[UP]
[1][TOP] >UniRef100_A6RXS7 Putative uncharacterized protein n=1 Tax=Botryotinia fuckeliana B05.10 RepID=A6RXS7_BOTFB Length = 197 Score = 61.2 bits (147), Expect(2) = 1e-13 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 GGGG+GGGRGGGGYGG G GGYGGGG G D+ N+ Y Sbjct: 97 GGGGFGGGRGGGGYGGRGGGGYGGGGGGYGGGRGYDNNNSGGGY 140 Score = 38.5 bits (88), Expect(2) = 1e-13 Identities = 18/24 (75%), Positives = 19/24 (79%), Gaps = 2/24 (8%) Frame = +3 Query: 276 FPGGNGGGGY-GAGGGGY-GGGGY 341 + GG GGGGY G GGGGY GGGGY Sbjct: 158 YNGGGGGGGYSGGGGGGYSGGGGY 181 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/34 (70%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGY-GGGGYGEANTG 121 GGGGY GG GGGGY GGG GGY GGGGY +G Sbjct: 154 GGGGYNGGGGGGGYSGGGGGGYSGGGGYDRNQSG 187 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGG-GYGEANTGSADS 133 GGGGYGG RGGGGYGGGG GGYGGG GY N+G S Sbjct: 106 GGGGYGG-RGGGGYGGGG-GGYGGGRGYDNNNSGGGYS 141 [2][TOP] >UniRef100_A8IZS5 Glycine-rich RNA-binding protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8IZS5_CHLRE Length = 165 Score = 69.7 bits (169), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGGYGGGRGGGGYGGGGSGGYGGGGYG Sbjct: 119 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 146 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG G GGYGGGG GG GGGGYG G Sbjct: 128 GGGGYGGG-GSGGYGGGGYGGNGGGGYGAGGGG 159 [3][TOP] >UniRef100_UPI0000E7FF28 PREDICTED: similar to zinc-finger homeodomain protein 4 isoform 2 n=1 Tax=Gallus gallus RepID=UPI0000E7FF28 Length = 3618 Score = 47.4 bits (111), Expect(2) = 8e-10 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 28 +Q + L +P P PP PP PPPP PPPP PP PP Sbjct: 2017 IQNTTPTPLQAPPPTPPPPPPPPPPPPPPPPPPSAPP 2053 Score = 39.3 bits (90), Expect(2) = 8e-10 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLP--PGKIGRRKTCQAT 245 PPPP PPPP P PPPP P P G K T Sbjct: 1989 PPPPPPPPPPPPPPPPTPSQPSSAGAGKIQNTT 2021 [4][TOP] >UniRef100_O73590 Zinc finger homeobox protein 4 n=1 Tax=Gallus gallus RepID=ZFHX4_CHICK Length = 3573 Score = 47.4 bits (111), Expect(2) = 8e-10 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 28 +Q + L +P P PP PP PPPP PPPP PP PP Sbjct: 1972 IQNTTPTPLQAPPPTPPPPPPPPPPPPPPPPPPSAPP 2008 Score = 39.3 bits (90), Expect(2) = 8e-10 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLP--PGKIGRRKTCQAT 245 PPPP PPPP P PPPP P P G K T Sbjct: 1944 PPPPPPPPPPPPPPPPTPSQPSSAGAGKIQNTT 1976 [5][TOP] >UniRef100_A0NCZ0 AGAP001055-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A0NCZ0_ANOGA Length = 208 Score = 51.2 bits (121), Expect(2) = 4e-09 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 157 GGGG GGG GGGG GGGG GG GGGG G G + W Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGPGGGGWGGW 106 Score = 33.1 bits (74), Expect(2) = 4e-09 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 6/43 (13%) Frame = +3 Query: 279 PGGNGGGGY------GAGGGGYGGGGY*ARG*SQRTSCRSTRH 389 PGG G GG+ G GGGG GGGG G Q + + +H Sbjct: 98 PGGGGWGGWRGRGAGGGGGGGGGGGGGGGGGGGQIRTYSNNKH 140 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +2 Query: 5 HVLLCVGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 HV+ VGGGG GG GGGG GGGG GG GGGG G G Sbjct: 11 HVVRVVGGGGNSGGGGGGGGGGGGGGGGGGGGGGGGGGG 49 [6][TOP] >UniRef100_A1WE85 RNP-1 like RNA-binding protein n=1 Tax=Verminephrobacter eiseniae EF01-2 RepID=A1WE85_VEREI Length = 175 Score = 49.3 bits (116), Expect(2) = 4e-09 Identities = 27/50 (54%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = +2 Query: 23 GGGGYGGGRGGG--GYGGG----GSGGYGGGGYGEANTGSADSCNARFDY 154 GGGGYGGG GGG GYGGG G GGYGGG G G R Y Sbjct: 101 GGGGYGGGGGGGRSGYGGGREGGGGGGYGGGREGGGYGGGRSEGGFRSPY 150 Score = 35.0 bits (79), Expect(2) = 4e-09 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 261 FLLPIFPGGNGGGGYGAGGGGYGGG 335 F P G GGG G GGGGYGGG Sbjct: 146 FRSPYGSGNRSGGGGGRGGGGYGGG 170 [7][TOP] >UniRef100_C5Z659 Putative uncharacterized protein Sb10g024405 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5Z659_SORBI Length = 118 Score = 48.1 bits (113), Expect(2) = 6e-09 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 G GG GGG GGGG GGGG GGY G G G G D R +Y Sbjct: 21 GEGGGGGGGGGGGGGGGGGGGY-GHGRGRGTIGGGDGDKGRGNY 63 Score = 35.8 bits (81), Expect(2) = 6e-09 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +3 Query: 270 PIFPGGNGGGGYGAGGGGYGGGG 338 P PGG GGG G GGGG GGGG Sbjct: 89 PGAPGGLDGGGGGRGGGGGGGGG 111 [8][TOP] >UniRef100_A8MUW5 Putative uncharacterized protein FAM98B n=1 Tax=Homo sapiens RepID=A8MUW5_HUMAN Length = 433 Score = 51.6 bits (122), Expect(2) = 7e-09 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 23 GGGGYGGGRG--GGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 GGGG GGGRG GGG GG G GG GGGG+G G R DY Sbjct: 348 GGGGGGGGRGGWGGGGGGWGGGGGGGGGWGGGGGGGRGGFQGRGDY 393 Score = 32.0 bits (71), Expect(2) = 7e-09 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGY 326 + GG GGGG G GGGGY Sbjct: 414 YGGGGGGGGGGGGGGGY 430 [9][TOP] >UniRef100_B9R282 'Cold-shock' DNA-binding domain protein n=1 Tax=Labrenzia alexandrii DFL-11 RepID=B9R282_9RHOB Length = 307 Score = 49.7 bits (117), Expect(2) = 7e-09 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 23 GGGGYGGGRGG-GGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 G GGYGGG G GGYGGG GGYGGGG G G R Y Sbjct: 107 GRGGYGGGGGREGGYGGGDRGGYGGGGGGGGRDGGGYGGGGRGGY 151 Score = 33.9 bits (76), Expect(2) = 7e-09 Identities = 21/47 (44%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +3 Query: 276 FPGGNGG--GGYGAGGGGYGGGGY*ARG*SQRTSCRSTRHVEEPSRE 410 + GG GG GGYG GGGG GG G R R R VE R+ Sbjct: 169 YGGGGGGRDGGYGGGGGGRGGFGGGNREGGDRPPRRDYPPVERGPRQ 215 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSAD 130 GGGG GGGR GGGYGGGG GGYGGGG E G D Sbjct: 130 GGGGGGGGRDGGGYGGGGRGGYGGGGSREGGYGGGD 165 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSAD 130 G GG GGGR GGGYGGGG GGYGGGG E G D Sbjct: 90 GYGGGGGGRDGGGYGGGGRGGYGGGGGREGGYGGGD 125 [10][TOP] >UniRef100_UPI000186D45B RNA-binding protein cabeza, putative n=1 Tax=Pediculus humanus corporis RepID=UPI000186D45B Length = 424 Score = 53.1 bits (126), Expect(2) = 8e-09 Identities = 26/52 (50%), Positives = 29/52 (55%) Frame = +2 Query: 20 VGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWVTSA*C 175 +GGGG GGG GGGG GGGG GG GGGG G G D+ T+ C Sbjct: 284 MGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGKGGFGRDGDWKCTNISC 335 Score = 30.0 bits (66), Expect(2) = 8e-09 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 282 GGNGGGGYGAGGGGYGGGGY*ARG 353 GG GGG G GGG GGG RG Sbjct: 372 GGRPGGGRGGPGGGRGGGDRGFRG 395 [11][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/63 (47%), Positives = 33/63 (52%), Gaps = 5/63 (7%) Frame = -2 Query: 195 CTRPKTQH-----QADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*P 31 CT KT H QA + +P+ P PPPP PP PPPP PPPP PPP P Sbjct: 16 CTNAKTLHDTIKRQAGCAAPCPAVCAPACQPICCVPAPPPPPPPPPPPPPPPPPPPPPPP 75 Query: 30 PPP 22 PPP Sbjct: 76 PPP 78 [12][TOP] >UniRef100_B4KKP9 GI17825 n=1 Tax=Drosophila mojavensis RepID=B4KKP9_DROMO Length = 552 Score = 48.9 bits (115), Expect(2) = 1e-08 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 GGG +GGG GGGGYGGGG G GGGY +G+A S +F + Sbjct: 402 GGGKFGGGFGGGGYGGGGKHGGLGGGY----SGAAASALPQFGF 441 Score = 33.9 bits (76), Expect(2) = 1e-08 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 270 PIFPGGNGGGGYGAGGGGYGGGG 338 P F G GGGYG GGGYGG G Sbjct: 444 PGFGGPGFGGGYGGFGGGYGGFG 466 [13][TOP] >UniRef100_B9HZ67 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HZ67_POPTR Length = 150 Score = 46.2 bits (108), Expect(2) = 1e-08 Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +2 Query: 23 GGGGYGGGRG----GGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 GG G+GGG G GGG GGGG GG GGGG G G + F + Sbjct: 54 GGAGFGGGAGKGRLGGGGGGGGGGGGGGGGGGGGGGGGKKGGGSGFGF 101 Score = 36.6 bits (83), Expect(2) = 1e-08 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGGGGY*ARG 353 F G GGGG G GGGG GGGG ++G Sbjct: 105 FGSGGGGGGGGGGGGGGGGGGGDSQG 130 [14][TOP] >UniRef100_O70133-2 Isoform 2 of ATP-dependent RNA helicase A n=1 Tax=Mus musculus RepID=O70133-2 Length = 1381 Score = 58.2 bits (139), Expect(2) = 1e-08 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +2 Query: 20 VGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 VGGGGYGGG GGGGYGGG SGGYGGGGYG S + R +Y Sbjct: 1274 VGGGGYGGG-GGGGYGGG-SGGYGGGGYGGGEGYSISPNSYRGNY 1316 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGG 332 + G GGGG G GG GG Sbjct: 1312 YRGNYGGGGGGYRGGSQGG 1330 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 121 GGGG+GGGRGGGG G GGSGG+ GGGGYG G Sbjct: 1244 GGGGFGGGRGGGGGGFGGSGGFGNGGGGYGVGGGG 1278 [15][TOP] >UniRef100_O70133 ATP-dependent RNA helicase A n=2 Tax=Mus musculus RepID=DHX9_MOUSE Length = 1380 Score = 58.2 bits (139), Expect(2) = 1e-08 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +2 Query: 20 VGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 VGGGGYGGG GGGGYGGG SGGYGGGGYG S + R +Y Sbjct: 1273 VGGGGYGGG-GGGGYGGG-SGGYGGGGYGGGEGYSISPNSYRGNY 1315 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGG 332 + G GGGG G GG GG Sbjct: 1311 YRGNYGGGGGGYRGGSQGG 1329 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 121 GGGG+GGGRGGGG G GGSGG+ GGGGYG G Sbjct: 1243 GGGGFGGGRGGGGGGFGGSGGFGNGGGGYGVGGGG 1277 [16][TOP] >UniRef100_B6UB95 Glycine-rich RNA-binding protein 7 n=1 Tax=Zea mays RepID=B6UB95_MAIZE Length = 252 Score = 53.5 bits (127), Expect(2) = 1e-08 Identities = 26/46 (56%), Positives = 28/46 (60%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWV 160 GGGGYGGG GG G GGG GG GGGGYG + G + DY V Sbjct: 126 GGGGYGGGGGGYGGGGGYGGGGGGGGYGGGDYGGNRNRGGGGDYGV 171 Score = 28.9 bits (63), Expect(2) = 1e-08 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 282 GGNGGGGYGAGGGGYGGGGY 341 GGNG GG+ A GG G G+ Sbjct: 199 GGNGAGGFDATGGSTGDDGF 218 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGR--GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG G GGGGYG G Sbjct: 115 GGGGYGGGGYGGGGGYGGGGGGYGGGGGYGGGGGG 149 [17][TOP] >UniRef100_B9RXJ1 Glycine-rich RNA-binding protein, putative n=1 Tax=Ricinus communis RepID=B9RXJ1_RICCO Length = 145 Score = 48.9 bits (115), Expect(2) = 2e-08 Identities = 23/45 (51%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +2 Query: 23 GGGGYGGGRGGG-GYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 GG G+GGG GGG GYG GG GG GGGG G +G F + Sbjct: 59 GGSGFGGGAGGGYGYGNGGLGGGGGGGSGGEGSGFGGGFGGGFGF 103 Score = 33.5 bits (75), Expect(2) = 2e-08 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGGGG 338 F GG G GG G GGGG GGGG Sbjct: 97 FGGGFGFGGGGIGGGGGGGGG 117 [18][TOP] >UniRef100_B6TI13 Glycine-rich RNA-binding protein 7 n=1 Tax=Zea mays RepID=B6TI13_MAIZE Length = 276 Score = 53.1 bits (126), Expect(2) = 2e-08 Identities = 26/46 (56%), Positives = 28/46 (60%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWV 160 GGGGYGGG GG G GGG GG GGGGYG + G + DY V Sbjct: 126 GGGGYGGGGGGYGGGGGYGGGGGGGGYGGGDYGGNRNRGGVGDYGV 171 Score = 28.9 bits (63), Expect(2) = 2e-08 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 282 GGNGGGGYGAGGGGYGGGGY 341 GGNG GG+ A GG G G+ Sbjct: 199 GGNGAGGFDATGGSTGDDGF 218 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGR--GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG G GGGGYG G Sbjct: 115 GGGGYGGGGYGGGGGYGGGGGGYGGGGGYGGGGGG 149 [19][TOP] >UniRef100_A8NYE9 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8NYE9_BRUMA Length = 145 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEA-NTGSADSCNARFDY 154 GGGG GG GGGYGGGG GG GGGYG G + +DY Sbjct: 52 GGGGSAGGGAGGGYGGGGGGGGYGGGYGGGYGGGGGYAYQQEYDY 96 Score = 31.6 bits (70), Expect(2) = 2e-08 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGGGG 338 + G GGGG G GGG GGGG Sbjct: 96 YGSGGGGGGGGGVGGGGGGGG 116 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGGGSGGYGGGG 100 GGGYGGG GGGGYGGG GGYGGGG Sbjct: 62 GGGYGGGGGGGGYGGGYGGGYGGGG 86 [20][TOP] >UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XP48_SORBI Length = 109 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG GGYGGGG G G Sbjct: 41 GGGGYGGGGGGGGYGGGGGGGYGGGGGGGRGGG 73 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG GG GGGG G G Sbjct: 50 GGGGYGGG-GGGGYGGGGGGGRGGGGGGFGGGG 81 [21][TOP] >UniRef100_Q5M7R7 Splicing factor 1 n=2 Tax=Xenopus (Silurana) tropicalis RepID=Q5M7R7_XENTR Length = 571 Score = 44.7 bits (104), Expect(2) = 2e-08 Identities = 27/71 (38%), Positives = 32/71 (45%), Gaps = 8/71 (11%) Frame = -2 Query: 210 TFAATCTRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPP------ 49 T + T + P Q Q Q + + P L +P PP PP PPP PPPP Sbjct: 472 TASGTASLPPWQQQ----QQGAGSSTSNTSPQLQTPGVQPPLPPSAPPPPPPPPPGTSGL 527 Query: 48 --RPPP*PPPP 22 PPP PPPP Sbjct: 528 LYAPPPPPPPP 538 Score = 37.0 bits (84), Expect(2) = 2e-08 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPPG 278 PPPP PPP P PPPP P G Sbjct: 423 PPPPPPPPSGPAPPPPPPSG 442 [22][TOP] >UniRef100_UPI0001B4C7B1 single-stranded DNA-binding protein n=1 Tax=Streptomyces hygroscopicus ATCC 53653 RepID=UPI0001B4C7B1 Length = 196 Score = 47.8 bits (112), Expect(2) = 2e-08 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGG-GYGEANTGSADSCNARFDYWVTSA 169 G GG GG GGGG GGGG GG+GGG G G+ G A + D W T A Sbjct: 122 GRGGQGGYGGGGGQGGGGGGGWGGGPGGGQQQGGGAPA----DDPWATGA 167 Score = 33.9 bits (76), Expect(2) = 2e-08 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 282 GGNGGGGYGAGGGGYGGGGY 341 GG GGGG G GGG GGGY Sbjct: 171 GGQGGGGGGWGGGSGSGGGY 190 [23][TOP] >UniRef100_A3PA60 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9301 RepID=A3PA60_PROM0 Length = 217 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG--GSGGYGGGGYGEANTGSADS 133 GGGGYGGG GGGYGGG G GGYGGGGYG G +S Sbjct: 118 GGGGYGGGNSGGGYGGGGYGGGGYGGGGYGGGGYGGGNS 156 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 6/38 (15%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGGG------SGGYGGGGYGEANTG 121 GGGYGGG GGGYGGGG GGYGGGGYG N+G Sbjct: 91 GGGYGGGNSGGGYGGGGYGGGNSGGGYGGGGYGGGNSG 128 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 6/39 (15%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGG------SGGYGGGGYGEANTG 121 GGGGYGGG GGGYGGGG GGYGGGGYG G Sbjct: 104 GGGGYGGGNSGGGYGGGGYGGGNSGGGYGGGGYGGGGYG 142 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 12/44 (27%) Frame = +2 Query: 26 GGGYGG----------GRGGGGYGGG--GSGGYGGGGYGEANTG 121 GGGYGG G GGGGYGGG G GGYGGGGYG N+G Sbjct: 114 GGGYGGGGYGGGNSGGGYGGGGYGGGGYGGGGYGGGGYGGGNSG 157 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +2 Query: 23 GGGGYGGGR-GGGGYGGGG-SGGYGGGGYGEANTGSADS 133 GGGGYGGG GGGGYGGGG GG GGGYG N+ S S Sbjct: 132 GGGGYGGGGYGGGGYGGGGYGGGNSGGGYGGGNSESNSS 170 [24][TOP] >UniRef100_Q6ASX7 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ASX7_ORYSJ Length = 162 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 8/41 (19%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGY--------GGGGYGEANTG 121 GGGGYGGGRGGGGYGGGG GGY GGGGYG G Sbjct: 99 GGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGG 139 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGRGG--GGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GG GG GGGG GG GGGGYG G Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGG 126 [25][TOP] >UniRef100_O22384 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22384_ORYSA Length = 162 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 8/41 (19%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGY--------GGGGYGEANTG 121 