[UP]
[1][TOP] >UniRef100_B0R0R1 Novel protein similar to human Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 (RAPH1) n=1 Tax=Danio rerio RepID=B0R0R1_DANRE Length = 1486 Score = 30.4 bits (67), Expect(4) = 6e-06 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 194 PPPPPPPPPL 223 PPPPPPPPPL Sbjct: 987 PPPPPPPPPL 996 Score = 29.3 bits (64), Expect(4) = 6e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 Query: 182 KRGIPPPPPPPPP 220 + PPPPPPPPP Sbjct: 981 QNNFPPPPPPPPP 993 Score = 26.6 bits (57), Expect(4) = 6e-06 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 197 PPPPPPPPLL 226 PPPPPPPP L Sbjct: 1012 PPPPPPPPPL 1021 Score = 24.6 bits (52), Expect(4) = 6e-06 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 80 PPKQDSIPSFLSQLPIGTICFQASELVKEEWL*KKRGIPPPPP 208 PP + S P T+ FQ+ L + G+PPPPP Sbjct: 912 PPPLVQMQSQPMPPPPPTVSFQSQPLPPPPPPLQANGLPPPPP 954