct: 466 WSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFL 508 [63][TOP] >UniRef100_A7QRE9 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QRE9_VITVI Length = 501 Score = 75.5 bits (184), Expect = 2e-12 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW++G+TVRFG+N+VDYKNGLKRY K SA WF FL++ Sbjct: 457 WSFLDDFEWNAGFTVRFGLNYVDYKNGLKRYPKHSAYWFKKFLQK 501 [64][TOP] >UniRef100_A6N1U0 Non-cyanogenic beta-glucosidase (Fragment) n=1 Tax=Oryza sativa Indica Group RepID=A6N1U0_ORYSI Length = 140 Score = 75.5 bits (184), Expect = 2e-12 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EWS+GYTVRFG+NFVDY +G KRY K SA WF FL Sbjct: 96 WSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFL 138 [65][TOP] >UniRef100_A5BPI8 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BPI8_VITVI Length = 415 Score = 75.5 bits (184), Expect = 2e-12 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW++G+TVRFG+N+VDYKNGLKRY K SA WF FL++ Sbjct: 371 WSFLDDFEWNAGFTVRFGLNYVDYKNGLKRYPKHSAYWFKKFLQK 415 [66][TOP] >UniRef100_Q945N9 Prunasin hydrolase isoform PH B (Fragment) n=1 Tax=Prunus serotina RepID=Q945N9_PRUSE Length = 517 Score = 75.1 bits (183), Expect = 2e-12 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+N+V+Y +GL+R+ KLS WF +FLK+ Sbjct: 448 WSLLDNFEWSEGYTVRFGINYVEYDSGLERHSKLSKHWFKSFLKK 492 [67][TOP] >UniRef100_Q8W1W7 Prunasin hydrolase isoform PH B n=1 Tax=Prunus serotina RepID=Q8W1W7_PRUSE Length = 545 Score = 75.1 bits (183), Expect = 2e-12 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+N+V+Y +GL+R+ KLS WF +FLK+ Sbjct: 476 WSLLDNFEWSEGYTVRFGINYVEYDSGLERHSKLSKHWFKSFLKK 520 [68][TOP] >UniRef100_A8TVQ9 Beta-glucosidase G3 n=1 Tax=Medicago truncatula RepID=A8TVQ9_MEDTR Length = 504 Score = 75.1 bits (183), Expect = 2e-12 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW SG+++RFG+ FVD+K+ LKR+ KLSA WF NFLKR Sbjct: 459 WSLLDNFEWESGFSLRFGLVFVDFKDNLKRHPKLSAHWFKNFLKR 503 [69][TOP] >UniRef100_A8C6P2 Cyanogenic beta-glucosidase (Fragment) n=1 Tax=Trifolium isthmocarpum RepID=A8C6P2_9FABA Length = 494 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN EW SGYTVRFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [70][TOP] >UniRef100_A8C6N9 Cyanogenic beta-glucosidase (Fragment) n=1 Tax=Trifolium nigrescens subsp. petrisavii RepID=A8C6N9_9FABA Length = 494 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN EW SGYTVRFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [71][TOP] >UniRef100_A8C6N7 Cyanogenic beta-glucosidase (Fragment) n=1 Tax=Trifolium nigrescens subsp. petrisavii RepID=A8C6N7_9FABA Length = 494 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN EW SGYTVRFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [72][TOP] >UniRef100_A8C6N4 Cyanogenic beta-glucosidase (Fragment) n=1 Tax=Trifolium nigrescens subsp. petrisavii RepID=A8C6N4_9FABA Length = 494 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN EW SGYTVRFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [73][TOP] >UniRef100_A8C6M3 Cyanogenic beta-glucosidase (Fragment) n=1 Tax=Trifolium repens RepID=A8C6M3_TRIRP Length = 494 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN EW SGYTVRFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [74][TOP] >UniRef100_A8C6L1 Cyanogenic beta-glucosidase (Fragment) n=1 Tax=Trifolium repens RepID=A8C6L1_TRIRP Length = 494 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN EW SGYTVRFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [75][TOP] >UniRef100_A8C6K7 Cyanogenic beta-glucosidase (Fragment) n=1 Tax=Trifolium repens RepID=A8C6K7_TRIRP Length = 494 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN EW SGYTVRFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [76][TOP] >UniRef100_A8C6J3 Cyanogenic beta-glucosidase (Fragment) n=1 Tax=Trifolium repens RepID=A8C6J3_TRIRP Length = 494 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN EW SGYTVRFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [77][TOP] >UniRef100_A8C6H2 Cyanogenic beta-glucosidase (Fragment) n=1 Tax=Trifolium repens RepID=A8C6H2_TRIRP Length = 494 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN EW SGYTVRFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [78][TOP] >UniRef100_A8C6G0 Cyanogenic beta-glucosidase (Fragment) n=1 Tax=Trifolium repens RepID=A8C6G0_TRIRP Length = 494 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN EW SGYTVRFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [79][TOP] >UniRef100_A7QRF7 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QRF7_VITVI Length = 179 Score = 75.1 bits (183), Expect = 2e-12 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLD+YEW+SGYTVRFG+ FVDY NGLKRY K SA WF FL Sbjct: 136 WSLLDDYEWNSGYTVRFGIVFVDYDNGLKRYPKHSALWFKKFL 178 [80][TOP] >UniRef100_A5C932 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=2 Tax=Vitis vinifera RepID=A5C932_VITVI Length = 505 Score = 75.1 bits (183), Expect = 2e-12 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WS LDNYEW+SGYTVRFG+ FVDY NGLKRY K SA WF FL Sbjct: 462 WSFLDNYEWNSGYTVRFGIVFVDYDNGLKRYPKHSAIWFKKFL 504 [81][TOP] >UniRef100_Q9FLU8 Beta-glucosidase 32 n=1 Tax=Arabidopsis thaliana RepID=BGL32_ARATH Length = 534 Score = 74.7 bits (182), Expect = 3e-12 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW GY VRFG+ +VDYKNGL R+ K SAKWF +FL+R Sbjct: 467 WSLLDNFEWEHGYAVRFGLYYVDYKNGLSRHAKNSAKWFKHFLQR 511 [82][TOP] >UniRef100_UPI0001984A06 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984A06 Length = 384 Score = 74.3 bits (181), Expect = 4e-12 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDNYEW+ GYTVRFG+ FVDY NGLKRY K SA WF FL Sbjct: 340 WSLLDNYEWNFGYTVRFGIVFVDYDNGLKRYPKHSAIWFKKFL 382 [83][TOP] >UniRef100_Q700B1 Non-cyanogenic beta-glucosidase n=1 Tax=Cicer arietinum RepID=Q700B1_CICAR Length = 511 Score = 74.3 bits (181), Expect = 4e-12 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLD++EW +GYTVRFG FVDY +GLKRY+KLSA W+ FL+R Sbjct: 460 WSLLDSFEWFNGYTVRFGFYFVDYNDGLKRYQKLSANWYRYFLER 504 [84][TOP] >UniRef100_C5YAE1 Putative uncharacterized protein Sb06g019880 n=1 Tax=Sorghum bicolor RepID=C5YAE1_SORBI Length = 442 Score = 74.3 bits (181), Expect = 4e-12 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW +GYTVRFG+N+VDY +GLKRY K SA WF FL++ Sbjct: 398 WSLMDNFEWVNGYTVRFGLNYVDYNDGLKRYPKNSAHWFKAFLQK 442 [85][TOP] >UniRef100_B9N9D9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N9D9_POPTR Length = 305 Score = 74.3 bits (181), Expect = 4e-12 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW SGY VRFG+ VDYKN LKRY K S KWF FL+R Sbjct: 232 WSLMDNFEWGSGYAVRFGLYHVDYKNDLKRYPKQSVKWFKQFLRR 276 [86][TOP] >UniRef100_A7QRE4 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QRE4_VITVI Length = 130 Score = 74.3 bits (181), Expect = 4e-12 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDNYEW+ GYTVRFG+ FVDY NGLKRY K SA