GGGGYGGGRGGGGYGGGG GGY GGGGYG G Sbjct: 99 GGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGG 139 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGRGG--GGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GG GG GGGG GG GGGGYG G Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGG 126 [26][TOP] >UniRef100_UPI0001796908 PREDICTED: zinc finger homeobox 4 n=1 Tax=Equus caballus RepID=UPI0001796908 Length = 3574 Score = 48.9 bits (115), Expect(2) = 3e-08 Identities = 21/38 (55%), Positives = 23/38 (60%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 L + L +P P PP PP PPPP PPPP PPP PP Sbjct: 1986 LPSTVSAPLQAPPPTPPPPPPPPPPPPPPPPPPPSAPP 2023 Score = 32.3 bits (72), Expect(2) = 3e-08 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPPGKIGRRKTCQATL 242 PPPP PPP P PP P G + T A L Sbjct: 1963 PPPPPPPPLPPAPPQPSSMGPVKLPSTVSAPL 1994 [27][TOP] >UniRef100_B9Q6L7 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii VEG RepID=B9Q6L7_TOXGO Length = 510 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = +2 Query: 23 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG G GGYGGGG+GGYGGGGYG N G Sbjct: 317 GGGGYGGGGYGGGNGGYGGGGNGGYGGGGYGGGNGG 352 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/47 (61%), Positives = 30/47 (63%), Gaps = 5/47 (10%) Frame = +2 Query: 23 GGGGYGGGR--GGGGYGGGGS---GGYGGGGYGEANTGSADSCNARF 148 GGGGYGGG GGGGYGGGG GGYGGGGYG N G N + Sbjct: 295 GGGGYGGGGYGGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGY 341 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 6/45 (13%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG---GSGGY-GGGGYGEA--NTGSADSCN 139 GGGGYGG GGGGYGGG GSGGY GGGGY A + G D+ N Sbjct: 363 GGGGYGGYGGGGGYGGGGGFGSGGYGGGGGYSPAGPHHGGMDTAN 407 [28][TOP] >UniRef100_B9PW07 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii GT1 RepID=B9PW07_TOXGO Length = 508 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = +2 Query: 23 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG G GGYGGGG+GGYGGGGYG N G Sbjct: 315 GGGGYGGGGYGGGNGGYGGGGNGGYGGGGYGGGNGG 350 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARF 148 GGGGYGGG G GG GG G GGYGGGGYG N G N + Sbjct: 298 GGGGYGGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGY 339 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 6/45 (13%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG---GSGGY-GGGGYGEA--NTGSADSCN 139 GGGGYGG GGGGYGGG GSGGY GGGGY A + G D+ N Sbjct: 361 GGGGYGGYGGGGGYGGGGGFGSGGYGGGGGYSPAGPHHGGMDTAN 405 [29][TOP] >UniRef100_B6KME4 RRM domain-containing protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KME4_TOXGO Length = 513 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = +2 Query: 23 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG G GGYGGGG+GGYGGGGYG N G Sbjct: 319 GGGGYGGGGYGGGNGGYGGGGNGGYGGGGYGGGNGG 354 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/46 (63%), Positives = 30/46 (65%), Gaps = 4/46 (8%) Frame = +2 Query: 23 GGGGYGGGR-GGGGYGGGGS---GGYGGGGYGEANTGSADSCNARF 148 GGGGYGGG GGGGYGGGG GGYGGGGYG N G N + Sbjct: 298 GGGGYGGGGYGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGY 343 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 6/45 (13%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG---GSGGY-GGGGYGEA--NTGSADSCN 139 GGGGYGG GGGGYGGG GSGGY GGGGY A + GS D+ N Sbjct: 366 GGGGYGGYGGGGGYGGGGGFGSGGYGGGGGYSPAGPHHGSMDTAN 410 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGG G GGYGGGG GGYGGGG G G Sbjct: 344 GGGGYGG--GNGGYGGGGGGGYGGGGGGYGGYG 374 [30][TOP] >UniRef100_Q5I2R0 Minus agglutinin n=1 Tax=Chlamydomonas incerta RepID=Q5I2R0_CHLIN Length = 4027 Score = 47.0 bits (110), Expect(2) = 4e-08 Identities = 24/42 (57%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -2 Query: 141 ALQESAEPVLASP*PPPP*PPLPPPP*PPPPRP-PP*PPPPT 19 AL PV SP PP P PP P PP P PP P PP PP PT Sbjct: 1262 ALPAPPSPVPPSPAPPSPEPPSPRPPSPEPPSPTPPIPPSPT 1303 Score = 33.9 bits (76), Expect(2) = 4e-08 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPPGKIGRRKT 257 P PP P PP+P PP P PP R T Sbjct: 1214 PVPPSPAPPSPEPPSPFPPSPAPPRPT 1240 Score = 43.1 bits (100), Expect(2) = 1e-06 Identities = 24/58 (41%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -2 Query: 192 TRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRP-PP*PPPP 22 T P+ + + Q + A P SP PP P PP P PP P PP P PP P PP Sbjct: 1240 TPPRPEPPSPTPQIPQPPSPAPALPAPPSPVPPSPAPPSPEPPSPRPPSPEPPSPTPP 1297 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPP 281 P PP P PP+P PP P PP Sbjct: 1184 PAPPSPEPPSPTPPSPQPP 1202 [31][TOP] >UniRef100_UPI0000DB7618 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB7618 Length = 608 Score = 47.0 bits (110), Expect(2) = 4e-08 Identities = 25/53 (47%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +2 Query: 26 GGGYGGGRG---GGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWVTSA*C 175 GGG GGG G GGG+GGGG GG GGGG G +G F T C Sbjct: 59 GGGLGGGFGGGFGGGFGGGGGGGGGGGGGGGFGSGGGFGSGGGFGSGGTKGGC 111 Score = 33.9 bits (76), Expect(2) = 4e-08 Identities = 15/21 (71%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = +3 Query: 282 GGNGGGGYGAGGGGYGG-GGY 341 GG GGG G+GGGG GG GGY Sbjct: 127 GGGAGGGAGSGGGGAGGIGGY 147 Score = 47.8 bits (112), Expect(3) = 8e-07 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 13/48 (27%) Frame = +2 Query: 23 GGGGYGG-GRGGGGYGG-----------GGSGGYGG-GGYGEANTGSA 127 G GGYGG G G GGYGG GG+GGYGG GGYG A G A Sbjct: 429 GSGGYGGAGAGSGGYGGAGAGGGSGGGRGGAGGYGGAGGYGGAGGGGA 476 Score = 26.2 bits (56), Expect(3) = 8e-07 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 291 GGGGYGAGGGGYGGGGY 341 GGGG+G+G +G GG+ Sbjct: 541 GGGGFGSGFDDFGPGGH 557 Score = 21.6 bits (44), Expect(3) = 8e-07 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 184 GSCASCCKGFFANASS 231 GSC CKG + AS+ Sbjct: 485 GSCPGGCKGGYGGASA 500 [32][TOP] >UniRef100_B8AP37 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AP37_ORYSI Length = 139 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYG--GGGYGEANTGS 124 GGGGYGGGRGGGGYGGGG GGYG GGYG + G+ Sbjct: 101 GGGGYGGGRGGGGYGGGGGGGYGRREGGYGGDSGGN 136 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGRGG--GGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GG GG GGGG GG GGGGYG G Sbjct: 94 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGG 128 [33][TOP] >UniRef100_C0SUH3 Ecdysone receptor B1 isoform n=1 Tax=Apis mellifera RepID=C0SUH3_APIME Length = 557 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 145 GGGG GGG GGGG GGGG GG GGGG G G +D C+AR Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGCDAR 163 [34][TOP] >UniRef100_C0SUE0 Ecdysone receptor A isoform n=1 Tax=Apis mellifera RepID=C0SUE0_APIME Length = 629 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 145 GGGG GGG GGGG GGGG GG GGGG G G +D C+AR Sbjct: 195 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGCDAR 235 [35][TOP] >UniRef100_B4IZJ4 GH14508 n=1 Tax=Drosophila grimshawi RepID=B4IZJ4_DROGR Length = 272 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 3/36 (8%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGG---GYGEANTG 121 GGGGYGGG GGGGYGGGG GGYGGG GYG G Sbjct: 72 GGGGYGGGGGGGGYGGGGGGGYGGGGDSGYGGGGGG 107 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSA 127 GGGGYGGG GGGGYGGGG GYGGGG G G + Sbjct: 81 GGGGYGGG-GGGGYGGGGDSGYGGGGGGGYGGGDS 114 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADS 133 GGGGYGGG GGGGYGGGG G GGG G + GS S Sbjct: 152 GGGGYGGGGGGGGYGGGGGYGGGGGSAGWSAGGSGSS 188 [36][TOP] >UniRef100_B7PJ39 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PJ39_IXOSC Length = 107 Score = 44.3 bits (103), Expect(2) = 5e-08 Identities = 20/35 (57%), Positives = 22/35 (62%) Frame = +2 Query: 38 GGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNA 142 GGG GGGG GGGG GG GGGG G G + +A Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGQERLSA 36 Score = 36.6 bits (83), Expect(2) = 5e-08 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +3 Query: 255 QVFLLPIFPGGNGGGGYGAGGGGYGGGG 338 Q ++ + G GGGG G GGGG GGGG Sbjct: 65 QTVIVTLITWGGGGGGGGGGGGGGGGGG 92 [37][TOP] >UniRef100_UPI0001BB0021 PE-PGRS family protein n=1 Tax=Haliangium ochraceum DSM 14365 RepID=UPI0001BB0021 Length = 636 Score = 42.4 bits (98), Expect(2) = 5e-08 Identities = 23/41 (56%), Positives = 24/41 (58%), Gaps = 6/41 (14%) Frame = +2 Query: 23 GGGGYGGG------RGGGGYGGGGSGGYGGGGYGEANTGSA 127 GGGG GGG R GGG GGGG GG GGGG + G A Sbjct: 438 GGGGGGGGASAWNSRVGGGGGGGGEGGEGGGGGVGGSGGGA 478 Score = 38.1 bits (87), Expect(2) = 5e-08 Identities = 24/53 (45%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +3 Query: 234 WLLKVA*QVFLLPIFP----GGNGGGGYGAGGGGYGGGGY*ARG*SQRTSCRS 380 WL+ VA V + G GGGG G GGGG GGGG A G SC S Sbjct: 483 WLVGVAESVVADNVIATAGGGSGGGGGSGVGGGGGGGGGNGAGGDCGLISCGS 535 [38][TOP] >UniRef100_UPI000155FB50 PREDICTED: similar to heterogeneous nuclear ribonucleoprotein A3, partial n=1 Tax=Equus caballus RepID=UPI000155FB50 Length = 373 Score = 42.4 bits (98), Expect(2) = 5e-08 Identities = 24/50 (48%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGG--GGY----GEANTGSADSCNARFDY 154 G GG GGRGG G GGG G YGG GGY G+ N G ++R Y Sbjct: 234 GRGGNFGGRGGYGGGGGSRGSYGGGDGGYNGFGGDGNYGGGPGYSSRGGY 283 Score = 38.1 bits (87), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGGGG 338 + GG GG GYG GGGYGGGG Sbjct: 283 YGGGGGGPGYGNQGGGYGGGG 303 [39][TOP] >UniRef100_B4N8F2 GK11039 n=1 Tax=Drosophila willistoni RepID=B4N8F2_DROWI Length = 272 Score = 47.4 bits (111), Expect(2) = 5e-08 Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +2 Query: 23 GGGGYGGGRG--GGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWVT 163 GGGG+GGG GGG+GGG GG GGGG G G S ++ + T Sbjct: 28 GGGGFGGGSSGIGGGFGGGHGGGGGGGGGGSGGFGGGFSTSSSSSSFAT 76 Score = 33.1 bits (74), Expect(2) = 5e-08 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 5/24 (20%) Frame = +3 Query: 282 GGNGGGGYGAG-----GGGYGGGG 338 GG GGGG+G G GG+GGGG Sbjct: 77 GGGGGGGFGGGFGGGSSGGFGGGG 100 [40][TOP] >UniRef100_UPI0000586C1D PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000586C1D Length = 215 Score = 45.4 bits (106), Expect(2) = 5e-08 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = +2 Query: 26 GGGYGGG-RGGGGYGGGGSGGYGG---GGYGEANTGSADSCNARFDY 154 GGG+GGG +G GGYGGGG GGYG GGYG N G + R Y Sbjct: 109 GGGWGGGYQGRGGYGGGG-GGYGNQGQGGYGGYNQGYGNQRFGRGGY 154 Score = 35.0 bits (79), Expect(2) = 5e-08 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGGGGY 341 + GG GGGGY GG GGGGY Sbjct: 154 YGGGGGGGGYQGRGGYQGGGGY 175 [41][TOP] >UniRef100_A1TWH4 RNP-1-like RNA-binding protein n=1 Tax=Acidovorax citrulli AAC00-1 RepID=A1TWH4_ACIAC Length = 176 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 6/41 (14%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGY------GGGGYGEANTGSA 127 GGGGYGGGR GGGYGGGG GGY GGGGYG G + Sbjct: 97 GGGGYGGGRSGGGYGGGGGGGYGGGRGDGGGGYGGGRGGDS 137 [42][TOP] >UniRef100_Q8LPA7 Cold shock protein-1 n=1 Tax=Triticum aestivum RepID=Q8LPA7_WHEAT Length = 229 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSC 136 GGGGYGGG GGGGYGGGG GGYGGGG G G C Sbjct: 96 GGGGYGGGGGGGGYGGGG-GGYGGGGGGYGGGGGGRGC 132 [43][TOP] >UniRef100_Q10FE7 Os03g0670700 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10FE7_ORYSJ Length = 196 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/48 (60%), Positives = 32/48 (66%), Gaps = 3/48 (6%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYG--GGGYG-EANTGSADSCNARFDYW 157 GGGGYGGGRGGGGYGGGG GGYG GGY A T + + D+W Sbjct: 99 GGGGYGGGRGGGGYGGGGGGGYGRREGGYAVAAATAATPAGTGGTDWW 146 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 2/37 (5%) Frame = +2 Query: 23 GGGGYGGGRGG--GGYGGGGSGGYGGGGYGEANTGSA 127 GGGGYGGG GG GG GGGG GG GGGGYG G A Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGYA 128 [44][TOP] >UniRef100_A2XDP2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XDP2_ORYSI Length = 820 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/63 (47%), Positives = 35/63 (55%), Gaps = 6/63 (9%) Frame = -2 Query: 192 TRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPP------PRPPP*P 31 T P+T+ T +K+ S PV S PPPP PP PPPP PPP P+PPP P Sbjct: 318 TPPRTRFSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPP 377 Query: 30 PPP 22 PPP Sbjct: 378 PPP 380 [45][TOP] >UniRef100_Q10Q99 Formin-like protein 8 n=1 Tax=Oryza sativa Japonica Group RepID=FH8_ORYSJ Length = 892 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/63 (47%), Positives = 35/63 (55%), Gaps = 6/63 (9%) Frame = -2 Query: 192 TRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPP------PRPPP*P 31 T P+T+ T +K+ S PV S PPPP PP PPPP PPP P+PPP P Sbjct: 318 TPPRTRFSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPP 377 Query: 30 PPP 22 PPP Sbjct: 378 PPP 380 [46][TOP] >UniRef100_B9HDW3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HDW3_POPTR Length = 547 Score = 51.2 bits (121), Expect(2) = 7e-08 Identities = 30/83 (36%), Positives = 36/83 (43%), Gaps = 19/83 (22%) Frame = -2 Query: 213 KTFAATCTRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPP----- 49 K A+ R KT+ Q L+ +EP ++ PPPP PP PPPP PPPP Sbjct: 298 KMVLASLYRKKTKKQKTQVLPKNDTLRSPSEPPSSTRPPPPPPPPPPPPPPPPPPSVFHF 357 Query: 48 --------------RPPP*PPPP 22 PPP PPPP Sbjct: 358 LFRKNSKSKRIHSFSPPPAPPPP 380 Score = 28.9 bits (63), Expect(2) = 7e-08 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = -1 Query: 331 PP*PPPPAP*PPPPLPPGKI---GRRKTCQAT 245 PP PPPP P P PP K+ RK AT Sbjct: 263 PPTPPPPPPRHATPAPPKKMHGKSERKRTNAT 294 [47][TOP] >UniRef100_C1YRB8 Single-stranded DNA-binding protein n=1 Tax=Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 RepID=C1YRB8_NOCDA Length = 195 Score = 49.7 bits (117), Expect(2) = 7e-08 Identities = 27/52 (51%), Positives = 32/52 (61%), Gaps = 4/52 (7%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG--GSGGYG--GGGYGEANTGSADSCNARFDYWVTS 166 GGGG+GGG GGGG+GGG GGYG GGG+G + G S D W T+ Sbjct: 125 GGGGFGGG-GGGGFGGGQPQGGGYGNQGGGFGGSQGGGGRSGPPADDPWATN 175 Score = 30.4 bits (67), Expect(2) = 7e-08 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 270 PIFPGGNGGGGYGAGGGGY 326 P G GGGG+G GGGG+ Sbjct: 171 PWATNGGGGGGFGGGGGGF 189 [48][TOP] >UniRef100_Q9XUW5 Protein F58E10.3a, confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=Q9XUW5_CAEEL Length = 561 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGY GGRGGG YGGGG GGYGGGGYG G Sbjct: 32 GGGGYSGGRGGG-YGGGGGGGYGGGGYGGGGRG 63 [49][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 44.7 bits (104), Expect(2) = 9e-08 Identities = 24/54 (44%), Positives = 27/54 (50%) Frame = -2 Query: 189 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 28 RP Q V+ +E P + P PPPP PP PPPP PPPP P PP Sbjct: 452 RPAPAPQPKVSHSLYPEKKEKPPPPVPPPTPPPPPPPPPPPP-PPPPPPVKAPP 504 Score = 35.0 bits (79), Expect(2) = 9e-08 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPPGKIGR 266 P PP PPPP P PP P PP I R Sbjct: 389 PAPPPPPPPPPPPPRPPPPPAIVR 412 [50][TOP] >UniRef100_UPI0000DA3E0C PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3E0C Length = 542 Score = 44.7 bits (104), Expect(2) = 9e-08 Identities = 24/54 (44%), Positives = 27/54 (50%) Frame = -2 Query: 189 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 28 RP Q V+ +E P + P PPPP PP PPPP PPPP P PP Sbjct: 390 RPAPAPQPKVSHSLYPEKKEKPPPPVPPPTPPPPPPPPPPPP-PPPPPPVKAPP 442 Score = 35.0 bits (79), Expect(2) = 9e-08 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPPGKIGR 266 P PP PPPP P PP P PP I R Sbjct: 327 PAPPPPPPPPPPPPRPPPPPAIVR 350 [51][TOP] >UniRef100_C5CSB2 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CSB2_VARPS Length = 181 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG GGYGGGG G + G Sbjct: 97 GGGGYGGG-GGGGYGGGGGGGYGGGGGGRSGGG 128 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGGYGGG GGGYGGGG GGYGGGG G Sbjct: 90 GGGGYGGG--GGGYGGGGGGGYGGGGGG 115 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/39 (66%), Positives = 27/39 (69%), Gaps = 6/39 (15%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGG------GGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGG GG GGYGGGG G + G Sbjct: 105 GGGGYGGG-GGGGYGGGGGGRSGGGGGYGGGGGGRSGGG 142 [52][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/48 (54%), Positives = 28/48 (58%) Frame = -2 Query: 147 KRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 +R + P P PPPP PP PPPP PPPP PPP PPPP R C Sbjct: 20 ERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPC 67 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P PPPP PP PPPP PPPP PPP PPPP R C Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPC 105 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 PCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPPRP P PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPPP 73 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/35 (68%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*P-PPPTHNRTC 4 P PPPP PP PPPP PPPP PPP P PPP R C Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPC 114 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP P PPPP PPPP PPP PPPP Sbjct: 58 PPPPPPPRPCPPPPPPPPPPPPPPPPPP 85 [53][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -2 Query: 132 ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 +SA P A P PPPP PP PPPP PPPP PPP PPP Sbjct: 53 QSAAPAQARPTPPPPPPPPPPPPPPPPPPPPPPPPP 88 [54][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 114 LASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +ASP PPPP PP PPPP PPPP PPP PPPP Sbjct: 220 VASPSPPPPPPPPPPPPPPPPPSPPPPPPPP 250 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 126 AEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 221 ASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPS 261 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/72 (40%), Positives = 33/72 (45%) Frame = -2 Query: 237 TNTRGIGKKTFAATCTRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*P 58 T G G TF + P + R + + P P PPPP PP P PP P Sbjct: 194 TGVTGPGGPTFPTPVSAPPPPFR-------DRPVASPSPPPPPPPPPPPPPPPPPSPPPP 246 Query: 57 PPPRPPP*PPPP 22 PPP PPP PPPP Sbjct: 247 PPPPPPPPPPPP 258 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PP P PP PPPP PPPP PPP PPPP+ N Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPPPSPN 268 [55][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRT 7 P PPPP PP PPPP PPPP PPP PPPP H T Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLT 44 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNR 10 P PPPP PP PPPP PPPP PPP PPPP +R Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHR 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 [56][TOP] >UniRef100_A7EC48 Glycine-rich RNA-binding protein n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7EC48_SCLS1 Length = 193 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGG+GGGRGGGGYGG G GGYGGGG G Sbjct: 96 GGGGFGGGRGGGGYGGRGGGGYGGGGGG 123 [57][TOP] >UniRef100_UPI00001809D7 UPI00001809D7 related cluster n=1 Tax=Rattus norvegicus RepID=UPI00001809D7 Length = 3593 Score = 47.8 bits (112), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 28 P+ A P PPP PP PPPP PPPP PP PP Sbjct: 2014 PLQAPPPTPPPPPPPPPPPPPPPPPPPSAPP 2044 Score = 31.6 bits (70), Expect(2) = 1e-07 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPPGKIGRRKTCQATL 242 PPPP PPP P PP P G + T A L Sbjct: 1984 PPPPPPPPLPPAPPQPSALGPVKIPNTVSAPL 2015 [58][TOP] >UniRef100_B4N9L9 GK12202 n=1 Tax=Drosophila willistoni RepID=B4N9L9_DROWI Length = 715 Score = 46.2 bits (108), Expect(2) = 1e-07 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 5/49 (10%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG-----EANTGSADSCNARFDY 154 GGG G RG GG GGGGSGG GGGG G + N D N+R D+ Sbjct: 432 GGGAQRGRRGRGGGGGGGSGGGGGGGNGLNQRYQNNRRDDDDYNSRGDH 480 Score = 33.1 bits (74), Expect(2) = 1e-07 Identities = 21/47 (44%), Positives = 26/47 (55%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGGGGY*ARG*SQRTSCRSTRHVEEPSRERQ 416 + GGNGGG GGG GGGG RG S R R R+ ++ R+ Q Sbjct: 501 YRGGNGGG----GGGNGGGGGNNRRGGSNR---RPPRNDQQNGRDYQ 540 [59][TOP] >UniRef100_Q7ZWT3 Sf1 protein n=1 Tax=Xenopus laevis RepID=Q7ZWT3_XENLA Length = 571 Score = 46.2 bits (108), Expect(2) = 1e-07 Identities = 30/72 (41%), Positives = 33/72 (45%), Gaps = 9/72 (12%) Frame = -2 Query: 210 TFAATCTRPKTQHQA-DVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPP----- 49 T + T + P Q A T S LQ +A V P PP PP PPP PPPP Sbjct: 466 TVSGTASLPPWQQGAGSTTSSSAPQLQTTASLVPPLPGVQPPLPPSAPPPPPPPPPGTSG 525 Query: 48 ---RPPP*PPPP 22 PPP PPPP Sbjct: 526 LLYAPPPPPPPP 537 Score = 33.1 bits (74), Expect(2) = 1e-07 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPP 281 PPPP P PAP PPPP P Sbjct: 419 PPPPPPSGPAPPPPPPSAP 437 [60][TOP] >UniRef100_B4R7C9 GD16486 n=1 Tax=Drosophila simulans RepID=B4R7C9_DROSI Length = 197 Score = 43.1 bits (100), Expect(2) = 1e-07 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 145 GGGG GG GGG GGG S G GGGG G ++ G + + Sbjct: 62 GGGGGGGWSSGGGGGGGWSSGGGGGGGGWSSGGGGSGSDVK 102 Score = 36.2 bits (82), Expect(2) = 1e-07 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +3 Query: 258 VFLLPIFPGGNGGGGYGAGGGGYGGGGY 341 V L+ I G GGGG+G GGG GGGG+ Sbjct: 101 VKLIKIISLGGGGGGHGGGGGHGGGGGH 128 [61][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/58 (48%), Positives = 34/58 (58%) Frame = -2 Query: 195 CTRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 C +P Q + S+ +L + P + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 397 CCKPLPQFYSQ----SQPSLPFAPLPQIQPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 99 PPPP*PPLPPPP*PPPPRPPP*PPPP 22 PPPP PP PPPP PPPP PPP PPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/50 (48%), Positives = 29/50 (58%) Frame = -2 Query: 171 QADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 Q D +Q + + + +S PPPP PP PPPP PPPP PPP P PP Sbjct: 122 QIDPSQYIEMMANQMQQQTQSSQTPPPPPPPPPPPPPPPPPPPPPPPKPP 171 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P PPPP PP PPPP PPPP PPP PPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPP 451 [62][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 123 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 EP P PPPP PP PPPP PPPP PPP PPPP Sbjct: 850 EPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 883 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -2 Query: 135 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +E P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 849 EEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = -2 Query: 135 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 + + P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 850 EPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 935 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 132 ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 E A V P PPP PP PPPP PPPP PPP PPPP Sbjct: 842 EPAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPP 878 [63][TOP] >UniRef100_Q7VEJ9 RNA-binding protein, RRM domain n=1 Tax=Prochlorococcus marinus RepID=Q7VEJ9_PROMA Length = 252 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGGYGGG G GGYGGGG GGYGGGG G Sbjct: 112 GGGGYGGGGGQGGYGGGGQGGYGGGGQG 139 [64][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGY---GGGGYGEANTGSAD 130 GGGGYGGG GGGGYGGGG GGY GGGGYG G D Sbjct: 134 GGGGYGGG-GGGGYGGGGGGGYGGGGGGGYGGGGGGGGD 171 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGGYGGG GGGGYGGGG GGYGGGG G Sbjct: 126 GGGGYGGG-GGGGYGGGGGGGYGGGGGG 152 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGGYGGG GGGYGGGG GGYGGGG G Sbjct: 119 GGGGYGGG--GGGYGGGGGGGYGGGGGG 144 [65][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 L S P P PP P PPLPPPP PPPP PPP PPPP Sbjct: 220 LPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPP 258 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPPPS 708 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PPLPP P PPPP PPP PPPP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P+ SP PPPP PP PPPP PPPP PPP PPP Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTH 16 P PP P PP PPPP PPPP PPP PPPP H Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPPPH 703 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P SP PP P PP PPPP PPPP PPP PPPP Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPP Sbjct: 684 PPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 [66][TOP] >UniRef100_B6SP74 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6SP74_MAIZE Length = 156 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 4/37 (10%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG----GSGGYGGGGYGEANTG 121 GGGGYGGGRGGGGYGGG G GGYGGGG G G Sbjct: 93 GGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGGYGGGG 129 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGYGGGG G GGGGYG N G Sbjct: 114 GGGGYGGG--GGGYGGGGGYGGGGGGYGGGNRG 144 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 3/36 (8%) Frame = +2 Query: 23 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG G GGGGYG G Sbjct: 102 GGGGYGGGGRRDGGGGYGGGGGGYGGGGGYGGGGGG 137 [67][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -2 Query: 123 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 E +L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 67 EVILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 [68][TOP] >UniRef100_UPI000024DCC5 zinc finger homeodomain 4 n=1 Tax=Mus musculus RepID=UPI000024DCC5 Length = 3581 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 20/32 (62%), Positives = 21/32 (65%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P+ A P PPP PP PPPP PPPP PPP P Sbjct: 2004 PLQAPPPTPPPPPPPPPPPPPPPPPPPPPSAP 2035 Score = 31.6 bits (70), Expect(2) = 1e-07 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPPGKIGRRKTCQATL 242 PPPP PPP P PP P G + T A L Sbjct: 1974 PPPPPPPPLPPAPPQPSTLGPVKIPNTVSAPL 2005 [69][TOP] >UniRef100_Q89X06 Blr0521 protein n=1 Tax=Bradyrhizobium japonicum RepID=Q89X06_BRAJA Length = 745 Score = 42.7 bits (99), Expect(2) = 1e-07 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 7/40 (17%) Frame = -2 Query: 120 PVLASP*PPPP*PP-------LPPPP*PPPPRPPP*PPPP 22 P A P P PP PP PPPP PP RP P PPPP Sbjct: 141 PPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPP 180 Score = 36.2 bits (82), Expect(2) = 1e-07 Identities = 21/44 (47%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -1 Query: 352 PRA**PPPP*PPP---PAP*PPPPLPPGKIGRRKTCQATLSNQH 230 PR PPPP PPP PAP PPPP PP + A QH Sbjct: 90 PRPAAPPPPPPPPAARPAP-PPPPPPPAAPKQPSPPPAAAPQQH 132 [70][TOP] >UniRef100_B3MW43 GF22622 n=1 Tax=Drosophila ananassae RepID=B3MW43_DROAN Length = 224 Score = 48.1 bits (113), Expect(2) = 2e-07 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 8/56 (14%) Frame = +2 Query: 26 GGGYGGGRGG--GGYGGGGSGGYGG------GGYGEANTGSADSCNARFDYWVTSA 169 GG YGGGRGG GG+ G G+GG G GG G A G+A A FDY V A Sbjct: 115 GGAYGGGRGGGAGGWQGSGAGGRGAGAGGWQGGAGGAGAGNAWGNPAEFDYTVNHA 170 Score = 30.8 bits (68), Expect(2) = 2e-07 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 285 GNGGGGYGAGGGGYGGGG 338 G GG YG GG YGG G Sbjct: 174 GGAGGAYGGAGGAYGGAG 191 [71][TOP] >UniRef100_UPI0001BB00BC single-strand binding protein n=1 Tax=Haliangium ochraceum DSM 14365 RepID=UPI0001BB00BC Length = 186 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = +2 Query: 23 GGGGYGGG-RGGGGYGGGGSGGYGGGGYGEANTGSAD 130 GGGGYGGG GGGGYGGGG GG GGGGYG G D Sbjct: 146 GGGGYGGGGSGGGGYGGGGPGGGGGGGYGGGGGGPDD 182 [72][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTCQ 1 P SP PPPP PP PPPP PPPP PPP PPPP +R + Sbjct: 169 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNAR 208 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 159 SPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPPP PP PPPP+ Sbjct: 131 PPPPPPSPPPPPPPSPPPPPSPPPPPPPS 159 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPP PPP PPPP Sbjct: 136 PSPPPPPPPSPPPPPSPPPPPPPSPPPP 163 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPP-PP*PPPPRPPP*PPPP 22 S P + P PPPP PP PP PP PPPP PPP PPPP Sbjct: 145 SPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPP 181 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPP PP PPPP PPPP PPP PPPP Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 195 [73][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P + +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 133 PPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 165 [74][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTCQ 1 P PP P PPLPPPP PPPP PPP PPPP TC+ Sbjct: 387 PPPPSPPPPLPPPPIPPPPSPPPPPPPPLAPFTCE 421 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P L P PP P PPLPPPP PPPP PPP PPPP Sbjct: 1600 SPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPP 1635 Score = 48.9 bits (115), Expect(2) = 2e-07 Identities = 24/48 (50%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -2 Query: 150 SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPR----PPP*PPPPT 19 S ++ S P P PP P PP PPPP PPPP PPP PPPP+ Sbjct: 1698 SPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPS 1745 Score = 29.3 bits (64), Expect(2) = 2e-07 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPPGKI 272 P PP PPP+P P PP P + Sbjct: 1644 PSPPPSPPPSPPPSPPPSPSPL 1665 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P SP PP P PPLPPPP PPPP PPP PPPP Sbjct: 921 PPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPP 953 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P SP PP P PPLPPPP PPPP PPP PPPP Sbjct: 1188 PPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPP 1220 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 S P L P PP P PPLPPPP PPPP PPP PPP+ Sbjct: 822 SPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPS 858 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 S P L P PP P PPLPPPP PPPP PPP PPP+ Sbjct: 1000 SPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPS 1036 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 S P L P PP P PPLPPPP PPPP PPP PPP+ Sbjct: 1091 SPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPS 1127 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P L P PP P PPLPPPP PPPP PPP PPP Sbjct: 913 SPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPP 948 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 99 PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 PP P PP PPPP PPPP PPP PPPPT Sbjct: 1249 PPSPPPPTPPPPAPPPPTPPPSPPPPT 1275 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 108 SP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 SP PP P PPLPPPP PPPP PPP PPP Sbjct: 704 SPPPPSPPPPLPPPPLPPPPLPPPSPPP 731 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P SP PP P PPLPPPP PPPP PPP PPP Sbjct: 830 PPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 861 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P SP PP P PPLPPPP PPPP PPP PPP Sbjct: 1008 PPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 1039 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P SP PP P PPLPPPP PPPP PPP PPP Sbjct: 1099 PPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 1130 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -2 Query: 120 PVLASP*PPP-P*PPLPPPP*PPPPRPPP*PPP 