WF FL Sbjct: 86 WSLLDNYEWNFGYTVRFGIVFVDYDNGLKRYPKHSAIWFKKFL 128 [87][TOP] >UniRef100_A8TVQ0 Beta-glucosidase G1 n=1 Tax=Medicago truncatula RepID=A8TVQ0_MEDTR Length = 506 Score = 73.9 bits (180), Expect = 5e-12 Identities = 32/45 (71%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNG-LKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYTVRFG+NFVDY+NG L R+ KLSA+WF FL+ Sbjct: 456 WSLLDNFEWNDGYTVRFGINFVDYENGHLTRHPKLSARWFRKFLQ 500 [88][TOP] >UniRef100_Q9M1D1 Beta-glucosidase 27 n=1 Tax=Arabidopsis thaliana RepID=BGL27_ARATH Length = 540 Score = 73.9 bits (180), Expect = 5e-12 Identities = 31/51 (60%), Positives = 40/51 (78%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY*TLDD 334 WSLLDN EW++GY VR+G+ +VDY NGLKR+ K+SA WF FLKR ++D Sbjct: 447 WSLLDNCEWNAGYGVRYGLFYVDYNNGLKRFPKMSAMWFKEFLKREEEIED 497 [89][TOP] >UniRef100_C6TII5 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TII5_SOYBN Length = 208 Score = 73.6 bits (179), Expect = 7e-12 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GY++RFG+ +VDYKNGLKRY+K SA WF FL Sbjct: 164 WSLLDNFEWNAGYSLRFGLVYVDYKNGLKRYRKRSALWFKIFL 206 [90][TOP] >UniRef100_Q01KA9 OSIGBa0135C13.2 protein n=1 Tax=Oryza sativa RepID=Q01KA9_ORYSA Length = 514 Score = 73.2 bits (178), Expect = 9e-12 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYT+RFG+NFVDY +G+KR+ K SA WF FL+ Sbjct: 466 WSLLDNFEWADGYTLRFGLNFVDYDDGMKRHPKNSAHWFKKFLR 509 [91][TOP] >UniRef100_B9NC20 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9NC20_POPTR Length = 475 Score = 73.2 bits (178), Expect = 9e-12 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSL+DN+EW SGY VRFG+ +VDYKN LKRY K S KWF FL Sbjct: 433 WSLMDNFEWGSGYAVRFGLYYVDYKNDLKRYPKQSVKWFKQFL 475 [92][TOP] >UniRef100_B9N6U3 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9N6U3_POPTR Length = 475 Score = 73.2 bits (178), Expect = 9e-12 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSL+DN+EW SGY VRFG+ +VDYKN LKRY K S KWF FL Sbjct: 433 WSLMDNFEWGSGYAVRFGLYYVDYKNDLKRYPKKSVKWFKQFL 475 [93][TOP] >UniRef100_A3AUS9 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3AUS9_ORYSJ Length = 254 Score = 73.2 bits (178), Expect = 9e-12 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYT+RFG+NFVDY +G+KR+ K SA WF FL+ Sbjct: 206 WSLLDNFEWADGYTLRFGLNFVDYDDGMKRHPKNSAHWFKKFLR 249 [94][TOP] >UniRef100_A2XUK0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XUK0_ORYSI Length = 254 Score = 73.2 bits (178), Expect = 9e-12 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYT+RFG+NFVDY +G+KR+ K SA WF FL+ Sbjct: 206 WSLLDNFEWADGYTLRFGLNFVDYDDGMKRHPKNSAHWFKKFLR 249 [95][TOP] >UniRef100_UPI0000E127A6 Os06g0320200 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E127A6 Length = 580 Score = 72.8 bits (177), Expect = 1e-11 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSL DN+EW GY+VRFG+N++DYK+GLKRY K S++W NFL Sbjct: 536 WSLFDNFEWMDGYSVRFGINYIDYKDGLKRYPKRSSQWLQNFL 578 [96][TOP] >UniRef100_Q5Z9Z0 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5Z9Z0_ORYSJ Length = 504 Score = 72.8 bits (177), Expect = 1e-11 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSL DN+EW GY+VRFG+N++DYK+GLKRY K S++W NFL Sbjct: 460 WSLFDNFEWMDGYSVRFGINYIDYKDGLKRYPKRSSQWLQNFL 502 [97][TOP] >UniRef100_C0PT85 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=C0PT85_PICSI Length = 508 Score = 72.8 bits (177), Expect = 1e-11 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EWS GYT RFG+ FVDYKN LKR+ K SA WF +FL R Sbjct: 450 WSLIDNFEWSQGYTKRFGLVFVDYKNELKRHPKSSAHWFTSFLHR 494 [98][TOP] >UniRef100_B9REF8 Beta-glucosidase, putative n=1 Tax=Ricinus communis RepID=B9REF8_RICCO Length = 504 Score = 72.8 bits (177), Expect = 1e-11 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GYT RFG+ FVDYK+ LKRY K S KWF NFL Sbjct: 459 WSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVKWFKNFL 501 [99][TOP] >UniRef100_B8B155 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B155_ORYSI Length = 504 Score = 72.8 bits (177), Expect = 1e-11 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSL DN+EW GY+VRFG+N++DYK+GLKRY K S++W NFL Sbjct: 460 WSLFDNFEWMDGYSVRFGINYIDYKDGLKRYPKRSSQWLQNFL 502 [100][TOP] >UniRef100_Q9FLU9 Beta-glucosidase 31 n=1 Tax=Arabidopsis thaliana RepID=BGL31_ARATH Length = 534 Score = 72.8 bits (177), Expect = 1e-11 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW GY VRFG+ +VDYKNGL+R+ K SA WF +FL+R Sbjct: 467 WSLLDNFEWEHGYAVRFGLYYVDYKNGLQRHAKHSAMWFKHFLER 511 [101][TOP] >UniRef100_Q8LSH8 Beta-glucosidase-like protein (Fragment) n=1 Tax=Phaseolus vulgaris RepID=Q8LSH8_PHAVU Length = 161 Score = 72.4 bits (176), Expect = 1e-11 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYT RFG+ +VDYKNGL R+ K SA WF+ FLK Sbjct: 94 WSLLDNFEWAQGYTKRFGLVYVDYKNGLSRHPKSSAYWFSRFLK 137 [102][TOP] >UniRef100_B9H2X5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H2X5_POPTR Length = 516 Score = 72.4 bits (176), Expect = 1e-11 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+D +EW GYT RFG+N++D+K+GLKR+ KLSA+WF FLK+ Sbjct: 472 WSLMDGFEWVVGYTSRFGLNYIDHKDGLKRHPKLSAQWFTKFLKK 516 [103][TOP] >UniRef100_A8C6P5 Beta-glucosidase-like protein (Fragment) n=1 Tax=Trifolium repens RepID=A8C6P5_TRIRP Length = 493 Score = 72.4 bits (176), Expect = 1e-11 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN EW SG+++RFG+ FVD+KN LKR+ KLSA WF +FLK+ Sbjct: 449 WSLLDNMEWESGFSLRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 493 [104][TOP] >UniRef100_UPI00005DBF00 BGLU16 (BETA GLUCOSIDASE 16); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds n=1 Tax=Arabidopsis thaliana RepID=UPI00005DBF00 Length = 462 Score = 72.0 bits (175), Expect = 2e-11 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSL+DN+EWS GYTVRFG+ FVD+++G KRY K SAKWF LK Sbjct: 406 WSLMDNFEWSEGYTVRFGLVFVDFEDGRKRYLKKSAKWFRRLLK 449 [105][TOP] >UniRef100_Q5N863 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5N863_ORYSJ Length = 483 Score = 72.0 bits (175), Expect = 2e-11 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WS LDN+EW+ GYT RFG+ +VDYKNGL R+ K SA+WF+ FLK Sbjct: 429 WSFLDNFEWAMGYTKRFGIVYVDYKNGLSRHPKASARWFSRFLK 472 [106][TOP] >UniRef100_Q0JGX5 Os01g0897600 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q0JGX5_ORYSJ Length = 166 Score = 72.0 bits (175), Expect = 2e-11 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WS LDN+EW+ GYT RFG+ +VDYKNGL R+ K SA+WF+ FLK Sbjct: 112 WSFLDNFEWAMGYTKRFGIVYVDYKNGLSRHPKASARWFSRFLK 155 [107][TOP] >UniRef100_A8TVR1 Beta-glucosidase G4 n=1 Tax=Medicago truncatula RepID=A8TVR1_MEDTR Length = 493 Score = 72.0 bits (175), Expect = 2e-11 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYT RFG+ +VDYKNGL R+ K SA WF+ FLK Sbjct: 440 WSLLDNFEWAQGYTKRFGLVYVDYKNGLTRHPKSSAYWFSRFLK 483 [108][TOP] >UniRef100_A8MSC6 Uncharacterized protein At3g60130.3 n=1 Tax=Arabidopsis thaliana RepID=A8MSC6_ARATH Length = 451 Score = 72.0 bits (175), Expect = 2e-11 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSL+DN+EWS GYTVRFG+ FVD+++G KRY K SAKWF LK Sbjct: 395 WSLMDNFEWSEGYTVRFGLVFVDFEDGRKRYLKKSAKWFRRLLK 438 [109][TOP] >UniRef100_Q9M1C9 Beta-glucosidase 30 n=1 Tax=Arabidopsis thaliana RepID=BGL30_ARATH Length = 577 Score = 72.0 bits (175), Expect = 2e-11 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW GYT RFG+ +VD+ NGLKRY K S KWF FLK+ Sbjct: 460 WSLMDNFEWEHGYTARFGLYYVDFVNGLKRYPKDSVKWFKRFLKK 504 [110][TOP] >UniRef100_Q9M1D0-2 Isoform 2 of Beta-glucosidase 16 n=1 Tax=Arabidopsis thaliana RepID=Q9M1D0-2 Length = 503 Score = 72.0 bits (175), Expect = 2e-11 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSL+DN+EWS GYTVRFG+ FVD+++G KRY K SAKWF LK Sbjct: 447 WSLMDNFEWSEGYTVRFGLVFVDFEDGRKRYLKKSAKWFRRLLK 490 [111][TOP] >UniRef100_Q9M1D0 Beta-glucosidase 16 n=1 Tax=Arabidopsis thaliana RepID=BGL16_ARATH Length = 514 Score = 72.0 bits (175), Expect = 2e-11 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSL+DN+EWS GYTVRFG+ FVD+++G KRY K SAKWF LK Sbjct: 458 WSLMDNFEWSEGYTVRFGLVFVDFEDGRKRYLKKSAKWFRRLLK 501 [112][TOP] >UniRef100_A9SYD7 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SYD7_PHYPA Length = 469 Score = 71.6 bits (174), Expect = 2e-11 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DNYEW+ GYTVRFG+ +VDYKN L RY K SA WF + LK+ Sbjct: 424 WSLMDNYEWADGYTVRFGIYYVDYKNNLARYPKDSAFWFQHILKK 468 [113][TOP] >UniRef100_UPI00019849EC PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019849EC Length = 622 Score = 71.2 bits (173), Expect = 3e-11 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW +G+T RFG+++VDYKNGLKRY K SA WF FL++ Sbjct: 454 WSFLDDFEWDAGFTFRFGLSYVDYKNGLKRYPKHSAYWFKKFLQK 498 Score = 68.2 bits (165), Expect = 3e-10 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WS LD++EW +G+T RFG+ +VDYKNGLKRY K S WF FL Sbjct: 580 WSFLDDFEWDAGFTFRFGLGYVDYKNGLKRYPKHSTYWFKKFL 622 [114][TOP] >UniRef100_UPI000198483B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI000198483B Length = 537 Score = 71.2 bits (173), Expect = 3e-11 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WS LD++EW SG+T RFG+ +VDYKNGLKRY K SA WF FL+ Sbjct: 462 WSFLDDFEWDSGFTFRFGLGYVDYKNGLKRYLKHSAYWFKKFLR 505 [115][TOP] >UniRef100_UPI000161F62C predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=UPI000161F62C Length = 499 Score = 71.2 bits (173), Expect = 3e-11 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW+ GYTVRFG+ +VDYKNGL RY K S WF LK+ Sbjct: 451 WSLMDNFEWAVGYTVRFGIYYVDYKNGLARYPKSSVHWFQQILKK 495 [116][TOP] >UniRef100_Q9FIW4 Beta-glucosidase n=1 Tax=Arabidopsis thaliana RepID=Q9FIW4_ARATH Length = 490 Score = 71.2 bits (173), Expect = 3e-11 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYT RFG+ +VDYKNGL R+ K SA WF FLK Sbjct: 437 WSLLDNFEWAQGYTKRFGLVYVDYKNGLTRHPKSSAYWFMKFLK 480 [117][TOP] >UniRef100_Q7Y073 Latex cyanogenic beta glucosidase n=1 Tax=Hevea brasiliensis RepID=Q7Y073_HEVBR Length = 489 Score = 71.2 bits (173), Expect = 3e-11 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYT RFG+ +VDYKNGL R+ K SA WF FLK Sbjct: 437 WSLLDNFEWAQGYTKRFGLIYVDYKNGLARHPKSSAYWFMRFLK 480 [118][TOP] >UniRef100_Q2V330 Putative uncharacterized protein At5g36890.2 n=1 Tax=Arabidopsis thaliana RepID=Q2V330_ARATH Length = 487 Score = 71.2 bits (173), Expect = 3e-11 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYT RFG+ +VDYKNGL R+ K SA WF FLK Sbjct: 437 WSLLDNFEWAQGYTKRFGLVYVDYKNGLTRHPKSSAYWFMKFLK 480 [119][TOP] >UniRef100_B9RM06 Beta-glucosidase, putative n=1 Tax=Ricinus communis RepID=B9RM06_RICCO Length = 500 Score = 71.2 bits (173), Expect = 3e-11 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYT RFG+ +VDYKNGL R+ K SA WF FLK Sbjct: 447 WSLLDNFEWAQGYTKRFGLVYVDYKNGLARHPKSSAYWFLRFLK 490 [120][TOP] >UniRef100_A7QRD8 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QRD8_VITVI Length = 391 Score = 71.2 bits (173), Expect = 3e-11 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW +G+T RFG+++VDYKNGLKRY K SA WF FL++ Sbjct: 347 WSFLDDFEWDAGFTFRFGLSYVDYKNGLKRYPKHSAYWFKKFLQK 391 [121][TOP] >UniRef100_UPI0001984C59 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984C59 Length = 518 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS++DN+EW SGYT RFGM F+DYKN LKR+ K+SA WF L+R Sbjct: 470 WSIVDNFEWKSGYTSRFGMVFIDYKNQLKRHPKMSAFWFKKLLQR 514 [122][TOP] >UniRef100_B5M9E4 Beta-glucosidase 01 n=1 Tax=Solanum lycopersicum RepID=B5M9E4_SOLLC Length = 517 Score = 70.9 bits (172), Expect = 4e-11 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WS DN+EW SGYT RFG+NFVDYKN LKRY K SA W FL Sbjct: 473 WSFYDNFEWGSGYTQRFGINFVDYKNNLKRYPKRSALWMKKFL 515 [123][TOP] >UniRef100_A7Q264 Chromosome chr13 scaffold_45, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7Q264_VITVI Length = 510 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW SG+T RFG+ +VDYKNGLKRY K SA WF FL + Sbjct: 466 WSFLDDFEWDSGFTFRFGLGYVDYKNGLKRYLKHSAYWFKKFLHK 510 [124][TOP] >UniRef100_A7PR65 Chromosome chr14 scaffold_26, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PR65_VITVI Length = 552 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS++DN+EW SGYT RFGM F+DYKN LKR+ K+SA WF L+R Sbjct: 504 WSIVDNFEWKSGYTSRFGMVFIDYKNQLKRHPKMSAFWFKKLLQR 548 [125][TOP] >UniRef100_A5BEY1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BEY1_VITVI Length = 437 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW SG+T RFG+ +VDYKNGLKRY K SA WF FL + Sbjct: 393 WSFLDDFEWDSGFTFRFGLGYVDYKNGLKRYLKHSAYWFKKFLHK 437 [126][TOP] >UniRef100_C5YAD4 Putative uncharacterized protein Sb06g019830 n=1 Tax=Sorghum bicolor RepID=C5YAD4_SORBI Length = 448 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW +TVRFG+NFVDY +GLKRY K SA WF L++ Sbjct: 400 WSLLDNFEWRDAFTVRFGINFVDYNDGLKRYPKNSAHWFREILQK 444 [127][TOP] >UniRef100_C5XFD2 Putative uncharacterized protein Sb03g042690 n=1 Tax=Sorghum bicolor RepID=C5XFD2_SORBI Length = 608 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WS LDN+EW+ GYT RFG+ +VDYKNGL R+ K SA WF+ FLK Sbjct: 554 WSFLDNFEWAMGYTKRFGIVYVDYKNGLSRHPKASALWFSRFLK 597 [128][TOP] >UniRef100_O64883 Beta-glucosidase 26, peroxisomal n=1 Tax=Arabidopsis thaliana RepID=BGL26_ARATH Length = 560 Score = 70.5 bits (171), Expect = 6e-11 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+SGY VR+G+ ++DYK+GL+RY K+SA W FL+ Sbjct: 450 WSLLDNFEWNSGYGVRYGLYYIDYKDGLRRYPKMSALWLKEFLR 493 [129][TOP] >UniRef100_Q9FVL4 Silverleaf whitefly-induced protein 3 n=1 Tax=Cucurbita pepo RepID=Q9FVL4_CUCPE Length = 490 Score = 69.7 bits (169), Expect = 9e-11 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GY++RFG+ +VD+KN L R +K SAKWF NFL Sbjct: 446 WSLLDNFEWANGYSMRFGLTYVDFKNDLTRTQKDSAKWFLNFL 488 [130][TOP] >UniRef100_B9N6F7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N6F7_POPTR Length = 506 Score = 69.7 bits (169), Expect = 9e-11 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW +GYTVRFG+ +VD+KN LKRY K SA+WF LK+ Sbjct: 462 WSFLDDFEWDAGYTVRFGVTYVDFKNNLKRYLKSSARWFQLLLKK 506 [131][TOP] >UniRef100_UPI00019828AB PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019828AB Length = 505 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW +G+T RFG+ FVDYK+ LKRY K S +WF NFL Sbjct: 460 WSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQWFKNFL 502 [132][TOP] >UniRef100_UPI00019828AA PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019828AA Length = 481 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW +G+T RFG+ FVDYK+ LKRY K S +WF NFL Sbjct: 436 WSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQWFKNFL 478 [133][TOP] >UniRef100_A7P2I4 Chromosome chr1 scaffold_5, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7P2I4_VITVI Length = 504 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW +G+T RFG+ FVDYK+ LKRY K S +WF NFL Sbjct: 459 WSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQWFKNFL 501 [134][TOP] >UniRef100_A7P2I3 Chromosome chr1 scaffold_5, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7P2I3_VITVI Length = 504 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW +G+T RFG+ FVDYK+ LKRY K S +WF NFL Sbjct: 459 WSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQWFKNFL 501 [135][TOP] >UniRef100_UPI000034F305 BGLU41 (BETA GLUCOSIDASE 41); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds n=1 Tax=Arabidopsis thaliana RepID=UPI000034F305 Length = 535 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW+SGYTVRFG+ +VDYKN L R K SA+WF L Sbjct: 463 WSLLDNWEWNSGYTVRFGIYYVDYKNNLTRIPKASARWFQTIL 505 [136][TOP] >UniRef100_Q9FIU7 Beta-glucosidase n=1 Tax=Arabidopsis thaliana RepID=Q9FIU7_ARATH Length = 520 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW+SGYTVRFG+ +VDYKN L R K SA+WF L Sbjct: 448 WSLLDNWEWNSGYTVRFGIYYVDYKNNLTRIPKASARWFQTIL 490 [137][TOP] >UniRef100_C5WR51 Putative uncharacterized protein Sb01g013360 n=1 Tax=Sorghum bicolor RepID=C5WR51_SORBI Length = 440 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GYT RFG+ FVDY N LKRY K S WF N L Sbjct: 377 WSLLDNWEWTAGYTSRFGLYFVDYNNNLKRYPKNSVLWFKNLL 419 [138][TOP] >UniRef100_C4J9Z9 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4J9Z9_MAIZE Length = 523 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GY+ RFG+ FVDYK+ LKRY K S +WF N L Sbjct: 478 WSLLDNWEWTAGYSSRFGLYFVDYKDNLKRYPKSSVQWFKNLL 520 [139][TOP] >UniRef100_C0P8I1 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0P8I1_MAIZE Length = 239 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GY+ RFG+ FVDYK+ LKRY K S +WF N L Sbjct: 194 WSLLDNWEWTAGYSSRFGLYFVDYKDNLKRYPKSSVQWFKNLL 236 [140][TOP] >UniRef100_B9NDX7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NDX7_POPTR Length = 217 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW SGY+ RFG+ ++DY+N LKRY K S KWF FLK+ Sbjct: 163 WSFLDDFEWGSGYSSRFGLFYIDYENNLKRYAKNSVKWFKQFLKK 207 [141][TOP] >UniRef100_B9I7D8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I7D8_POPTR Length = 515 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+SGYTVRFG+ FVDY+N L R K SA+WF L+ Sbjct: 463 WSLLDNWEWNSGYTVRFGLYFVDYRNNLTRVPKASAEWFKRTLR 506 [142][TOP] >UniRef100_B9HXK7 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9HXK7_POPTR Length = 509 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GYT RFG+ FVDYK+ LKRY K S +WF FL Sbjct: 464 WSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVQWFKKFL 506 [143][TOP] >UniRef100_B9HID2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HID2_POPTR Length = 512 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GYT RFG+ FVDYK+ LKRY K S +WF FL Sbjct: 467 WSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVQWFKKFL 509 [144][TOP] >UniRef100_B9GTS5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GTS5_POPTR Length = 491 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW SGY+ RFG+ ++DY+N LKRY K S KWF FLK+ Sbjct: 437 WSFLDDFEWGSGYSSRFGLFYIDYENNLKRYAKNSVKWFKQFLKK 481 [145][TOP] >UniRef100_B9GEM2 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9GEM2_POPTR Length = 200 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW SGY+ RFG+ ++DY+N LKRY K S KWF FLK+ Sbjct: 146 WSFLDDFEWGSGYSSRFGLFYIDYENNLKRYAKNSVKWFKQFLKK 190 [146][TOP] >UniRef100_Q84WV2 Beta-glucosidase 20 n=1 Tax=Arabidopsis thaliana RepID=BGL20_ARATH Length = 535 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSL+DN+EW GY RFG+ +VDYKN L R++KLSA+W+++FL Sbjct: 475 WSLMDNFEWQDGYKARFGLYYVDYKNNLTRHEKLSAQWYSSFL 517 [147][TOP] >UniRef100_O64879 Beta-glucosidase 15 n=1 Tax=Arabidopsis thaliana RepID=BGL15_ARATH Length = 506 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW+ GYTVRFG+ +VD+K+G KRY K SA+WF L Sbjct: 458 WSLLDNFEWAMGYTVRFGLVYVDFKDGCKRYPKKSAEWFRKLL 500 [148][TOP] >UniRef100_A9SST8 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SST8_PHYPA Length = 474 Score = 68.6 bits (166), Expect = 2e-10 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EWS GYTVRFG+ +VDYKNGL R K S WF L++ Sbjct: 426 WSLLDNFEWSEGYTVRFGIYYVDYKNGLARLPKSSVFWFRQVLRK 470 [149][TOP] >UniRef100_Q9LV33 Beta-glucosidase 44 n=1 Tax=Arabidopsis thaliana RepID=BGL44_ARATH Length = 512 Score = 68.6 bits (166), Expect = 2e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW SGYT RFG+ +VDYK LKRY K+SA+WF LKR Sbjct: 466 WSLLDNFEWLSGYTSRFGIVYVDYKT-LKRYPKMSAQWFKQLLKR 509 [150][TOP] >UniRef100_Q5UB04 Beta-glycosidase n=1 Tax=Dalbergia nigrescens RepID=Q5UB04_9FABA Length = 531 Score = 68.2 bits (165), Expect = 3e-10 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 W+L+D++EWS G+T RFG+NFVDY N L RY KLSAKWF FL R Sbjct: 468 WTLMDDFEWSGGFTSRFGLNFVDY-NTLNRYPKLSAKWFKYFLTR 511 [151][TOP] >UniRef100_A9NVG8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NVG8_PICSI Length = 477 Score = 68.2 bits (165), Expect = 3e-10 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSL+DN+EW GYT RFG ++DYK+GLKRY K SA W+ FL Sbjct: 433 WSLMDNFEWGFGYTSRFGFIYIDYKDGLKRYPKASAHWYKKFL 475 [152][TOP] >UniRef100_A7QRD9 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QRD9_VITVI Length = 233 Score = 68.2 bits (165), Expect = 3e-10 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WS LD++EW +G+T RFG+ +VDYKNGLKRY K S WF FL Sbjct: 191 WSFLDDFEWDAGFTFRFGLGYVDYKNGLKRYPKHSTYWFKKFL 233 [153][TOP] >UniRef100_UPI00019860B5 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019860B5 Length = 324 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EWS GYT RFG+ +VDY+N L R+ K SA WF FL+ Sbjct: 271 WSLLDNFEWSQGYTKRFGLVYVDYRNDLSRHPKSSALWFLRFLR 314 [154][TOP] >UniRef100_UPI0001985FE9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FE9 Length = 1027 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EWS GYT RFG+ +VDY+N L R+ K SA WF FL+ Sbjct: 974 WSLLDNFEWSQGYTKRFGLVYVDYRNDLSRHPKSSALWFLRFLR 1017 [155][TOP] >UniRef100_UPI000016343A BGLU43 (BETA GLUCOSIDASE 43); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds n=1 Tax=Arabidopsis thaliana RepID=UPI000016343A Length = 501 Score = 67.8 bits (164), Expect = 4e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW SGYT RFG+ +VDYK+ LKRY K+SA WF LKR Sbjct: 455 WSLLDNFEWLSGYTSRFGIVYVDYKD-LKRYPKMSALWFKQLLKR 498 [156][TOP] >UniRef100_Q9LV34 Beta-glucosidase n=1 Tax=Arabidopsis thaliana RepID=Q9LV34_ARATH Length = 495 Score = 67.8 bits (164), Expect = 4e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW SGYT RFG+ +VDYK+ LKRY K+SA WF LKR Sbjct: 449 WSLLDNFEWLSGYTSRFGIVYVDYKD-LKRYPKMSALWFKQLLKR 492 [157][TOP] >UniRef100_Q1PEP7 Glycosyl hydrolase family 1 protein n=1 Tax=Arabidopsis thaliana RepID=Q1PEP7_ARATH Length = 424 Score = 67.8 bits (164), Expect = 4e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW SGYT RFG+ +VDYK+ LKRY K+SA WF LKR Sbjct: 378 WSLLDNFEWLSGYTSRFGIVYVDYKD-LKRYPKMSALWFKQLLKR 421 [158][TOP] >UniRef100_C5YC13 Putative uncharacterized protein Sb06g022410 n=1 Tax=Sorghum bicolor RepID=C5YC13_SORBI Length = 510 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSL+DN+EW SGYT+++G+ VD+K+ LKR KLSAKW++NF+K Y Sbjct: 450 WSLMDNFEWLSGYTIKYGLYHVDFKS-LKRTPKLSAKWYSNFIKGY 494 [159][TOP] >UniRef100_B9S3T2 Beta-glucosidase, putative n=1 Tax=Ricinus communis RepID=B9S3T2_RICCO Length = 102 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WS LD++EW GYTVRFG+ ++DY+N LKR K SA WF NFL Sbjct: 45 WSFLDDFEWEFGYTVRFGLTYIDYRNSLKRTPKASALWFKNFL 87 [160][TOP] >UniRef100_B9N6U5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N6U5_POPTR Length = 493 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW SGY RFG+ ++DY+N LKRY K S KWF FLK+ Sbjct: 439 WSFLDDFEWGSGYGSRFGLFYIDYENNLKRYAKNSVKWFKQFLKK 483 [161][TOP] >UniRef100_B9GEM1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GEM1_POPTR Length = 488 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW SGY RFG+ ++DY+N LKRY K S KWF FLK+ Sbjct: 434 WSFLDDFEWGSGYGSRFGLFYIDYENNLKRYAKNSVKWFKQFLKK 478 [162][TOP] >UniRef100_B9GEM0 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9GEM0_POPTR Length = 64 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW SGY RFG+ ++DY+N LKRY K S KWF FLK+ Sbjct: 10 WSFLDDFEWGSGYGSRFGLFYIDYENNLKRYAKNSVKWFKQFLKK 54 [163][TOP] >UniRef100_B8A7Q2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8A7Q2_ORYSI Length = 472 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 483 SLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 S LDN+EW+ GYT RFG+ +VDYKNGL R+ K SA+WF+ FLK Sbjct: 419 SFLDNFEWAMGYTKRFGIVYVDYKNGLSRHPKASARWFSRFLK 461 [164][TOP] >UniRef100_A9SRY3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SRY3_PHYPA Length = 535 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW+ GYT RFGM +VDY N +R+ K SAKWF+ FL R Sbjct: 489 WSLMDNFEWAMGYTRRFGMLYVDYNNNQQRHLKESAKWFSRFLSR 533 [165][TOP] >UniRef100_A7R459 Chromosome undetermined scaffold_621, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R459_VITVI Length = 481 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EWS GYT RFG+ +VDY+N L R+ K SA WF FL+ Sbjct: 428 WSLLDNFEWSQGYTKRFGLVYVDYRNDLSRHPKSSALWFLRFLR 471 [166][TOP] >UniRef100_A7R1F9 Chromosome undetermined scaffold_351, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R1F9_VITVI Length = 262 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EWS GYT RFG+ +VDY+N L R+ K SA WF FL+ Sbjct: 209 WSLLDNFEWSQGYTKRFGLVYVDYRNDLSRHPKSSALWFLRFLR 252 [167][TOP] >UniRef100_Q41172 Linamarase n=1 Tax=Manihot esculenta RepID=Q41172_MANES Length = 531 Score = 67.4 bits (163), Expect = 5e-10 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WS LDN+EW+ GYT RFG+ +VDYKN L RY K SA WF FL Sbjct: 463 WSYLDNFEWNIGYTSRFGLYYVDYKNNLTRYPKKSAHWFTKFL 505 [168][TOP] >UniRef100_B9SY45 Beta-glucosidase, putative n=1 Tax=Ricinus communis RepID=B9SY45_RICCO Length = 495 Score = 67.4 bits (163), Expect = 5e-10 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WS+LDN+EW+SGYTVRFG+ +VDYKN L R K S +WF + L+ Sbjct: 447 WSVLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVQWFKSILR 490 [169][TOP] >UniRef100_B9F659 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9F659_ORYSJ Length = 521 Score = 67.4 bits (163), Expect = 5e-10 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW++GY+ RFG+ FVDYK+ LKRY K S +WF LK Sbjct: 477 WSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLK 520 [170][TOP] >UniRef100_B8AQS4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AQS4_ORYSI Length = 521 Score = 67.4 bits (163), Expect = 5e-10 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW++GY+ RFG+ FVDYK+ LKRY K S +WF LK Sbjct: 477 WSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLK 520 [171][TOP] >UniRef100_A7QRE5 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QRE5_VITVI Length = 65 Score = 67.4 bits (163), Expect = 5e-10 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDNY+W+S YT+RF + F+DY N LKR+ K SA WF FLK+ Sbjct: 21 WSLLDNYKWNSSYTLRFDIIFIDYDNNLKRHPKDSAMWFKKFLKK 65 [172][TOP] >UniRef100_Q9LU02 Beta-glucosidase 13 n=1 Tax=Arabidopsis thaliana RepID=BGL13_ARATH Length = 507 Score = 67.4 bits (163), Expect = 5e-10 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GY+VRFG+ +VD+ +G KRY K SAKWF L Sbjct: 459 WSLLDNFEWATGYSVRFGLVYVDFNDGRKRYPKKSAKWFRKLL 501 [173][TOP] >UniRef100_Q8L7J2 Beta-glucosidase 6 n=1 Tax=Oryza sativa Japonica Group RepID=BGL06_ORYSJ Length = 521 Score = 67.4 bits (163), Expect = 5e-10 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW++GY+ RFG+ FVDYK+ LKRY K S +WF LK Sbjct: 477 WSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLK 520 [174][TOP] >UniRef100_Q9FZE0 T1K7.7 protein n=2 Tax=Arabidopsis thaliana RepID=Q9FZE0_ARATH Length = 510 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GY+ RFG+ FVDY++ LKRY K S WF +FL Sbjct: 464 WSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKDSVHWFTSFL 506 [175][TOP] >UniRef100_Q7X9A9 Beta-primeverosidase n=1 Tax=Camellia sinensis RepID=Q7X9A9_CAMSI Length = 507 Score = 67.0 bits (162), Expect = 6e-10 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 W+ LDN+EW SGYT RFG+ +VD+K+GLKRY K SA WF FL Sbjct: 463 WAFLDNFEWLSGYTQRFGIVYVDFKDGLKRYPKHSALWFKKFL 505 [176][TOP] >UniRef100_Q6PW57 Beta-primeverosidase (Fragment) n=1 Tax=Camellia sinensis RepID=Q6PW57_CAMSI Length = 65 Score = 67.0 bits (162), Expect = 6e-10 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 W+ LDN+EW SGYT RFG+ +VD+K+GLKRY K SA WF FL Sbjct: 21 WAFLDNFEWLSGYTQRFGIVYVDFKDGLKRYPKHSALWFKKFL 63 [177][TOP] >UniRef100_Q56ZF5 Beta-glucosidase like protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q56ZF5_ARATH Length = 160 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GY+ RFG+ FVDY++ LKRY K S WF +FL Sbjct: 114 WSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKDSVHWFTSFL 156 [178][TOP] >UniRef100_B8A1R1 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B8A1R1_MAIZE Length = 480 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WS LDN+EW+ GYT RFG+ +VDYKNGL R+ K SA WF+ L+ Sbjct: 429 WSFLDNFEWAMGYTKRFGIVYVDYKNGLSRHPKASALWFSRLLR 472 [179][TOP] >UniRef100_A9SGD0 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SGD0_PHYPA Length = 492 Score = 67.0 bits (162), Expect = 6e-10 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW+ GYT RFG+ FVDY + KRY K SAKW++ FL R Sbjct: 446 WSLMDNFEWAMGYTRRFGLVFVDYDHDQKRYLKDSAKWYSRFLSR 490 [180][TOP] >UniRef100_Q9LIF9 Beta-glucosidase 19 n=1 Tax=Arabidopsis thaliana RepID=BGL19_ARATH Length = 527 Score = 67.0 bits (162), Expect = 6e-10 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSL+DN+EW GYT RFG+ ++D+KN L R +K SAKW + FLK Sbjct: 469 WSLMDNFEWQDGYTARFGVYYIDFKNNLTRMEKESAKWLSEFLK 512 [181][TOP] >UniRef100_O24524 Linamarase n=1 Tax=Manihot esculenta RepID=O24524_MANES Length = 507 Score = 66.6 bits (161), Expect = 8e-10 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WS LDN+EW+ GYT RFG+ +VDYKN L RY K SA WF FL Sbjct: 439 WSYLDNFEWNIGYTSRFGLYYVDYKNNLTRYPKESALWFTKFL 481 [182][TOP] >UniRef100_B8LQ52 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=B8LQ52_PICSI Length = 407 Score = 66.6 bits (161), Expect = 8e-10 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLD++EWSSGY RFG+ VDYK+ LKR+ K SA WF + L+R Sbjct: 363 WSLLDSFEWSSGYNYRFGLYHVDYKDNLKRHPKTSAHWFKHILQR 407 [183][TOP] >UniRef100_B8LQ09 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=B8LQ09_PICSI Length = 505 Score = 66.6 bits (161), Expect = 8e-10 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSLLDN+EW SGYT RFG+ +VD+ N LKRY K+SA WF+ L+R+ Sbjct: 461 WSLLDNFEWKSGYTSRFGVVYVDFTN-LKRYPKMSAYWFSKLLQRH 505 [184][TOP] >UniRef100_Q9FH03 Beta-glucosidase 12 n=1 Tax=Arabidopsis thaliana RepID=BGL12_ARATH Length = 507 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GY VRFG+ +VD+ G KRY K SAKWF L Sbjct: 459 WSLLDNFEWATGYAVRFGLVYVDFNGGRKRYPKKSAKWFKKLL 501 [185][TOP] >UniRef100_UPI0001984A08 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984A08 Length = 499 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW +G+ RFG+ +VDYKN LKRY K SA WF FL++ Sbjct: 455 WSFLDDFEWDAGFAFRFGLGYVDYKNDLKRYPKHSAYWFKKFLQK 499 [186][TOP] >UniRef100_C5WSU5 Putative uncharacterized protein Sb01g043030 n=1 Tax=Sorghum bicolor RepID=C5WSU5_SORBI Length = 508 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GY+ RFG+ FVDYK+ LKRY K S +WF L Sbjct: 463 WSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKTLL 505 [187][TOP] >UniRef100_C0P2D5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0P2D5_MAIZE Length = 150 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WS LDN+EW+ GYT RFG+ +VDYK+GL R+ K SA WF+ LK Sbjct: 98 WSFLDNFEWAMGYTKRFGIVYVDYKDGLSRHPKASALWFSRLLK 141 [188][TOP] >UniRef100_A7QRE7 Chromosome chr13 scaffold_149, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QRE7_VITVI Length = 481 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WS LD++EW +G+ RFG+ +VDYKN LKRY K SA WF FL++ Sbjct: 437 WSFLDDFEWDAGFAFRFGLGYVDYKNDLKRYPKHSAYWFKKFLQK 481 [189][TOP] >UniRef100_Q9ZT64 Beta-glucosidase n=1 Tax=Pinus contorta RepID=Q9ZT64_PINCO Length = 513 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GYT+RFG+ VD+ + KRY KLSA+WF FL+ Sbjct: 457 WSLLDNFEWAFGYTIRFGLYHVDFISDQKRYPKLSAQWFRQFLQ 500 [190][TOP] >UniRef100_Q1G3B5 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana RepID=Q1G3B5_ARATH Length = 168 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN+EW GY RFGM +VD+KN L+RY K S WF FL R Sbjct: 41 WSLFDNFEWEHGYNSRFGMYYVDFKNNLQRYPKDSVNWFKKFLSR 85 [191][TOP] >UniRef100_C6T8A2 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T8A2_SOYBN Length = 195 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WS D++EW +GYTVRFG+ +VDYKN LKRY K SA W FL Sbjct: 151 WSFSDSFEWDAGYTVRFGLIYVDYKNNLKRYPKFSAFWLQKFL 193 [192][TOP] >UniRef100_B9S3R8 Beta-glucosidase, putative n=1 Tax=Ricinus communis RepID=B9S3R8_RICCO Length = 519 Score = 65.9 bits (159), Expect = 1e-09 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WS LD++EW GYT RFG+ ++DY NGL+RY K SA WF FL+ Sbjct: 462 WSFLDDFEWDLGYTFRFGITYIDYTNGLQRYLKRSALWFKKFLQ 505 [193][TOP] >UniRef100_A0MDZ9 Putative uncharacterized protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=A0MDZ9_ARATH Length = 169 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN+EW GY RFGM +VD+KN L+RY K S WF FL R Sbjct: 41 WSLFDNFEWEHGYNSRFGMYYVDFKNNLQRYPKDSVNWFKKFLSR 85 [194][TOP] >UniRef100_Q8GXT2 Beta-glucosidase 29 n=1 Tax=Arabidopsis thaliana RepID=BGL29_ARATH Length = 590 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL DN+EW GY RFGM +VD+KN L+RY K S WF FL R Sbjct: 463 WSLFDNFEWEHGYNSRFGMYYVDFKNNLQRYPKDSVNWFKKFLSR 507 [195][TOP] >UniRef100_Q9SE50 Beta-glucosidase 18 n=1 Tax=Arabidopsis thaliana RepID=BGL18_ARATH Length = 528 Score = 65.9 bits (159), Expect = 1e-09 Identities = 23/44 (52%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSL+DN+EW GY RFG+ ++D++N L R++K+S KW++ FLK Sbjct: 473 WSLMDNFEWQDGYKARFGLYYIDFQNNLTRHQKVSGKWYSEFLK 516 [196][TOP] >UniRef100_UPI0001985544 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985544 Length = 503 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GY+VRFG+ FVDYKN L R K S +WF L+ Sbjct: 451 WSLLDNWEWNLGYSVRFGLYFVDYKNNLTRIPKTSVQWFRRILR 494 [197][TOP] >UniRef100_B9N6G1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N6G1_POPTR Length = 510 Score = 65.5 bits (158), Expect = 2e-09 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 W+ D++EW +GYTVRFGM ++D+KN LKRY K SA WF FL Sbjct: 466 WAFWDDFEWDAGYTVRFGMIYIDFKNNLKRYMKYSAYWFKMFL 508 [198][TOP] >UniRef100_B9N6G0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N6G0_POPTR Length = 510 Score = 65.5 bits (158), Expect = 2e-09 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 W+ D++EW +GYTVRFGM ++D+KN LKRY K SA WF FL Sbjct: 466 WAFWDDFEWDAGYTVRFGMIYIDFKNNLKRYMKYSAYWFKMFL 508 [199][TOP] >UniRef100_B9N6F8 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9N6F8_POPTR Length = 54 Score = 65.5 bits (158), Expect = 2e-09 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 W+ D++EW +GYTVRFGM ++D+KN LKRY K SA WF FL Sbjct: 10 WAFWDDFEWDAGYTVRFGMIYIDFKNNLKRYMKYSAYWFKMFL 52 [200][TOP] >UniRef100_B9MZ87 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZ87_POPTR Length = 522 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 W+ D++EW +GYT+RFG+ + DY++ L RY K S +WF NFLK Y Sbjct: 450 WTFADDFEWPNGYTIRFGLYYTDYQHNLHRYPKRSVQWFTNFLKGY 495 [201][TOP] >UniRef100_B9IE97 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IE97_POPTR Length = 514 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW GYT RFG+ +VDY N LKRY K+SA WF + L+R Sbjct: 468 WSLLDNFEWRLGYTSRFGIVYVDYSN-LKRYPKMSANWFKHLLER 511 [202][TOP] >UniRef100_A7P134 Chromosome chr19 scaffold_4, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7P134_VITVI Length = 504 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+ GY+VRFG+ FVDYKN L R K S +WF L+ Sbjct: 452 WSLLDNWEWNLGYSVRFGLYFVDYKNNLTRIPKTSVQWFRRILR 495 [203][TOP] >UniRef100_Q14QP8 Beta-glucosidase-like protein (Fragment) n=1 Tax=Camellia sinensis RepID=Q14QP8_CAMSI Length = 503 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWF 370 W+LLDN+EW SGYT RFG+ +VD+K+GLKRY K SA WF Sbjct: 463 WALLDNFEWLSGYTQRFGIVYVDFKDGLKRYPKDSALWF 501 [204][TOP] >UniRef100_C5Z877 Putative uncharacterized protein Sb10g027600 n=1 Tax=Sorghum bicolor RepID=C5Z877_SORBI Length = 511 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW+SGYTVRFG+ ++DY N L R K S +WF L Sbjct: 452 WSLLDNWEWNSGYTVRFGLYYIDYNNNLTRIPKASVEWFKQVL 494 [205][TOP] >UniRef100_C0HE98 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0HE98_MAIZE Length = 420 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW+SGYTVRFG+ ++DY N L R K S +WF L Sbjct: 361 WSLLDNWEWNSGYTVRFGLYYIDYNNNLTRIPKASVEWFRQVL 403 [206][TOP] >UniRef100_A9RBW1 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RBW1_PHYPA Length = 530 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW++GYTVRFG+ +VD+ N RY K SA WF LK Sbjct: 484 WSLLDNFEWATGYTVRFGLYYVDFDNDQARYPKASAFWFRKVLK 527 [207][TOP] >UniRef100_Q9SLA0 Beta-glucosidase 14 n=1 Tax=Arabidopsis thaliana RepID=BGL14_ARATH Length = 489 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW+SGYTVRFG+ +VD+ + KRY K SA WF + L Sbjct: 441 WSLLDNFEWASGYTVRFGLVYVDFNDRRKRYLKKSAHWFRHLL 483 [208][TOP] >UniRef100_A3RF67 Beta-glycosidase n=1 Tax=Dalbergia nigrescens RepID=A3RF67_9FABA Length = 547 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+ G+T RFG+NFV+Y L RY KLSA WF FL R Sbjct: 468 WSLLDNFEWNEGFTSRFGLNFVNYTT-LTRYHKLSATWFKYFLAR 511 [209][TOP] >UniRef100_B2W4C3 Beta-glucosidase n=1 Tax=Pyrenophora tritici-repentis Pt-1C-BFP RepID=B2W4C3_PYRTR Length = 480 Score = 64.3 bits (155), Expect = 4e-09 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSL+DN+EW+ GYT RFG+ +VDYK G KRY K SA+ + ++Y Sbjct: 431 WSLMDNFEWAEGYTTRFGVTYVDYKGGQKRYPKKSAREISKIFEKY 476 [210][TOP] >UniRef100_Q94HQ6 Putative beta-glucosidase n=1 Tax=Oryza sativa RepID=Q94HQ6_ORYSA Length = 515 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GYT RFG+ +VDYKN KRY K S +WF N L Sbjct: 470 WSLLDNWEWAAGYTSRFGLYYVDYKN-RKRYPKNSVQWFKNLL 511 [211][TOP] >UniRef100_Q339X2 Os10g0323500 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q339X2_ORYSJ Length = 510 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GYT RFG+ +VDYKN KRY K S +WF N L Sbjct: 465 WSLLDNWEWAAGYTSRFGLYYVDYKN-RKRYPKNSVQWFKNLL 506 [212][TOP] >UniRef100_Q2MV12 Beta-mannosidase 3 n=1 Tax=Oncidium Gower Ramsey RepID=Q2MV12_ONCHC Length = 491 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW SGYT RFG+ +VD+K LKRY K+SA WF + L++ Sbjct: 446 WSLLDNFEWKSGYTSRFGIVYVDFKT-LKRYPKMSAYWFRDVLQK 489 [213][TOP] >UniRef100_Q2MV10 Beta-mannosidase 1 n=1 Tax=Oncidium Gower Ramsey RepID=Q2MV10_ONCHC Length = 491 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW SGYT RFG+ +VD+K LKRY K+SA WF + L++ Sbjct: 446 WSLLDNFEWKSGYTSRFGIVYVDFKT-LKRYPKMSAYWFRDVLQK 489 [214][TOP] >UniRef100_C5YC17 Putative uncharacterized protein Sb06g022450 n=1 Tax=Sorghum bicolor RepID=C5YC17_SORBI Length = 515 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSLLDN+EW+SGYT RFG+ VD+K KR KLSAKW++ FLK Sbjct: 455 WSLLDNFEWNSGYTQRFGLYHVDFKT-QKRTPKLSAKWYSEFLK 497 [215][TOP] >UniRef100_C5YC14 Putative uncharacterized protein Sb06g022420 n=1 Tax=Sorghum bicolor RepID=C5YC14_SORBI Length = 817 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLK 355 WSL+DN+EW SGYT ++G+ +VD+K+ LKR KLSAKW++ F+K Sbjct: 757 WSLMDNFEWLSGYTTKYGLYYVDFKS-LKRTPKLSAKWYSKFIK 799 [216][TOP] >UniRef100_B8BG74 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BG74_ORYSI Length = 510 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GYT RFG+ +VDYKN KRY K S +WF N L Sbjct: 465 WSLLDNWEWAAGYTSRFGLYYVDYKN-RKRYPKNSVQWFKNLL 506 [217][TOP] >UniRef100_O48779-2 Isoform 2 of Beta-glucosidase 33 n=1 Tax=Arabidopsis thaliana RepID=O48779-2 Length = 613 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY*TL 340 WSL+DN+EW GY VRFG+ +VDY + +KRY + S KW + FL TL Sbjct: 528 WSLMDNFEWDKGYKVRFGLYYVDYNDNMKRYIRSSGKWLSEFLDSKETL 576 [218][TOP] >UniRef100_O48779 Beta-glucosidase 33 n=1 Tax=Arabidopsis thaliana RepID=BGL33_ARATH Length = 614 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY*TL 340 WSL+DN+EW GY VRFG+ +VDY + +KRY + S KW + FL TL Sbjct: 529 WSLMDNFEWDKGYKVRFGLYYVDYNDNMKRYIRSSGKWLSEFLDSKETL 577 [219][TOP] >UniRef100_Q9C8Y9 Beta-glucosidase 22 n=1 Tax=Arabidopsis thaliana RepID=BGL22_ARATH Length = 524 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW GY RFG+ +VD+KN L RY+K SAK++ +FL Sbjct: 468 WSLLDNFEWQDGYNNRFGLYYVDFKNNLTRYEKESAKYYKDFL 510 [220][TOP] >UniRef100_Q9C525-2 Isoform 2 of Beta-glucosidase 21 n=1 Tax=Arabidopsis thaliana RepID=Q9C525-2 Length = 522 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW GY RFG+ +VD+KN L RY+K SAK++ +FL Sbjct: 466 WSLLDNFEWQDGYKNRFGLYYVDFKNNLTRYEKESAKYYKDFL 508 [221][TOP] >UniRef100_Q9C525 Beta-glucosidase 21 n=1 Tax=Arabidopsis thaliana RepID=BGL21_ARATH Length = 524 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW GY RFG+ +VD+KN L RY+K SAK++ +FL Sbjct: 468 WSLLDNFEWQDGYKNRFGLYYVDFKNNLTRYEKESAKYYKDFL 510 [222][TOP] >UniRef100_Q9SPK3 Dalcochinin 8'-O-beta-glucoside beta-glucosidase n=1 Tax=Dalbergia cochinchinensis RepID=Q9SPK3_9FABA Length = 547 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW+ GYT RFG+ FV+Y L RY KLSA WF FL R Sbjct: 468 WSLLDNFEWAEGYTSRFGLYFVNYTT-LNRYPKLSATWFKYFLAR 511 [223][TOP] >UniRef100_Q93XR2 Cyanogenic beta-glucosidase dhurrinase-2 n=1 Tax=Sorghum bicolor RepID=Q93XR2_SORBI Length = 571 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANF 361 WSLLDN+EWSSGYT RFG+ +VD +NG KR K SA+W F Sbjct: 503 WSLLDNFEWSSGYTERFGIVYVDRENGCKRTLKRSARWLKEF 544 [224][TOP] >UniRef100_C5YTW1 Putative uncharacterized protein Sb08g007610 n=1 Tax=Sorghum bicolor RepID=C5YTW1_SORBI Length = 310 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANF 361 WSLLDN+EWSSGYT RFG+ +VD +NG KR K SA+W F Sbjct: 242 WSLLDNFEWSSGYTERFGIVYVDRENGCKRTLKRSARWLKEF 283 [225][TOP] >UniRef100_Q0U9G8 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0U9G8_PHANO Length = 481 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSL+DN+EW+ GYT RFG+ +VDYK G KRY K SA + ++Y Sbjct: 432 WSLMDNFEWAEGYTTRFGVTYVDYKGGQKRYPKKSAYEISKIFEKY 477 [226][TOP] >UniRef100_Q9SX92 F16N3.11 protein n=1 Tax=Arabidopsis thaliana RepID=Q9SX92_ARATH Length = 496 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DNYE+ +GYT+RFGMN+V++ N R +K S KWF+ FL + Sbjct: 452 WSLMDNYEFGNGYTLRFGMNWVNFTNPADRKEKASGKWFSKFLAK 496 [227][TOP] >UniRef100_Q9C8J9 Myrosinase, putative; 53323-50499 n=1 Tax=Arabidopsis thaliana RepID=Q9C8J9_ARATH Length = 465 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DNYE+ +GYT+RFGMN+V++ N R +K S KWF+ FL + Sbjct: 421 WSLMDNYEFGNGYTLRFGMNWVNFTNPADRKEKASGKWFSKFLAK 465 [228][TOP] >UniRef100_Q8VWL8 Beta-mannosidase n=1 Tax=Solanum lycopersicum RepID=Q8VWL8_SOLLC Length = 514 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW GYT RFG+ +VD+ N L+RY K+SA WF LKR Sbjct: 468 WSLLDNFEWRLGYTSRFGIVYVDF-NTLRRYPKMSAYWFKKLLKR 511 [229][TOP] >UniRef100_Q8GRX1 Beta-thioglucoside glucohydrolase n=1 Tax=Arabidopsis thaliana RepID=Q8GRX1_ARATH Length = 511 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DNYE+ +GYT+RFGMN+V++ N R +K S KWF+ FL + Sbjct: 467 WSLMDNYEFGNGYTLRFGMNWVNFTNPADRKEKASGKWFSKFLAK 511 [230][TOP] >UniRef100_Q42249 Glucosidase-beta (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q42249_ARATH Length = 74 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW GY RFG+ +VD+KN L RY+K S K++ +FL + Sbjct: 18 WSLLDNFEWQDGYKNRFGLYYVDFKNNLTRYEKESGKYYKDFLSQ 62 [231][TOP] >UniRef100_Q3ECS3 Beta-thioglucoside glucohydrolase n=1 Tax=Arabidopsis thaliana RepID=Q3ECS3_ARATH Length = 511 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DNYE+ +GYT+RFGMN+V++ N R +K S KWF+ FL + Sbjct: 467 WSLMDNYEFGNGYTLRFGMNWVNFTNPADRKEKASGKWFSKFLAK 511 [232][TOP] >UniRef100_B6SYH1 Non-cyanogenic beta-glucosidase n=1 Tax=Zea mays RepID=B6SYH1_MAIZE Length = 557 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANF 361 WSLLDN+EWSSGYT R+G+ +VD +G +RY K SAKW F Sbjct: 501 WSLLDNFEWSSGYTERYGIIYVDRDDGYRRYLKRSAKWLREF 542 [233][TOP] >UniRef100_B6SUH6 Non-cyanogenic beta-glucosidase n=1 Tax=Zea mays RepID=B6SUH6_MAIZE Length = 497 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANF 361 WSLLDN+EWSSGYT R+G+ +VD +G +RY K SAKW F Sbjct: 441 WSLLDNFEWSSGYTERYGIIYVDRDDGYRRYLKRSAKWLREF 482 [234][TOP] >UniRef100_Q9SR37 Beta-glucosidase 23 n=1 Tax=Arabidopsis thaliana RepID=BGL23_ARATH Length = 524 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW GY RFG+ +VD+KN L RY+K S K++ +FL + Sbjct: 468 WSLLDNFEWQDGYKNRFGLYYVDFKNNLTRYEKESGKYYKDFLSQ 512 [235][TOP] >UniRef100_Q75W17 Furcatin hydrolase n=1 Tax=Viburnum furcatum RepID=Q75W17_9DIPS Length = 538 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWF 370 WSLLD++EW+SG+ VRFG+ ++D+++GLKRY K SA WF Sbjct: 494 WSLLDDWEWNSGFNVRFGIVYIDHEDGLKRYLKYSALWF 532 [236][TOP] >UniRef100_Q5EMV2 Lactase-phlorizin hydrolase-like protein n=1 Tax=Magnaporthe grisea RepID=Q5EMV2_MAGGR Length = 476 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAK 376 WSL+DN+EW+ GY RFG+ FVDY+NG KRY K SAK Sbjct: 427 WSLMDNFEWAEGYETRFGVTFVDYENGQKRYPKKSAK 463 [237][TOP] >UniRef100_Q84L69 P66 protein n=1 Tax=Hevea brasiliensis RepID=Q84L69_HEVBR Length = 527 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WS LDN+EW+ GYT RFG+ +VDYK L R K SA WFA FL Sbjct: 460 WSYLDNFEWNIGYTSRFGLFYVDYKKNLTRIPKSSAFWFAAFL 502 [238][TOP] >UniRef100_Q41290 Dhurrinase n=1 Tax=Sorghum bicolor RepID=Q41290_SORBI Length = 565 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANF 361 WSLLDN+EWSSGYT RFG+ +VD +NG +R K SA+W F Sbjct: 504 WSLLDNFEWSSGYTERFGIVYVDRENGCERTMKRSARWLQEF 545 [239][TOP] >UniRef100_Q2MV11 Beta-mannosidase 2 n=1 Tax=Oncidium Gower Ramsey RepID=Q2MV11_ONCHC Length = 501 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSLLDN+EW GYT RFG+ +VD+K LKRY K+SA WF + L++ Sbjct: 456 WSLLDNFEWKLGYTSRFGIVYVDFKT-LKRYPKMSAYWFKDVLQK 499 [240][TOP] >UniRef100_C9WCP9 Beta-thioglucoside glucohydrolase n=1 Tax=Arabidopsis thaliana RepID=C9WCP9_ARATH Length = 512 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/45 (53%), Positives = 35/45 (77%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DNYE+ +GYT+RFGMN+V++ N R +K S KWF+ F+ + Sbjct: 468 WSLMDNYEFGNGYTLRFGMNWVNFTNPADRREKASGKWFSRFIAK 512 [241][TOP] >UniRef100_C5YTV7 Putative uncharacterized protein Sb08g007586 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5YTV7_SORBI Length = 567 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANF 361 WSLLDN+EWSSGYT R+G+ ++D +NG +R K SA+WF F Sbjct: 506 WSLLDNFEWSSGYTERYGIVYLDRENGCERTMKRSARWFQEF 547 [242][TOP] >UniRef100_C5YTV4 Putative uncharacterized protein Sb08g007570 n=1 Tax=Sorghum bicolor RepID=C5YTV4_SORBI Length = 565 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANF 361 WSLLDN+EWSSGYT RFG+ +VD +NG +R K SA+W F Sbjct: 504 WSLLDNFEWSSGYTERFGIVYVDRENGCERTMKRSARWLQEF 545 [243][TOP] >UniRef100_C5YC09 Putative uncharacterized protein Sb06g022385 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5YC09_SORBI Length = 378 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/46 (54%), Positives = 37/46 (80%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKRY 349 WSL+D +EW+SGYT ++G+ VD+K+ LKR +LSAKW++ F+K Y Sbjct: 318 WSLMDTFEWNSGYTAKYGLFHVDFKS-LKRTPRLSAKWYSKFIKGY 362 [244][TOP] >UniRef100_C5X3X5 Putative uncharacterized protein Sb02g028400 n=1 Tax=Sorghum bicolor RepID=C5X3X5_SORBI Length = 505 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 W+ +D +EW GY RFG+ F+D NGLKRY+K S+ W NFLKR Sbjct: 461 WTFMDCFEWGDGYLDRFGLIFIDRLNGLKRYRKESSYWIQNFLKR 505 [245][TOP] >UniRef100_B8A0L0 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B8A0L0_MAIZE Length = 420 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKW 373 WSLLDN+EW+SGYTVRFG+ ++DY N L R K S +W Sbjct: 361 WSLLDNWEWNSGYTVRFGLYYIDYNNNLTRIPKASVEW 398 [246][TOP] >UniRef100_A1E2C0 Beta glucosidase n=1 Tax=Hevea brasiliensis RepID=A1E2C0_HEVBR Length = 527 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WS LDN+EW+ GYT RFG+ +VDYK L R K SA WFA FL Sbjct: 460 WSYLDNFEWNIGYTSRFGLFYVDYKKNLTRIPKSSAFWFAAFL 502 [247][TOP] >UniRef100_UPI00019856F7 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019856F7 Length = 576 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GY++RFG+ +VDYK L R K S+KW+ +FL Sbjct: 504 WSLLDNFEWTNGYSIRFGLYYVDYKT-LCRIPKFSSKWYTSFL 545 [248][TOP] >UniRef100_Q0D407 Os07g0656200 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=Q0D407_ORYSJ Length = 331 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW GYT RFG+ +VDYK LKRY K SA WF N L Sbjct: 284 WSLLDNFEWRLGYTSRFGIVYVDYKT-LKRYPKDSAFWFKNML 325 [249][TOP] >UniRef100_C5YC18 Putative uncharacterized protein Sb06g022460 n=1 Tax=Sorghum bicolor RepID=C5YC18_SORBI Length = 522 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFL 358 WSLLDN+EW++GYT RFG+ +VDY N KR KLS KW+ FL Sbjct: 457 WSLLDNFEWNNGYTQRFGLYYVDY-NTQKRTPKLSTKWYREFL 498 [250][TOP] >UniRef100_B9T4F7 Beta-glucosidase, putative n=1 Tax=Ricinus communis RepID=B9T4F7_RICCO Length = 517 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 486 WSLLDNYEWSSGYTVRFGMNFVDYKNGLKRYKKLSAKWFANFLKR 352 WSL+DN+EW SGYT RFG+ +VD+ LKRY K+SA WF L+R Sbjct: 471 WSLVDNFEWRSGYTSRFGIVYVDFTT-LKRYPKMSAYWFKQMLQR 514