25 PV P PPP P PPLPPPP PPPP PPP PPP Sbjct: 939 PVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP 971 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -2 Query: 120 PVLASP*PPP-P*PPLPPPP*PPPPRPPP*PPP 25 PV P PPP P PPLPPPP PPPP PPP PPP Sbjct: 1206 PVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP 1238 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P PPPP PP PPPP PPPP PPP PPP Sbjct: 1726 PLPPPPSPPSPPPPSPPPPSPPPSPPP 1752 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 PV P PPP PPLPPPP PPP PPP PPPPT Sbjct: 2122 PVPPPPTPPPSPPPLPPPP-TPPPSPPPLPPPPT 2154 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -2 Query: 141 ALQESAEPVLASP*PPPP*PP--LPPPP*PPPPRPPP*PPPP 22 +L S P P PPPP PP LPPPP PPPP PPP PPP Sbjct: 363 SLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPLPPPPIPPP 404 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 L S P+ P PPPP PP PPP PPPP PPP PPP Sbjct: 2111 LPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPP 2148 [75][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 ASP PPPP PP PPPP PPPP PPP PPPP Sbjct: 304 ASPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 [76][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 ASP PPPP PP PPPP PPPP PPP PPPP Sbjct: 466 ASPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -2 Query: 144 RALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 R A P P PPPP PP PPPP PPPP PPP PP T Sbjct: 460 RTYAHDASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVET 501 [77][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 ASP PPPP PP PPPP PPPP PPP PPPP Sbjct: 257 ASPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTH 16 P PPPP PP PPPP PPPP PPP PPPP + Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPAY 290 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 [78][TOP] >UniRef100_C1UQA5 Single-stranded DNA-binding protein n=1 Tax=Haliangium ochraceum DSM 14365 RepID=C1UQA5_9DELT Length = 155 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = +2 Query: 23 GGGGYGGG-RGGGGYGGGGSGGYGGGGYGEANTGSAD 130 GGGGYGGG GGGGYGGGG GG GGGGYG G D Sbjct: 115 GGGGYGGGGSGGGGYGGGGPGGGGGGGYGGGGGGPDD 151 [79][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 SA P + PPPP PPLPPPP PPPP PPP PPPP Sbjct: 460 SAIPHAGASLPPPPPPPLPPPPPPPPPPPPPPPPPP 495 [80][TOP] >UniRef100_A2QC74 ATP-dependent RNA helicase dbp2 n=1 Tax=Aspergillus niger CBS 513.88 RepID=DBP2_ASPNC Length = 565 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGG--GSGGYGGGGYGEANTGS 124 GGGYGGG GGGGYGGG G GGYGGGGYG G+ Sbjct: 35 GGGYGGGGGGGGYGGGGYGGGGYGGGGYGGRGGGA 69 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 4/37 (10%) Frame = +2 Query: 23 GGGGYGGGRG---GGGYGGGGSGG-YGGGGYGEANTG 121 GGGGYG G G GGGYGGGG GG YGGGGYG G Sbjct: 22 GGGGYGNGNGYSNGGGYGGGGGGGGYGGGGYGGGGYG 58 [81][TOP] >UniRef100_B4IF47 GM13418 n=1 Tax=Drosophila sechellia RepID=B4IF47_DROSE Length = 400 Score = 45.4 bits (106), Expect(2) = 2e-07 Identities = 24/50 (48%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = +2 Query: 23 GGGGYGGGR-----GGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 157 GGGG GGGR GGGG GGGG G Y GG G G + R W Sbjct: 233 GGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGGGNVQPRDGDW 282 Score = 33.1 bits (74), Expect(2) = 2e-07 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 279 PGGNGGGGYGAGGGGYGGGG 338 P G+ G G GGGGYGGGG Sbjct: 304 PKGDDEGSSGGGGGGYGGGG 323 [82][TOP] >UniRef100_B8LQI7 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=B8LQI7_PICSI Length = 199 Score = 44.7 bits (104), Expect(2) = 2e-07 Identities = 22/45 (48%), Positives = 25/45 (55%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 157 GG G+GGG GG G+GGGG GG GGGG G G +W Sbjct: 35 GGPGFGGG-GGPGFGGGGFGGGGGGGPGFGGGGGPGGGGGWPGFW 78 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = +3 Query: 270 PIFPGGNG---GGGYGAGGGGYGGGGY 341 P F GG G GGG G G GGYG GGY Sbjct: 75 PGFWGGGGPGLGGGGGPGFGGYGSGGY 101 [83][TOP] >UniRef100_A9NTY4 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NTY4_PICSI Length = 157 Score = 44.7 bits (104), Expect(2) = 2e-07 Identities = 22/45 (48%), Positives = 25/45 (55%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 157 GG G+GGG GG G+GGGG GG GGGG G G +W Sbjct: 35 GGPGFGGG-GGPGFGGGGFGGGGGGGPGFGGGGGPGGGGGWPGFW 78 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = +3 Query: 270 PIFPGGNG---GGGYGAGGGGYGGGGY 341 P F GG G GGG G G GGYG GGY Sbjct: 75 PGFWGGGGPGLGGGGGPGFGGYGSGGY 101 [84][TOP] >UniRef100_A3BJ87 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3BJ87_ORYSJ Length = 121 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 23/46 (50%), Positives = 24/46 (52%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWV 160 GGGG GGG GGGG GGGG G GGG G G F + V Sbjct: 55 GGGGLGGG-GGGGLGGGGGFGKGGGVGGGFGKGGGFGKGGGFGFGV 99 Score = 36.2 bits (82), Expect(2) = 2e-07 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGGGG 338 F G GGGG+G GGGG GGGG Sbjct: 95 FGFGVGGGGFGGGGGGGGGGG 115 [85][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 S+ P SP P PP PP+PPPP PPPP PPP PPPP+ Sbjct: 229 SSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPS 265 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 99 PPPP*PPLPPPP*PPPPRPPP*PPPP 22 PPPP PP PPPP PPPP PPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P + P PPPP PP PPPP P PP PPP PPPP Sbjct: 244 PPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P+ P PPPP PP PPPP PPP PPP PPPP Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PP P PP PPPP PPPP PPP PPPP Sbjct: 234 SPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPP 269 [86][TOP] >UniRef100_C4J6D2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4J6D2_MAIZE Length = 149 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/38 (73%), Positives = 28/38 (73%), Gaps = 5/38 (13%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG----GSGGY-GGGGYGEANTG 121 GGGGYGGGRGGGGYGGG G GGY GGGGYG G Sbjct: 93 GGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYGGGGGG 130 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 3/36 (8%) Frame = +2 Query: 23 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG G GGGGYG N G Sbjct: 102 GGGGYGGGGRRDGGGGYGGGGGYGGGGGGYGGGNRG 137 [87][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P PPPP PP PPPP PPPP PPP PPPP TC Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTC 117 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -2 Query: 117 VLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 V+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 75 VIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -2 Query: 117 VLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 ++ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 74 IVIPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P PPPP PP PPPP PPPP PPP PPPP C Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPC 119 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTCQ 1 P PPPP PP PPPP PPPP PPP PPPP C+ Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPCCE 121 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 [88][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PPLPPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPPP +N Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPNN 71 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPPP N Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [89][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -2 Query: 150 SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +++ + E P+ +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 NEKMVIELPPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 126 AEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 L + P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 58 LPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 [90][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PPLPPPP PPPP PPP PPPP Sbjct: 1215 PPPPPPPPPLPPPPPPPPPLPPPPPPPP 1242 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = -2 Query: 120 PVLASP*PP--PP*PPLPPPP*PPPPRPPP*PPPP 22 PV A P PP PP PPLPPPP PPPP PPP PPPP Sbjct: 1198 PVPAGPPPPLTPPPPPLPPPPPPPPPLPPPPPPPP 1232 [91][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTH 16 P PPPP PP PPPP PPPP PPP PPPP H Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [92][TOP] >UniRef100_B1X5L4 RNA-binding protein RbpD n=1 Tax=Paulinella chromatophora RepID=B1X5L4_PAUCH Length = 132 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 3/31 (9%) Frame = +2 Query: 23 GGGGYGGGRGGGG-YGGGGSGGY--GGGGYG 106 GGGGYGGGRGGGG YGGGG GGY GGGGYG Sbjct: 96 GGGGYGGGRGGGGGYGGGGGGGYGSGGGGYG 126 [93][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/56 (48%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = -2 Query: 183 KTQHQADVTQ*SKRA--LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 K + +A+ K A E ++P + + PPPP PP PPPP PPPP PPP PPPP Sbjct: 1004 KAEQKAEAEAAEKEADVKDEVSKPAVTAVPPPPPPPPPPPPPPPPPPPPPPPPPPP 1059 [94][TOP] >UniRef100_A8NA58 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NA58_COPC7 Length = 653 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGG GGG GGGGYGG G GGYGGGGYG G Sbjct: 604 GGGGGGGGYGGGGYGGYGGGGYGGGGYGGGPRG 636 [95][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 20/33 (60%), Positives = 20/33 (60%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P LA P P PP PPPP P PP PP PPPP Sbjct: 698 PSLAPKPPSAPPPPPPPPPAPKPPGAPPPPPPP 730 Score = 33.1 bits (74), Expect(2) = 2e-07 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Frame = -1 Query: 337 PPPP*PPPP----AP*PPPPLPPGKIGRRKTCQATL 242 PPPP PPPP + PPPP PP + + TL Sbjct: 623 PPPPPPPPPTSISSKGPPPPPPPPDFSSSSSNKPTL 658 Score = 44.7 bits (104), Expect(2) = 4e-07 Identities = 22/43 (51%), Positives = 24/43 (55%), Gaps = 13/43 (30%) Frame = -2 Query: 111 ASP*PPPP*PPLP-----PPP*PPPP--------RPPP*PPPP 22 ++P PPPP PP P PPP PPPP PPP PPPP Sbjct: 706 SAPPPPPPPPPAPKPPGAPPPPPPPPPTTKPLGAHPPPPPPPP 748 Score = 32.7 bits (73), Expect(2) = 4e-07 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 12/48 (25%) Frame = -1 Query: 337 PPPP*PPP------------PAP*PPPPLPPGKIGRRKTCQATLSNQH 230 PPPP PPP P P PPPP PP + + + S+ H Sbjct: 639 PPPPPPPPDFSSSSSNKPTLPPPPPPPPAPPLPMFSSSSSTSRSSSSH 686 Score = 42.0 bits (97), Expect(2) = 5e-07 Identities = 21/46 (45%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = -2 Query: 150 SKRALQESAEPVLASP*PPPP*P---PLPPPP*PPPPRPPP*PPPP 22 S + S+ + P PPPP P P PP PPPP PPP P PP Sbjct: 676 SSSTSRSSSSHGVPPPHPPPPPPSLAPKPPSAPPPPPPPPPAPKPP 721 Score = 35.0 bits (79), Expect(2) = 5e-07 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPPGKIGRR 263 PPPP P P P PPPP PP I + Sbjct: 613 PPPPLPGPSPPPPPPPPPPTSISSK 637 [96][TOP] >UniRef100_Q6AHT0 Protease-1 (PRT1) protein, putative n=1 Tax=Pneumocystis carinii RepID=Q6AHT0_PNECA Length = 947 Score = 51.6 bits (122), Expect(2) = 2e-07 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -2 Query: 186 PKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*P-PLPPPP*PPPPRPPP*PPPPT 19 P +Q D + S S+EP P PPPP P P PPPP P P PPP PPPP+ Sbjct: 756 PSSQQDPDTSLSSNLTSTSSSEP---PPLPPPPPPAPTPPPPAPTPAPPPPPPPPPS 809 Score = 26.6 bits (57), Expect(2) = 2e-07 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLPPGK 275 P PP PPP P P P PP K Sbjct: 728 PQPPSEPPPQP-PLDPRPPSK 747 [97][TOP] >UniRef100_B5I5T8 Single-stranded DNA-binding protein n=1 Tax=Streptomyces sviceus ATCC 29083 RepID=B5I5T8_9ACTO Length = 200 Score = 44.7 bits (104), Expect(2) = 3e-07 Identities = 24/46 (52%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +2 Query: 38 GGGRGG-GGYGGGGSGGYGGGGYGEANTGSADSCNA-RFDYWVTSA 169 G GRGG GGY GGG GG GGGG+G G A D W T A Sbjct: 123 GAGRGGQGGYSGGGGGGQGGGGWGGGPGGGQQGGGAPADDPWATGA 168 Score = 33.5 bits (75), Expect(2) = 3e-07 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +3 Query: 282 GGNGGGGYGAGGGGYGGGGY 341 GG GGGG+G GG GGGGY Sbjct: 176 GGQGGGGWGGNSGG-GGGGY 194 [98][TOP] >UniRef100_B7QTD0 Single-stranded DNA-binding protein n=1 Tax=Ruegeria sp. R11 RepID=B7QTD0_9RHOB Length = 177 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG+GGG YGGG GGYGGGGY N G Sbjct: 124 GGGGYGGGQGGG-YGGGQGGGYGGGGYDSGNQG 155 [99][TOP] >UniRef100_A6G1X8 Single-stranded DNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G1X8_9DELT Length = 198 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG YGGGG G G Sbjct: 130 GGGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYG 162 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 4/37 (10%) Frame = +2 Query: 23 GGGGYGGGRGGGGYG-GGGSGGYGGGG---YGEANTG 121 GGGGY GG GGGGYG GGG GGYGGGG YG +G Sbjct: 121 GGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSG 157 [100][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPPP +N Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPNN 71 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPPP N Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [101][TOP] >UniRef100_Q40426 RNA-binding glycine-rich protein-1a n=1 Tax=Nicotiana sylvestris RepID=Q40426_NICSY Length = 156 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 4/38 (10%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGG----GGYGEANTGS 124 GGGGYGGGR GGYGGGG GGYGG GGYG + G+ Sbjct: 116 GGGGYGGGRREGGYGGGGGGGYGGGRREGGYGGGSEGN 153 [102][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P PPPP PP PPPP PPPP PPP PPPP + C Sbjct: 275 PSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQC 308 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 108 SP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 SP PPPP PP PPPP PPPP PPP PPPP Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 108 SP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 SP PPPP PP PPP PPPP PPP PPPP Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P + P PPPP PP PPP PPPP PPP PPPP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PPPP PP PPPP PPPP PP PPPP Sbjct: 248 SPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PPPP PP PPPP P PP PPP PPPP Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPP PP PPPP PPPP PPP PPPP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP P PP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 [103][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPPP +N Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPNN 68 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPPP N Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 67 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 [104][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 LQ+S P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 LQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/45 (57%), Positives = 27/45 (60%) Frame = -2 Query: 156 Q*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 Q S+ A P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 QQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [105][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRT 7 P PPPP PP PPPP PPPP PPP PPPP ++T Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQT 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNR 10 P PPPP PP PPPP PPPP PPP PPP R Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTR 52 [106][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPPP +N Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPENN 35 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPPP N Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPEN 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 [107][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P + +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 113 PPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -2 Query: 108 SP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 +P PPPP PP PPPP PPPP PPP PPPPT Sbjct: 119 APPPPPPPPPPPPPPPPPPPPPPPPPPPPT 148 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P+ PPPP PP PPPP PPPP PPP PPPP Sbjct: 114 PIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPP 146 [108][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P + +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 113 PPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 [109][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PHLLPPRPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPP N Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPRN 104 [110][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P SP PPPP PP PPPP PPPP PPP PPPP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPP 285 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPPS 296 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P SP PPPP PP PPPP PP P PPP PPPP Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PPPP PP PP P PPPP PPP PPPP Sbjct: 257 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PPPP PP PPP PPPP PPP PPPP Sbjct: 259 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 [111][TOP] >UniRef100_A4RW22 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RW22_OSTLU Length = 643 Score = 48.9 bits (115), Expect(2) = 3e-07 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 L+E L P PPPP PP PPPP PP P PP P PP Sbjct: 102 LEEGQLDELPPPKPPPPKPPKPPPPKPPKPPPPRPPKPP 140 Score = 28.9 bits (63), Expect(2) = 3e-07 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 11/37 (29%) Frame = -1 Query: 337 PPPP*P--------PPPAP*PP---PPLPPGKIGRRK 260 PPPP P PPP P PP PP PP R K Sbjct: 47 PPPPPPKATAARRAPPPPPPPPKRQPPPPPPFAARTK 83 [112][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P SP PPPP PP PPPP PPPP PPP PPPP Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P + P PPPP PP PPPP PPPP PPP PPPP +C Sbjct: 376 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASC 414 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -2 Query: 150 SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S Q P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 350 SANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPPPP 397 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPP 400 Score = 51.6 bits (122), Expect(2) = 7e-06 Identities = 27/61 (44%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = -2 Query: 186 PKTQHQADVTQ*SKRALQESAEPVLASP*PPP-----P*PPLPPPP*PPPPRPPP*PPPP 22 P T+ + D +K +Q + P P PP P PP PPPP PPPP PPP PPPP Sbjct: 320 PPTEAKLDTPTEAKPEMQ-TGSPNACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPP 378 Query: 21 T 19 + Sbjct: 379 S 379 Score = 21.6 bits (44), Expect(2) = 7e-06 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPP 290 PP P PP+ P PP Sbjct: 269 PPAEAPQPPSEAPQPP 284 [113][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/45 (57%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = -2 Query: 144 RALQESAEPVLASP*PPPP*P-PLPPPP*PPPPRPPP*PPPPTHN 13 +A +A +A+P PPPP P P PPPP PPPP PPP PPPP H+ Sbjct: 2787 QAAAAAAISAVATPPPPPPPPTPPPPPPPPPPPPPPPPPPPPQHS 2831 [114][TOP] >UniRef100_UPI000042D0EA hypothetical protein CNBF3470 n=1 Tax=Cryptococcus neoformans var. neoformans B-3501A RepID=UPI000042D0EA Length = 559 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 3/30 (10%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGGG---SGGYGGGGYG 106 GGGYGGG GGGGYGGGG GGYGGGGYG Sbjct: 32 GGGYGGGGGGGGYGGGGGGYGGGYGGGGYG 61 [115][TOP] >UniRef100_Q31DH1 RNA-binding region RNP-1 n=1 Tax=Prochlorococcus marinus str. MIT 9312 RepID=Q31DH1_PROM9 Length = 222 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGYGGGG G GGGGYG N G Sbjct: 100 GGGGYGGGNNGGGYGGGGGG--GGGGYGGGNNG 130 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 10/43 (23%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSG----------GYGGGGYGEANTG 121 GGGGYGGG GGGYGGGG G G GGGGYG N G Sbjct: 120 GGGGYGGGNNGGGYGGGGGGYGGGNNGGGYGGGGGGYGGGNNG 162 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 4/35 (11%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYG----GGGYGEAN 115 GGGGYGGG GGGYGGGG GGYG GGGYG N Sbjct: 136 GGGGYGGGNNGGGYGGGG-GGYGGGNNGGGYGGGN 169 [116][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPPP PPP PPPPT Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPT 1440 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1436 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1408 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1437 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +A P P PPPP PP PPPP PPPP PPP P PP Sbjct: 1407 TAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P PPPP PP PPPP PPPP PPP PPP Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPP PPP PPPP Sbjct: 1425 PPPPPPPPPPPPPPPTPPPAPPPPPPPP 1452 [117][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A+P PPPP PP PPPP PPPP PPP PPPP Sbjct: 214 AAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 243 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A P PPPP PP PPPP PPPP PPP PPPP Sbjct: 215 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 99 PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 PPPP PP PPPP PPPP PPP PPPP C Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAC 247 [118][TOP] >UniRef100_A4CWS8 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 7805 RepID=A4CWS8_SYNPV Length = 197 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGGYGGG GGGGYGGGG GGYGGGG G Sbjct: 89 GGGGYGGG-GGGGYGGGGGGGYGGGGGG 115 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 121 GGGGYGGG GGGGYGGGG GGY GGGGY + G Sbjct: 97 GGGGYGGG-GGGGYGGGGGGGYRGGGGGYNDGGGG 130 [119][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 108 SP*PPPP*PPLPPPP*PPPPRPPP*PPPPTH 16 SP PPPP PP PPPP PPPP PPP PPPP + Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 108 SP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 SP PPP PP PPPP PPPP PPP PPPP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P P PPPP PP PPPP PPPP PPP PPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 [120][TOP] >UniRef100_Q41810 Glycine-rich protein n=1 Tax=Zea mays RepID=Q41810_MAIZE Length = 155 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/33 (81%), Positives = 27/33 (81%), Gaps = 5/33 (15%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG----GSGGY-GGGGYG 106 GGGGYGGGRGGGGYGGG G GGY GGGGYG Sbjct: 93 GGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYG 125 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 9/42 (21%) Frame = +2 Query: 23 GGGGYGGGR---------GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG G GGGGYG N G Sbjct: 102 GGGGYGGGGRRDGGGGYGGGGGYGGGGGYGGGGGGYGGGNRG 143 [121][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 123 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 EP P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 EPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 132 ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 E P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 EPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPPP PPP PP P+ Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPQPS 47 [122][TOP] >UniRef100_C0PNT1 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PNT1_MAIZE Length = 94 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/33 (81%), Positives = 27/33 (81%), Gaps = 5/33 (15%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG----GSGGY-GGGGYG 106 GGGGYGGGRGGGGYGGG G GGY GGGGYG Sbjct: 32 GGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYG 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 9/42 (21%) Frame = +2 Query: 23 GGGGYGGGR---------GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG G GGGGYG N G Sbjct: 41 GGGGYGGGGRRDGGGGYGGGGGYGGGGGYGGGGGGYGGGNRG 82 [123][TOP] >UniRef100_B6STA5 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6STA5_MAIZE Length = 155 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/33 (81%), Positives = 27/33 (81%), Gaps = 5/33 (15%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG----GSGGY-GGGGYG 106 GGGGYGGGRGGGGYGGG G GGY GGGGYG Sbjct: 93 GGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYG 125 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 9/42 (21%) Frame = +2 Query: 23 GGGGYGGGR---------GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG G GGGGYG N G Sbjct: 102 GGGGYGGGGRRDGGGGYGGGGGYGGGGGYGGGGGGYGGGNRG 143 [124][TOP] >UniRef100_A1BQW1 Glycine-rich RNA-binding protein (Fragment) n=1 Tax=Nicotiana attenuata RepID=A1BQW1_9SOLA Length = 152 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 4/37 (10%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGG----GGYGEANTG 121 GGGGYGGGR GGYGGGG GGYGG GGYG + G Sbjct: 116 GGGGYGGGRREGGYGGGGGGGYGGGRREGGYGGGSEG 152 [125][TOP] >UniRef100_C0SUI0 Ecdysone receptor B1 isoform (Fragment) n=1 Tax=Anterhynchium flavomarginatum RepID=C0SUI0_9HYME Length = 263 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 145 G G GGG GGGG GGGG GG GGGG G A G +D C+AR Sbjct: 161 GSGGGGGGGGGGGGGGGGGGGGGGGGGGAGGGGSDGCDAR 200 [126][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTH 16 P PPPP PP PPPP PPPP PPP PPP TH Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPSTH 532 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 114 LASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 L+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 486 LSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRT 7 P PPPP PP PPPP PPPP PPP PPPP+ +++ Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKS 534 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 487 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 [127][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -2 Query: 135 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +E+ P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 RETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTCQ 1 P PPPP PP PPPP PPPP PPP PPPP ++ Q Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQ 70 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -2 Query: 150 SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S R P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 STRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P PPPP PP PPPP PPPP PPP PPPP C Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPC 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 PV ++ PPP PP PPPP PPPP PPP PPPP Sbjct: 9 PVASTRETPPPPPPPPPPPPPPPPPPPPPPPPP 41 [128][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPPP PPP PPPPT Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPT 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 [129][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/56 (48%), Positives = 34/56 (60%) Frame = -2 Query: 186 PKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P T + + S+ + Q+S +S PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 470 PPTPPDEESKKNSECSSQDSTRGGPSSTPPPPPPPPPPPPPPPPPPPPPPPPPPPS 525 [130][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRT 7 P PPPP PP PPPP PPPP PPP PPPP RT Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRT 49 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRT 7 P PPPP PP PPPP PPPP PPP PPPP +T Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKT 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRT 7 P PPPP PP PPPP PPPP PPP PPP T T Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTT 50 [131][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -2 Query: 150 SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S+R P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 SRRPAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = -2 Query: 141 ALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A+ + P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 AMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNR 10 P PPPP PP PPPP PPPP PPP PPPP R Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRR 116 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNR 10 P PPPP PP PPPP PPPP PPP PPPP R Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 115 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 [132][TOP] >UniRef100_A5K6G3 Exoribonuclease, putative n=1 Tax=Plasmodium vivax RepID=A5K6G3_PLAVI Length = 1353 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = +2 Query: 23 GGGGYGGG-RGGGGYGGGGSGGYGGGGYGEANTGS 124 GGGGYGGG GGGGYGGG GGYG GGYG G+ Sbjct: 1084 GGGGYGGGGHGGGGYGGGYGGGYGNGGYGNGGYGN 1118 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/46 (58%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGG--SGGYGGGGYGEANTGSADSCNARFDY 154 G GGYGGG GGGYGGGG SGGYG GGYG G + R +Y Sbjct: 1117 GNGGYGGGGHGGGYGGGGYGSGGYGSGGYGSGGYGGHVGRDHRNNY 1162 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG-GSGGYGGGGYGEANTG 121 GGGG+GGG GGGYGGG G+GGYG GGYG G Sbjct: 1089 GGGGHGGGGYGGGYGGGYGNGGYGNGGYGNGGYG 1122 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 2/36 (5%) Frame = +2 Query: 23 GGGGYG-GGRGGGGYGGGG-SGGYGGGGYGEANTGS 124 G GGYG GG G GGYGGGG GGYGGGGYG GS Sbjct: 1107 GNGGYGNGGYGNGGYGGGGHGGGYGGGGYGSGGYGS 1142 [133][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -2 Query: 144 RALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 R L P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 RLLHSLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNR 10 P PPPP PP PPPP PPPP PPP PPPP R Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNR 10 P PPPP PP PPPP PPPP PPP PPPP R Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRRAR 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [134][TOP] >UniRef100_Q5KFM6 ATP-dependent RNA helicase DBP2-A n=1 Tax=Filobasidiella neoformans RepID=DBP2_CRYNE Length = 540 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 3/30 (10%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGGG---SGGYGGGGYG 106 GGGYGGG GGGGYGGGG GGYGGGGYG Sbjct: 13 GGGYGGGGGGGGYGGGGGGYGGGYGGGGYG 42 [135][TOP] >UniRef100_UPI0000F2C630 PREDICTED: similar to zinc finger homeodomain 4, n=1 Tax=Monodelphis domestica RepID=UPI0000F2C630 Length = 3606 Score = 47.0 bits (110), Expect(2) = 4e-07 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 28 +Q + L +P P PP PP PPPP PPPP PP PP Sbjct: 1990 IQSTPPTPLQAPPPTPPPPPPPPPPPPPPPPPPSAPP 2026 Score = 30.4 bits (67), Expect(2) = 4e-07 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 331 PP*PPPPAP*PPPPLPPGKIGRRK 260 PP PPPP P PP P +G K Sbjct: 1966 PPPPPPPPPLPPTPSQSSSVGSGK 1989 [136][TOP] >UniRef100_Q4S986 Chromosome 3 SCAF14700, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4S986_TETNG Length = 1204 Score = 40.0 bits (92), Expect(2) = 4e-07 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Frame = -2 Query: 150 SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP----*PPPP 22 S L P L PPPP PP P PPPP PPP PPPP Sbjct: 635 SAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPP 681 Score = 37.4 bits (85), Expect(2) = 4e-07 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 6/29 (20%) Frame = -1 Query: 337 PPPP*PPPPA------P*PPPPLPPGKIG 269 PPPP PPPPA P PPPP PP G Sbjct: 610 PPPPPPPPPALGAMGAPPPPPPPPPSAAG 638 [137][TOP] >UniRef100_A9RMD2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RMD2_PHYPA Length = 1127 Score = 48.5 bits (114), Expect(2) = 4e-07 Identities = 26/67 (38%), Positives = 31/67 (46%), Gaps = 11/67 (16%) Frame = -2 Query: 189 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPP-----------PRP 43 RP T + + L + +E + P PPPP P PPPP PPP P P Sbjct: 497 RPATLSNVATSPPPRSPLGKGSEDNTSPPSPPPPPSPPPPPPAPPPPPFSTNLPSKKPAP 556 Query: 42 PP*PPPP 22 PP PPPP Sbjct: 557 PPSPPPP 563 Score = 28.9 bits (63), Expect(2) = 4e-07 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = -1 Query: 337 PPPP*PPPPAP*PPPPLP---PGKIG 269 PPPP P P P P PP P P ++G Sbjct: 439 PPPPLPVPFQPLPSPPYPLRAPSRLG 464 [138][TOP] >UniRef100_Q015R2 RhoA GTPase effector DIA/Diaphanous (ISS) n=1 Tax=Ostreococcus tauri RepID=Q015R2_OSTTA Length = 1105 Score = 42.0 bits (97), Expect(2) = 4e-07 Identities = 22/44 (50%), Positives = 23/44 (52%), Gaps = 6/44 (13%) Frame = -2 Query: 135 QESAEPVLASP*PPPP*PPLPPPP*PPP------PRPPP*PPPP 22 Q + V A P PPPP PP PPPP P P P PP PP P Sbjct: 460 QSANANVSAPPPPPPPPPPPPPPPPPRPSLGPIVPTPPAPPPVP 503 Score = 35.4 bits (80), Expect(2) = 4e-07 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 6/39 (15%) Frame = -1 Query: 337 PPPP*PPPP------AP*PPPPLPPGKIGRRKTCQATLS 239 PPPP PPPP PPPP PP R ++ A +S Sbjct: 429 PPPPPPPPPKRIGCDITHPPPPPPPPPFARAQSANANVS 467 [139][TOP] >UniRef100_B9S1L1 DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9S1L1_RICCO Length = 820 Score = 44.7 bits (104), Expect(2) = 4e-07 Identities = 29/78 (37%), Positives = 33/78 (42%), Gaps = 13/78 (16%) Frame = -2 Query: 216 KKTFAATCTRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPP---------P 64 K + A T K Q +++ S P P PPPP PPLPPP P Sbjct: 559 KDSTALTALTAKRVPQPPPPPNFNKSVSSSPPPPPPPPPPPPPPPPLPPPNLCSKDIYMP 618 Query: 63 *PP----PPRPPP*PPPP 22 P PP PPP PPPP Sbjct: 619 PPATSKGPPLPPPPPPPP 636 Score = 32.7 bits (73), Expect(2) = 4e-07 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 10/36 (27%) Frame = -1 Query: 358 LQPRA**PPPP*PPPP----------AP*PPPPLPP 281 LQP PPPP PPPP P P PPLPP Sbjct: 498 LQPFVTQPPPPPPPPPPISSQSPLSTQPPPFPPLPP 533 Score = 43.5 bits (101), Expect(2) = 5e-07 Identities = 26/65 (40%), Positives = 27/65 (41%), Gaps = 22/65 (33%) Frame = -2 Query: 150 SKRALQESAEPVLASP*PPPP*PPL------------PPPP*PP----------PPRPPP 37 S + Q S P P PPPP PP PPPP PP PP PPP Sbjct: 652 SSTSRQSSLSPSPPPPPPPPPLPPRQPSSANSLTEPPPPPPLPPSGRNLSNAPRPPAPPP 711 Query: 36 *PPPP 22 PPPP Sbjct: 712 PPPPP 716 Score = 33.5 bits (75), Expect(2) = 5e-07 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = -1 Query: 337 PPPP*--------PPPPAP*PPPPLPPGKIGRRKTC 254 PPPP PPPP P PPPP PP + C Sbjct: 576 PPPPNFNKSVSSSPPPPPPPPPPPPPPPPLPPPNLC 611 Score = 46.2 bits (108), Expect(2) = 1e-06 Identities = 26/56 (46%), Positives = 28/56 (50%), Gaps = 9/56 (16%) Frame = -2 Query: 150 SKRALQESAEPVLASP*PPPP*PP---------LPPPP*PPPPRPPP*PPPPTHNR 10 S R L + P A P PPPP PP +PPPP P P P P PPPP NR Sbjct: 696 SGRNLSNAPRPP-APPPPPPPPPPSSGPLPSTSIPPPPPPAPIHPAPPPPPPVPNR 750 Score = 29.6 bits (65), Expect(2) = 1e-06 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = -1 Query: 334 PPP*PPPPAP-----*PPPPLPPGKIGRRKT 257 PPP PPPP P PPPP P R+ + Sbjct: 629 PPPPPPPPPPFSSSRTPPPPPPFSSTSRQSS 659 [140][TOP] >UniRef100_Q4WCV2 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus fumigatus RepID=Q4WCV2_ASPFU Length = 643 Score = 45.4 bits (106), Expect(2) = 4e-07 Identities = 24/48 (50%), Positives = 27/48 (56%), Gaps = 8/48 (16%) Frame = -2 Query: 141 ALQESAEPVLASP*PPPP*PPLPP----PP*PPPPRP----PP*PPPP 22 A + + P + S PPPP PP PP PP PPPP P PP PPPP Sbjct: 458 ASRPTPPPPVTSAVPPPPPPPPPPSTSVPPSPPPPPPVSSGPPAPPPP 505 Score = 32.0 bits (71), Expect(2) = 4e-07 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 334 PPP*PPPPAP*PPPPLPPGKIGRRKT 257 PPP PP P PPPP PP R T Sbjct: 437 PPPPPPARNPVPPPPPPPVPAASRPT 462 [141][TOP] >UniRef100_B4MEB1 GJ17213 n=1 Tax=Drosophila virilis RepID=B4MEB1_DROVI Length = 511 Score = 50.1 bits (118), Expect(2) = 4e-07 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = +2 Query: 38 GGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARF 148 GG RGGGG GGGG+GG GGGG+G G+ N RF Sbjct: 204 GGNRGGGGGGGGGAGGGGGGGFGGGGGGNGGRGNDRF 240 Score = 27.3 bits (59), Expect(2) = 4e-07 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +3 Query: 261 FLLPIFPGGNGGG--GYGAG--GGGYGGGGY 341 F+ P GG GG G+G G GGG+GG + Sbjct: 270 FINPWANGGGGGDADGFGVGNNGGGFGGNNF 300 [142][TOP] >UniRef100_B4NC79 GK25130 n=1 Tax=Drosophila willistoni RepID=B4NC79_DROWI Length = 200 Score = 48.9 bits (115), Expect(2) = 4e-07 Identities = 30/61 (49%), Positives = 33/61 (54%), Gaps = 12/61 (19%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGG-----------GGYGEANT-GSADSCNARFDYWVTS 166 GGG YG G G GGYG GG+GGYGG GG G A G+A A+FDY V Sbjct: 94 GGGAYGAG-GAGGYGAGGAGGYGGAGAGGWQGQGRGGRGGAGAGGNAWGNPAQFDYTVNH 152 Query: 167 A 169 A Sbjct: 153 A 153 Score = 28.5 bits (62), Expect(2) = 4e-07 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 282 GGNGGGGYGAGGGGYGGG 335 G G G YG G YGGG Sbjct: 162 GAGGAGSYGGGAASYGGG 179 [143][TOP] >UniRef100_B3MSW9 GF23248 n=1 Tax=Drosophila ananassae RepID=B3MSW9_DROAN Length = 188 Score = 45.4 bits (106), Expect(2) = 4e-07 Identities = 22/36 (61%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGG---GGSGGYGGGGYGEANTG 121 GGGG+GGG GGG GG GG GG GGGGY + G Sbjct: 32 GGGGFGGGFGGGFGGGSSFGGGGGGGGGGYQAVSGG 67 Score = 32.0 bits (71), Expect(2) = 4e-07 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 237 LLKVA*QVFLLPIFPGGNGGGGYGAGGGGYGGG 335 LL+ Q+ L G GGGG G GGGGY G Sbjct: 80 LLEQVRQILLNEESKQGGGGGGGGGGGGGYPSG 112 [144][TOP] >UniRef100_Q9VX67 CG5172, isoform D n=1 Tax=Drosophila melanogaster RepID=Q9VX67_DROME Length = 172 Score = 52.4 bits (124), Expect(2) = 4e-07 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 GGGGYGGG GGGGYGGGG G G GG G+ N G + Y Sbjct: 28 GGGGYGGG-GGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSY 70 Score = 25.0 bits (53), Expect(2) = 4e-07 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 3/24 (12%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGY---GGGG 338 + GG+ GG G G GG+ GGGG Sbjct: 70 YGGGSQGGHGGGGQGGWQKNGGGG 93 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = +2 Query: 8 VLLCVGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCN 139 ++ G GGG GGGGYGGGG GGYGGGG G++ G N Sbjct: 14 LIALTSAGLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKN 57 [145][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 123 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 E L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 EIYLPPPLPPPPPPPRPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPRPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P L P PPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPPP 48 [146][TOP] >UniRef100_UPI0000E4626F PREDICTED: similar to heterogeneous nuclear ribonucleoprotein A2/B1 n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E4626F Length = 360 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/33 (75%), Positives = 27/33 (81%), Gaps = 4/33 (12%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG----GSGGYGGGGYGE 109 GGGGYGGG+GGGGYGGG G GG GGGGYG+ Sbjct: 326 GGGGYGGGQGGGGYGGGNSGYGGGGGGGGGYGK 358 [147][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRT 7 P PPPP PP PPPP PPPP PPP PPPP RT Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPRT 1507 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P L P PPPP PP PPPP PPPP PPP PPP Sbjct: 1472 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1503 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPP 1500 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P+ P PPPP PP PPPP PPPP PPP PP P Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 1505 [148][TOP] >UniRef100_Q3B0Y9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. CC9902 RepID=Q3B0Y9_SYNS9 Length = 196 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGG-----SGGYGGGGYGEANTGSADSCNAR 145 GGGGYGGG GGGGYGGGG GG GGGGYG G AR Sbjct: 98 GGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGDRPSGAR 143 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 1/29 (3%) Frame = +2 Query: 23 GGGGYGGGRGGGGYG-GGGSGGYGGGGYG 106 GGGGYGGG GGGGYG GGG GGYGGGG G Sbjct: 89 GGGGYGGGGGGGGYGGGGGGGGYGGGGGG 117 [149][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 132 ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 E P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 319 EQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +++ P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 318 VEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 135 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 Q P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 320 QPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP P PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPEPPPQPDPP 372 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P PPPP PP PPPP PPPP PPP PPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPEPPP 367 [150][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PP-----PPRPPP*PPPP 22 LQ S + AS PPPP PP PPPP PP PPRPPP PPPP Sbjct: 421 LQRSETEIFASTPPPPPPPPPPPPPPPPTPPPPPPRPPPPPPPP 464 [151][TOP] >UniRef100_B9H173 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H173_POPTR Length = 207 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 5/38 (13%) Frame = +2 Query: 23 GGGGYGGGRGGGGYG-----GGGSGGYGGGGYGEANTG 121 G GG GGGRGGGGYG GGG GGYGGGGYG G Sbjct: 88 GSGGRGGGRGGGGYGGGGGYGGGGGGYGGGGYGGGRRG 125 [152][TOP] >UniRef100_A7PDA4 Chromosome chr17 scaffold_12, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PDA4_VITVI Length = 277 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/39 (71%), Positives = 29/39 (74%), Gaps = 6/39 (15%) Frame = +2 Query: 23 GGGGYGGGRGG---GGYGGGG---SGGYGGGGYGEANTG 121 GGGGYGGG GG GGYGGGG SGGYGGGGYG + G Sbjct: 127 GGGGYGGGGGGYGGGGYGGGGYGGSGGYGGGGYGGGSGG 165 [153][TOP] >UniRef100_A5B074 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B074_VITVI Length = 272 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/39 (71%), Positives = 29/39 (74%), Gaps = 6/39 (15%) Frame = +2 Query: 23 GGGGYGGGRGG---GGYGGGG---SGGYGGGGYGEANTG 121 GGGGYGGG GG GGYGGGG SGGYGGGGYG + G Sbjct: 127 GGGGYGGGGGGYGGGGYGGGGYGGSGGYGGGGYGGGSGG 165 [154][TOP] >UniRef100_C3Y7T8 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3Y7T8_BRAFL Length = 183 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGGY GGRGGG YGGGG GGYGGGGYG Sbjct: 91 GGGGYRGGRGGGRYGGGG-GGYGGGGYG 117 [155][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P PPPP PP PPPP PPPP PPP PPPP + C Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLC 85 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P PPPP PP PPPP PPPP PPP PPPP C Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLCC 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 [156][TOP] >UniRef100_B5DJN5 GA28844 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DJN5_DROPS Length = 400 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGYGGG GGGGYGGGG GGYGGGG+G Sbjct: 334 GGGYGGG-GGGGYGGGGGGGYGGGGHG 359 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 8/45 (17%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGG--------GGYGEANTGSADS 133 GGGGYGGG GGGGYGGGG GG+GG GGYG SA S Sbjct: 341 GGGGYGGG-GGGGYGGGGHGGHGGLGGAGGKHGGYGGGAHSSASS 384 [157][TOP] >UniRef100_B4LUJ0 GJ17322 n=1 Tax=Drosophila virilis RepID=B4LUJ0_DROVI Length = 418 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +2 Query: 23 GGGGYGGG-RGGGGYGGGG--SGGYGGGGYGEANTGSADS 133 GGGG+GGG GGGG+GGGG GGYGGGGYG G A S Sbjct: 364 GGGGFGGGGHGGGGHGGGGHGGGGYGGGGYGGGGKGGASS 403 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/34 (67%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGS-GGYGGGGYGEANTG 121 GGGG GGG GGGG+GGG + GG+GGGG+G +TG Sbjct: 130 GGGGLGGGHGGGGFGGGSAGGGHGGGGFGGGSTG 163 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = +2 Query: 23 GGGGYGGG-RGGGGYGGG--GSGGYGGGGYGEANTGSADSCNA 142 GGGG+GGG GGGG+GGG G GGYGGGG G A++ ++ S +A Sbjct: 369 GGGGHGGGGHGGGGHGGGGYGGGGYGGGGKGGASSSASASASA 411 [158][TOP] >UniRef100_Q0UIP7 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0UIP7_PHANO Length = 668 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGY GGG GGYGGGGYG G Sbjct: 261 GGGGYGGG--GGGYSGGGGGGYGGGGYGGGGGG 291 [159][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 114 LASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 L+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 983 LSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1013 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 987 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 1014 [160][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/41 (58%), Positives = 26/41 (63%) Frame = -2 Query: 123 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTCQ 1 +P A PPPP PP PPPP PPPP PPP PPPP + Q Sbjct: 345 QPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPASTKPPQ 385 [161][TOP] >UniRef100_C0P2F3 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0P2F3_MAIZE Length = 326 Score = 45.4 bits (106), Expect(2) = 5e-07 Identities = 22/48 (45%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -2 Query: 147 KRALQESAEPVLASP*PPPP*PPLPPP---P*PPPPRPPP*PPPPTHN 13 +RA P + P PP P P PPP P PPPP P P PP P H+ Sbjct: 111 RRAPPPPPSPPIRPPPPPTPRPQAPPPPHLPMPPPPAPVPPPPSPPHH 158 Score = 31.6 bits (70), Expect(2) = 5e-07 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -1 Query: 337 PPPP*--PPPPAP*PPPPLPPGKIGRR 263 PPPP PPPPA PPPP P RR Sbjct: 44 PPPPRRAPPPPALAPPPPTMPPPPPRR 70 [162][TOP] >UniRef100_B3NWS9 GG18194 n=1 Tax=Drosophila erecta RepID=B3NWS9_DROER Length = 211 Score = 48.5 bits (114), Expect(2) = 6e-07 Identities = 26/49 (53%), Positives = 29/49 (59%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWVTSA 169 G G G GRGG G+G GG+GG+ GG G A GSA A FDY V A Sbjct: 126 GWQGAGAGRGGAGFGRGGAGGWQGGA-GGAGAGSAWGNPAEFDYTVNHA 173 Score = 28.5 bits (62), Expect(2) = 6e-07 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 285 GNGGGGYGAGGGGYGGGG 338 G GG YG G YGG G Sbjct: 178 GGAGGAYGGAAGAYGGAG 195 [163][TOP] >UniRef100_B4H321 GL13352 n=1 Tax=Drosophila persimilis RepID=B4H321_DROPE Length = 191 Score = 42.4 bits (98), Expect(2) = 6e-07 Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGG---YGEANTGSADSCNARFDYWV 160 G GG GGG GGGG G GG GG+GGGG +G + G + D +V Sbjct: 35 GHGGGGGGLGGGG-GWGGGGGWGGGGGQKWGGGHGGGGQGGASTIDVYV 82 Score = 34.7 bits (78), Expect(2) = 6e-07 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGGGG 338 +P G GGG + GGGG GGGG Sbjct: 117 YPSGGGGGFHNGGGGGGGGGG 137 [164][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P PPPP PP PPPP PPPP PPP PPPP C Sbjct: 295 PPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPC 328 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 259 PPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPP 291 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P P PPPP PP PPPP PPPP PPP PPPP C Sbjct: 281 PPCPPPCPPPP-PPCPPPPPPPPPCPPPPPPPPPPPPPC 318 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P P PPPP PP PPPP PPPP PPP PPP Sbjct: 255 PPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPP 286 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P PPPP PP PPPP PPPP PPP PPP Sbjct: 309 PPPPPPPPPCPPPPPPPPPCPPPCPPP 335 [165][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -2 Query: 117 VLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 V+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 232 VVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 135 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 Q P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 229 QVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 [166][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A P PPPP PP PPPP PPPP PPP PPPP Sbjct: 231 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 138 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 L E + +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 221 LAECLDAAGFAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 [167][TOP] >UniRef100_Q7V9D6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9313 RepID=Q7V9D6_PROMM Length = 199 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 145 GGGGYGGG GG G GG G GGYGGGGYG G AR Sbjct: 112 GGGGYGGGGGGYGGGGYGGGGYGGGGYGGGGGGGDRGSGAR 152 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 6/39 (15%) Frame = +2 Query: 23 GGGGYGGGRGGGGYG------GGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYG GGG GGYGGGGYG G Sbjct: 97 GGGGYGGG-GGGGYGGGGGGYGGGGGGYGGGGYGGGGYG 134 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 2/34 (5%) Frame = +2 Query: 26 GGGYGGGRGGGG--YGGGGSGGYGGGGYGEANTG 121 GGGYGGG GGGG YGGGG GGYGGGG G G Sbjct: 87 GGGYGGGGGGGGGGYGGGGGGGYGGGGGGYGGGG 120 [168][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A P PPPP PP PPPP PPPP PPP PPPP Sbjct: 230 APPAPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRT 7 A+P PPP PP PPPP PPPP PPP PPPP T Sbjct: 229 AAPPAPPPPPPPPPPPPPPPPPPPPPPPPPPEETT 263 [169][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = -2 Query: 141 ALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A++ P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 645 AVRSVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 [170][TOP] >UniRef100_B9MIH3 RNP-1 like RNA-binding protein n=1 Tax=Diaphorobacter sp. TPSY RepID=B9MIH3_DIAST Length = 155 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +2 Query: 23 GGGGYGGGR-GGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGGR GGGGYGGGG GGYGGGG G + G Sbjct: 96 GGGGYGGGRSGGGGYGGGG-GGYGGGGGGRSEGG 128 [171][TOP] >UniRef100_C1ZIK1 RRM domain-containing RNA-binding protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZIK1_PLALI Length = 146 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGGYGGG GGGGYGGGG GGYGGGG G Sbjct: 118 GGGGYGGGGGGGGYGGGG-GGYGGGGGG 144 [172][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A P PPPP PP PPPP PPPP PPP PPPP Sbjct: 223 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 252 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPPP N Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPCN 256 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 99 PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 PPPP PP PPPP PPPP PPP PPPP C Sbjct: 224 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPC 255 [173][TOP] >UniRef100_Q40427 RNA-binding glycine-rich protein-1b n=1 Tax=Nicotiana sylvestris RepID=Q40427_NICSY Length = 148 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 7/35 (20%) Frame = +2 Query: 23 GGGGYGGGR---GGGGYGG----GGSGGYGGGGYG 106 GGGGYGGGR GGGGYGG GG GGYGGGGYG Sbjct: 109 GGGGYGGGRREGGGGGYGGGRREGGGGGYGGGGYG 143 [174][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 SPPPSPPPPFPPPPSPPPPPPPLPPPPSPPPPPPPP 72 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P P PPPP PPLPPPP PPPP PPP PPP Sbjct: 45 PFPPPPSPPPPPPPLPPPPSPPPPPPPPPPPP 76 [175][TOP] >UniRef100_A8JAG8 Argonaute-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JAG8_CHLRE Length = 1037 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGG 100 GGGGYGGG GGGG GGGG GGYGGGG Sbjct: 52 GGGGYGGGGGGGGRGGGGGGGYGGGG 77 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 11/44 (25%) Frame = +2 Query: 23 GGGGYGGG-----------RGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG RGGGGYGGGG GG GGGGYG G Sbjct: 19 GGGGYGGGGGGGRGGGGGDRGGGGYGGGGRGGGGGGGYGGGGGG 62 [176][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 123 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 E +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 EVTAVNPAPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = -2 Query: 147 KRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 K+ + V +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 KKDWKPEVTAVNPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 + P P PPPP PP PPPP PPPP PPP PPP Sbjct: 40 AVNPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [177][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 123 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 E +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 EVTAVNPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -2 Query: 123 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +P + + PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 KPEVTAVNPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 + P P PPPP PP PPPP PPPP PPP PPP Sbjct: 40 AVNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [178][TOP] >UniRef100_O02049 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans RepID=O02049_CAEEL Length = 259 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +2 Query: 20 VGGGGYGGGR-GGGGYGGGGSGGYGGGGYGEANTG 121 +GGGGYGGG GGGG GGGG GGYGGGGYG G Sbjct: 109 MGGGGYGGGGYGGGGDGGGGYGGYGGGGYGGMGGG 143 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/51 (54%), Positives = 29/51 (56%), Gaps = 12/51 (23%) Frame = +2 Query: 20 VGGGGYGGG-RGGGGYGGGGSGGYG-----------GGGYGEANTGSADSC 136 +GGGGYGGG GGGGYGGGG GGYG GGGYG G C Sbjct: 200 MGGGGYGGGGMGGGGYGGGGDGGYGPSGGYGGGYGPGGGYGMGGGGGGGGC 250 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = +2 Query: 29 GGYGGG-RGGGGYGGGGSGGYGGGGYGEANTG 121 GGYGGG GGGGYGGGG GGYGGGG+G G Sbjct: 163 GGYGGGGMGGGGYGGGGDGGYGGGGFGGGGMG 194 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 8/42 (19%) Frame = +2 Query: 20 VGGGGYGGGR----GGGGYGGGGSGGY----GGGGYGEANTG 121 +GGGGYGGG GGGG+GGGG GGY GGGGYG G Sbjct: 170 MGGGGYGGGGDGGYGGGGFGGGGMGGYGGGMGGGGYGGGGMG 211 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/30 (80%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG--GSGGYGGGGYG 106 G GGYGGG GGGGYGGG G GGYGGGG G Sbjct: 192 GMGGYGGGMGGGGYGGGGMGGGGYGGGGDG 221 [179][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 114 LASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 LCCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [180][TOP] >UniRef100_A7SMB3 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SMB3_NEMVE Length = 218 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = +2 Query: 23 GGGGYGGGR-GGGGYGGG--GSGGYGGGGYGEANTGSADS 133 GGGGYGGG GGGGYGGG G GGYGGGGYG G S Sbjct: 136 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGS 175 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 6/39 (15%) Frame = +2 Query: 23 GGGGYGGGR---GGGGYGG---GGSGGYGGGGYGEANTG 121 GGGGYGGG GGGGYGG GG GGYGGGGYG +G Sbjct: 156 GGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSG 194 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = +2 Query: 23 GGGGYG-GGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYG GG GGGGYGGGG GG GGGGYG + G Sbjct: 146 GGGGYGGGGHGGGGYGGGGYGG-GGGGYGGSGYG 178 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 3/36 (8%) Frame = +2 Query: 23 GGGGYGG-GRGGGGYGGG--GSGGYGGGGYGEANTG 121 GGGGY G GRGGGGYGGG G GGYGGGG+G G Sbjct: 126 GGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYG 161 [181][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/62 (46%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = -2 Query: 201 ATCTRPKTQHQADVTQ*SKRALQ--ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 28 A +P+ Q Q D Q ++ Q E + P PPPP P PPPP PPPP PPP PP Sbjct: 9 AGSAQPQPQPQIDQQQQQQQQQQHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPP 68 Query: 27 PP 22 PP Sbjct: 69 PP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = -2 Query: 189 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPL--PPPP*PPPPRPPP*PPPPT 19 RP Q QA T + + P LA P PPPP PP PPPP PPPP P PPPPT Sbjct: 1924 RPPAQAQAPATP-TITSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPT 1981 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/56 (44%), Positives = 30/56 (53%) Frame = -2 Query: 189 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +P+ Q Q + Q+ + P PPPP P PPPP PPPP PPP PPPP Sbjct: 17 QPQIDQQQQQQQQQQHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/52 (48%), Positives = 26/52 (50%) Frame = -2 Query: 177 QHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 QHQ Q + P P PPPP PP PPPP PPPP P P P PP Sbjct: 31 QHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 [182][TOP] >UniRef100_C9SP10 ATP-dependent RNA helicase DBP2 n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9SP10_9PEZI Length = 577 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 5/41 (12%) Frame = +2 Query: 23 GGGGYGGGRGG-----GGYGGGGSGGYGGGGYGEANTGSAD 130 GGGGYGGG GG GGYGGGG GGYGGGG G G D Sbjct: 6 GGGGYGGGGGGYGGGGGGYGGGGGGGYGGGGRGGYGGGRND 46 [183][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/62 (46%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = -2 Query: 201 ATCTRPKTQHQADVTQ*SKRALQ--ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 28 A +P+ Q Q D Q ++ Q E + P PPPP P PPPP PPPP PPP PP Sbjct: 9 AGSAQPQPQPQIDQQQQQQQQQQHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPP 68 Query: 27 PP 22 PP Sbjct: 69 PP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = -2 Query: 189 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPL--PPPP*PPPPRPPP*PPPPT 19 RP Q QA T + + P LA P PPPP PP PPPP PPPP P PPPPT Sbjct: 1827 RPPAQAQAPATP-TITSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPT 1884 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/56 (44%), Positives = 30/56 (53%) Frame = -2 Query: 189 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +P+ Q Q + Q+ + P PPPP P PPPP PPPP PPP PPPP Sbjct: 17 QPQIDQQQQQQQQQQHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/52 (48%), Positives = 26/52 (50%) Frame = -2 Query: 177 QHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 QHQ Q + P P PPPP PP PPPP PPPP P P P PP Sbjct: 31 QHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 [184][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPP 93 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPS 89 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P L P PPPP PP PPPP PPPP PPP PPP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPP 92 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNR 10 P PPPP PP PPPP PP P PPP PPPP R Sbjct: 72 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRR 103 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNR 10 P PPPP PP PPPP PPP PPP PPPP R Sbjct: 71 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQR 102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = -2 Query: 135 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 + + P P PPPP PP PPPP PPPP PPP P PP Sbjct: 54 ENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPP 91 [185][TOP] >UniRef100_UPI0000DB6C07 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6C07 Length = 431 Score = 43.5 bits (101), Expect(2) = 7e-07 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 7/55 (12%) Frame = +2 Query: 26 GGGYGGGRGGG---GYGGGGSGGY----GGGGYGEANTGSADSCNARFDYWVTSA 169 GGG+GGG GGG G+GGGG G+ GGGG+G + G + D ++S+ Sbjct: 123 GGGFGGGFGGGHGGGHGGGGFSGHVSFGGGGGHGGGHGGGFGGKSGHGDVIISSS 177 Score = 33.1 bits (74), Expect(2) = 7e-07 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 4/23 (17%) Frame = +3 Query: 282 GGNGGGG----YGAGGGGYGGGG 338 GG GGG +G GGGG+GGGG Sbjct: 190 GGGGGGSIIEHHGGGGGGFGGGG 212 [186][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [187][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 A+P PPPP PP PPPP PPPP PPP PPPPT Sbjct: 220 AAPPPPPPPPPPPPPPPPPPPPPPP-PPPPT 249 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -2 Query: 96 PPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 PPP PP PPPP PPPP PPP PPPP C Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPPPTTPC 252 [188][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 501 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P SP PPPP P PPPP PPPP PPP PPPP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PPPP PP P PP PPPP PPP PPPP Sbjct: 485 SPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PP P PPP PPPP Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P P PPP PP PPPP PPPP PPP PPPP Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 [189][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 94 PPPPPPPPPSPPPPSPPPPSPPPPPPPP 121 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPP PPP PPPPT Sbjct: 107 PSPPPPSPPPPPPPPPPPSPPPPSPPPPT 135 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP P PP PPPP PPP PPPP+ Sbjct: 102 PSPPPPSPPPPSPPPPPPPPPPPSPPPPS 130 [190][TOP] >UniRef100_C5Z4J0 Putative uncharacterized protein Sb10g021810 n=1 Tax=Sorghum bicolor RepID=C5Z4J0_SORBI Length = 199 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/55 (54%), Positives = 30/55 (54%), Gaps = 10/55 (18%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGS----GGYGGGGYGEANTGS------ADSCNARFDYW 157 GGGGYGGG GGGYGGGG GGYGGGG G G A S DYW Sbjct: 38 GGGGYGGGGSGGGYGGGGGGGGYGGYGGGGGGSGYGGGGGGYTPAYSGTGTCDYW 92 [191][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/32 (75%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPR--PPP*PPPPTH 16 P PPPP PP PPPP PPPPR PPP PPPP H Sbjct: 1095 PPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVH 1126 [192][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 257 PSPPPPPPPSPPPPPPPPPPPPPPPPPPS 285 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = -2 Query: 120 PVLASP*PP---PP*PPLPPPP*PPPPRPPP*PPPP 22 P SP PP PP PP PPPP PPPP PPP PPPP Sbjct: 244 PAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPP 279 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P+ SP PPPP P PPPP PPPP PPP PP P+ Sbjct: 254 PLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPS 287 [193][TOP] >UniRef100_B7Q3U9 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U9_IXOSC Length = 280 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/30 (76%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG--GSGGYGGGGYG 106 GGGGYGGG GGGG+GGG G GG+GGGG+G Sbjct: 21 GGGGYGGGHGGGGFGGGGFGGGGFGGGGFG 50 [194][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNR 10 P PPPP PP PPPP PPPP PPP PPPP R Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQR 108 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 [195][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P PPPP PP PPPP PPPP PPP PPPP N Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLCN 50 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTC 4 P PPPP PP PPPP PPPP PPP PPPP C Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLC 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [196][TOP] >UniRef100_B4NET8 GK25701 n=1 Tax=Drosophila willistoni RepID=B4NET8_DROWI Length = 211 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGG GG GGGYGGGG GGYGGGGYG Sbjct: 22 GGGGGGGWSSGGGYGGGGGGGYGGGGYG 49 [197][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 114 LASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 265 ITGPGPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 135 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 QE P P PPPP PP PPPP PPPP PPP PPP Sbjct: 263 QEITGPGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 [198][TOP] >UniRef100_P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein n=2 Tax=Zea mays RepID=GRPA_MAIZE Length = 157 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGG-GSGGY-GGGGYGEANTG 121 GGGGYGGGRGGGGYGGG GGY GGGGYG G Sbjct: 92 GGGGYGGGRGGGGYGGGRRDGGYGGGGGYGGRREG 126 [199][TOP] >UniRef100_Q6CIV2 ATP-dependent RNA helicase DBP2 n=1 Tax=Kluyveromyces lactis RepID=DBP2_KLULA Length = 554 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GG G+GGGRGG G+GG G GGYGGGGYG G Sbjct: 509 GGRGFGGGRGGRGFGGRGDGGYGGGGYGGGRGG 541 [200][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 54.3 bits (129), Expect(2) = 9e-07 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 8/50 (16%) Frame = -2 Query: 144 RALQESAEPVLASP*PPPP*--------PPLPPPP*PPPPRPPP*PPPPT 19 RA E P +P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 1182 RAPSEPGRPPPTAPSPPPPGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPS 1231 Score = 21.9 bits (45), Expect(2) = 9e-07 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 3/22 (13%) Frame = -1 Query: 322 PPPPAP*PP---PPLPPGKIGR 266 PPP AP P PP P + GR Sbjct: 1168 PPPRAPSEPERSPPRAPSEPGR 1189 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 3/31 (9%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPP---RPPP*PPPP 22 P PPPP PPLPPPP PPPP PPP PPPP Sbjct: 1217 PPPPPPPPPLPPPPSPPPPPPSPPPPSPPPP 1247 [201][TOP] >UniRef100_Q2W222 RTX toxins and related Ca2+-binding protein n=1 Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W222_MAGSA Length = 1274 Score = 53.1 bits (126), Expect(2) = 9e-07 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = -2 Query: 150 SKRALQESAEPVLASP*PPPP*PPLPPPP*PP---PPRPPP*PPPP 22 ++ A+ + A P P PPPP PP PPPP PP PP PPP PPPP Sbjct: 263 AEAAVVDVAPPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPP 308 Score = 23.1 bits (48), Expect(2) = 9e-07 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -1 Query: 334 PPP*PPPPAP*PPPPLPPGKIG 269 PPP P P P P P G G Sbjct: 225 PPPAVAPALPAAPAPAPAGGTG 246 [202][TOP] >UniRef100_A0E1N2 Chromosome undetermined scaffold_73, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0E1N2_PARTE Length = 442 Score = 40.4 bits (93), Expect(2) = 9e-07 Identities = 18/29 (62%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -1 Query: 337 PPPP*PPPP--AP*PPPPLPPGKIGRRKT 257 PPPP PPPP AP PPPP PPG + T Sbjct: 78 PPPPPPPPPKGAPPPPPPRPPGPPAAKPT 106 Score = 35.8 bits (81), Expect(2) = 9e-07 Identities = 24/61 (39%), Positives = 26/61 (42%), Gaps = 12/61 (19%) Frame = -2 Query: 147 KRALQESAEPVLASP*PPPP*-------PPLP-----PPP*PPPPRPPP*PPPPTHNRTC 4 K A Q PV P PPPP PP P PPP PPP + PPPP + Sbjct: 116 KPASQPPPPPVQNLPPPPPPPQQNVLPPPPKPQQNVMPPPPPPPQQNVMPPPPPPAQQQA 175 Query: 3 Q 1 Q Sbjct: 176 Q 176 [203][TOP] >UniRef100_UPI0001982BFF PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982BFF Length = 274 Score = 48.9 bits (115), Expect(2) = 9e-07 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 154 GGG GGG GGGG GGGG YG GG+G A +GS + Y Sbjct: 179 GGGAGGGSGGGGGGGGGGAAYGAGGHG-AGSGSGQGSGSGGGY 220 Score = 27.3 bits (59), Expect(2) = 9e-07 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGGG 335 + G G GG G GG G GGG Sbjct: 220 YGAGGGKGGGGGGGSGGGGG 239 [204][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -2 Query: 123 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 +PV A P PPPP PP PPPP PPPP PPP PPP N Sbjct: 330 KPVSAPPPPPPPRPPPPPPPPPPPPPPPP-PPPALKN 365 [205][TOP] >UniRef100_C5CY78 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CY78_VARPS Length = 137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGG GGGG GGYGGGG G + G Sbjct: 91 GGGGYGGGGGGGYGGGGGGGGYGGGGGGRSGGG 123 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSG-GYGGGGYGEANTG 121 GGGGYGGG GGGGYGGGG G GGGGYG G Sbjct: 99 GGGGYGGGGGGGGYGGGGGGRSGGGGGYGGGGGG 132 [206][TOP] >UniRef100_A9B9L1 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9211 RepID=A9B9L1_PROM4 Length = 245 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 G GGYGGG G GGYGGGG GGYGGGG G Sbjct: 134 GQGGYGGGGGQGGYGGGGQGGYGGGGQG 161 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 G GGYGGG G GGYGGGG GGYGGGGYG Sbjct: 143 GQGGYGGG-GQGGYGGGGQGGYGGGGYG 169 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 4/37 (10%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGG----GGYGEANTG 121 G GGYGGG G GGYGGGG GGYGG GGYG G Sbjct: 117 GQGGYGGGGGQGGYGGGGQGGYGGGGGQGGYGGGGQG 153 [207][TOP] >UniRef100_A2BZB6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. NATL1A RepID=A2BZB6_PROM1 Length = 250 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGG GGG GGGGYGGGG GGYGGGG G Sbjct: 90 GGGGGGGYGGGGYGGGGQGGYGGGGQG 116 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSAD 130 G GGYGGG G GGYGGGG GGYGGGGYG G AD Sbjct: 162 GQGGYGGG-GQGGYGGGGQGGYGGGGYG--GGGQAD 194 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 106 GGGGYGGG G GGYGGGG GGYGGGG G Sbjct: 98 GGGGYGGG-GQGGYGGGGQGGYGGGGQG 124 [208][TOP] >UniRef100_B6AXZ3 Single-stranded DNA-binding protein n=1 Tax=Rhodobacterales bacterium HTCC2083 RepID=B6AXZ3_9RHOB Length = 174 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGRGGGGY--GGGGSGGYGGGGYGEANTG 121 GGGGYGGG GGGY G GG GGYGGG YG N G Sbjct: 123 GGGGYGGGNQGGGYDSGQGGGGGYGGGSYGGGNQG 157 [209][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 108 SP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 212 APVPPPPPPPPPPPPPPPPPPPPPPPPPP 240 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -2 Query: 99 PPPP*PPLPPPP*PPPPRPPP*PPPPTHNRTCQ 1 P PP PP PPPP PPPP PPP PPPP CQ Sbjct: 213 PVPPPPPPPPPPPPPPPPPPPPPPPPPPAPVCQ 245 [210][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPS 124 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPP 128 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPPP 142 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PPLPP P PPPP PPP PPPP Sbjct: 72 PPPPPPQPPLPPSPSPPPPPPPPVPPPP 99 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P SP PPPP P PPPP PPPP PPP PPPP Sbjct: 82 PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPP 114 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 99 PPPP*PPLPPPP*PPPPRPPP*PPPP 22 PPPP PP PPPP PPPP PPP PPPP Sbjct: 112 PPPPPPPPPPPPSPPPPPPPPPPPPP 137 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PPPP PP PPPP P PP PPP PPPP Sbjct: 86 SPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPP 121 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPP PP PPPP PPPP PPP PPPP Sbjct: 119 PPPPPSPPPPPPPPPPPPPNPPPPPPPP 146 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPP PP PPPP PPPP PPP PPPP Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPP 132 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 S P P PPPP PP PPPP PPPP PP PPPP Sbjct: 110 SPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145 [211][TOP] >UniRef100_O04070 SGRP-1 protein n=1 Tax=Solanum commersonii RepID=O04070_SOLCO Length = 162 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 9/37 (24%) Frame = +2 Query: 23 GGGGYGGGR----GGGGYGGG-----GSGGYGGGGYG 106 GGGGYGGGR GGGGYGGG G GGYGGGGYG Sbjct: 121 GGGGYGGGRREGGGGGGYGGGRREGGGGGGYGGGGYG 157 [212][TOP] >UniRef100_C4J159 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4J159_MAIZE Length = 261 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGS 124 GGGGYGGG GGGYGGG SGGYGGGG G+ GS Sbjct: 128 GGGGYGGGGYGGGYGGG-SGGYGGGGSGDYGGGS 160 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 4/32 (12%) Frame = +2 Query: 23 GGGGYGGGRGGG--GYGGGGSGGYGG--GGYG 106 GGGGYGGG GGG GYGGGGSG YGG GGYG Sbjct: 133 GGGGYGGGYGGGSGGYGGGGSGDYGGGSGGYG 164 [213][TOP] >UniRef100_B9MU37 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MU37_POPTR Length = 372 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWVT 163 GGGG GGG GGGG GGGG GG GGGG G +++ N + W T Sbjct: 208 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGNAGSNAVNVKPSNWKT 254 [214][TOP] >UniRef100_Q9VNN3 CG15597 n=1 Tax=Drosophila melanogaster RepID=Q9VNN3_DROME Length = 171 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +2 Query: 14 LCVGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANT 118 L GGGG GGG GGGYGGG GGYGGGGYG +T Sbjct: 46 LLKGGGGGGGGGYGGGYGGGYGGGYGGGGYGGEST 80 [215][TOP] >UniRef100_C4XVF6 MIP10548p (Fragment) n=1 Tax=Drosophila melanogaster RepID=C4XVF6_DROME Length = 162 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +2 Query: 14 LCVGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANT 118 L GGGG GGG GGGYGGG GGYGGGGYG +T Sbjct: 37 LLKGGGGGGGGGYGGGYGGGYGGGYGGGGYGGEST 71 [216][TOP] >UniRef100_B7PDK3 Cuticular protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDK3_IXOSC Length = 166 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GG G GGGR GGGYGGG GGYGGGGYG G Sbjct: 110 GGAGAGGGRFGGGYGGGHHGGYGGGGYGGGRGG 142 [217][TOP] >UniRef100_B4ND74 GK24962 n=1 Tax=Drosophila willistoni RepID=B4ND74_DROWI Length = 282 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -2 Query: 135 QESAEP-VLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 +ES P +A P PPPP PP PPPP PPPP PPP PP P Sbjct: 71 EESKLPETIAPPAPPPPPPPTPPPPPPPPPPPPPTPPTP 109 [218][TOP] >UniRef100_B4NC76 GK25807 n=1 Tax=Drosophila willistoni RepID=B4NC76_DROWI Length = 234 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGG +GGG GGGGYGGGGSGG+GGG +G G Sbjct: 120 GGGKHGGGGGGGGYGGGGSGGFGGGKHGGGGGG 152 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = +2 Query: 23 GGGGYGGGRGGGG--YGGGGSGGYGGGGYGEANTG 121 GGGGYGG GGGG +GGGG GGYGGGG G+ G Sbjct: 199 GGGGYGGNGGGGGGKHGGGGGGGYGGGGGGKHGGG 233 [219][TOP] >UniRef100_B4JQZ8 GH13089 n=1 Tax=Drosophila grimshawi RepID=B4JQZ8_DROGR Length = 545 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +2 Query: 23 GGGGYGGGRGGGGYG-GGGSGGYGGGGYGEANTGSADSCN 139 GGGG+GGG GGGGYG GGG GGYGGG G +G +++ N Sbjct: 118 GGGGFGGGGGGGGYGGGGGGGGYGGGAGGGRFSGGSNNYN 157 [220][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 SA P + PPPP PP PPPP PPPP PPP PPPP Sbjct: 831 SAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPP 866 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 AS PPPP PP PPPP PPPP PPP PPPP Sbjct: 838 ASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 867 [221][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 SA P + PPPP PP PPPP PPPP PPP PPPP Sbjct: 909 SAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 AS PPPP PP PPPP PPPP PPP PPPP Sbjct: 916 ASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 [222][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 SA P + PPPP PP PPPP PPPP PPP PPPP Sbjct: 909 SAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 111 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 AS PPPP PP PPPP PPPP PPP PPPP Sbjct: 916 ASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 [223][TOP] >UniRef100_Q99069 Glycine-rich RNA-binding protein 1 (Fragment) n=1 Tax=Sorghum bicolor RepID=GRP1_SORBI Length = 142 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 3/39 (7%) Frame = +2 Query: 23 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTGSAD 130 GGGGYGGGR GGGGYGGGG GGYGGG G G++D Sbjct: 100 GGGGYGGGRGGYGGGGYGGGG-GGYGGGSRGGGGYGNSD 137 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/50 (56%), Positives = 28/50 (56%), Gaps = 17/50 (34%) Frame = +2 Query: 23 GGGGYGGGRGGGG-----------YGGGGSG------GYGGGGYGEANTG 121 GGGGYGGGRGGGG YGGGG G GYGGGGYG G Sbjct: 73 GGGGYGGGRGGGGGYGRRDGGGGGYGGGGGGYGGGRGGYGGGGYGGGGGG 122 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 5/45 (11%) Frame = +2 Query: 23 GGGGYGGGRGG-----GGYGGGGSGGYGGGGYGEANTGSADSCNA 142 GGGGYGGG GG GGYGGGG GG GGGGYG + G N+ Sbjct: 93 GGGGYGGGGGGYGGGRGGYGGGGYGG-GGGGYGGGSRGGGGYGNS 136 [224][TOP] >UniRef100_B4M7B5 GJ16487 n=1 Tax=Drosophila virilis RepID=B4M7B5_DROVI Length = 880 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 24/44 (54%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = -2 Query: 141 ALQESAEPVLASP*----PPPP*PPLPPPP*PPPPRPPP*PPPP 22 A+ + EP LA+ PPPP PP PPPP PPPP P P PP P Sbjct: 789 AMLQYQEPELAAAVAQSKPPPPPPPPPPPPPPPPPPPLPLPPQP 832 Score = 27.3 bits (59), Expect(2) = 1e-06 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 319 PPPAP*PPPPLPPGKIGRRKTCQATLSNQH*RHWQK 212 P PAP PPPP PP +N H +WQ+ Sbjct: 758 PMPAPPPPPPPPP------SPSDMFQANGHIDNWQQ 787 [225][TOP] >UniRef100_P10495 Glycine-rich cell wall structural protein 1.0 n=1 Tax=Phaseolus vulgaris RepID=GRP1_PHAVU Length = 252 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 26/57 (45%), Positives = 28/57 (49%), Gaps = 13/57 (22%) Frame = +2 Query: 23 GGGGYGGGRGGG-----------GYGGGGS--GGYGGGGYGEANTGSADSCNARFDY 154 GGGG GG GGG GYGGGG+ GGYGGGG G G + A Y Sbjct: 95 GGGGGGGADGGGYGGGAGKGGGEGYGGGGANGGGYGGGG-GSGGGGGGGAGGAGSGY 150 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +3 Query: 276 FPGGNGGGGYGAGGGGYGGGG 338 + G NGGGG G GGGG GG G Sbjct: 162 YGGANGGGGGGNGGGGGGGSG 182 [226][TOP] >UniRef100_B4IEZ4 GM13329 n=1 Tax=Drosophila sechellia RepID=B4IEZ4_DROSE Length = 217 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 27/51 (52%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGG--GGYGEANTGSADSCNARFDYWVTSA 169 G G G GRGG G GG G GG GG GG G A G+A A FDY V A Sbjct: 143 GWQGAGAGRGGAGRGGAGRGGAGGWQGGVGGAGAGNAWGNPAEFDYTVNHA 193 Score = 27.3 bits (59), Expect(2) = 1e-06 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 282 GGNGGGGYGAGGGGYGGGGY 341 GG GG G GGG GG G+ Sbjct: 195 GGAGGAGGAYGGGSRGGAGW 214 [227][TOP] >UniRef100_B3NW54 GG18942 n=1 Tax=Drosophila erecta RepID=B3NW54_DROER Length = 167 Score = 42.7 bits (99), Expect(2) = 1e-06 Identities = 22/39 (56%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +2 Query: 26 GGGYGGGRGG---GGYGGGGSGGYGGGGYGEANTGSADS 133 GGG GGG GG GG GG G GG GGGG G G S Sbjct: 23 GGGLGGGSGGLSLGGGGGNGGGGGGGGGGGRGYGGPGPS 61 Score = 33.1 bits (74), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 255 QVFLLPIFPGGNGGGGYGAGGGGYG 329 QVF + + GG GGGG GGGGYG Sbjct: 100 QVFKVKVISGGGGGGG---GGGGYG 121 [228][TOP] >UniRef100_UPI000155C36A PREDICTED: hypothetical protein, partial n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C36A Length = 1287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPP----PRPPP*PPPPTH 16 P+ P PPP PPLPPPP PPP P PPP PPPPTH Sbjct: 47 PMPPPPPPPPGFPPLPPPPPPPPQPGFPMPPPLPPPPTH 85 [229][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHN 13 P ASP PPPP PP P PP PPPP PPP P PP+ N Sbjct: 199 PPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPN 234 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/34 (70%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = -2 Query: 120 PVLASP*PPPP*P-PLPPPP*PPPPRPPP*PPPP 22 P ASP PPPP P PPPP PPPP PPP PPPP Sbjct: 190 PSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPP 223 [230][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P SP PP P PP PPPP PPPP PPP PPPP+ Sbjct: 234 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPS 267 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 19 P SP PP P PP PPPP PPPP PPP PPPP+ Sbjct: 239 PPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPS 272 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPP Sbjct: 429 PSPPPPSPPSPPPPSPPPPSPPPPSPPP 456 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = -2 Query: 120 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PP---PPTH 16 P SP PP P PP PPPP PPPP PPP PP PP+H Sbjct: 494 PPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSHPPSH 531 [231][TOP] >UniRef100_Q121M2 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Polaromonas sp. JS666 RepID=Q121M2_POLSJ Length = 151 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +2 Query: 29 GGYGGGRGGGGYG-GGGSGGYGGGGYGEANTGSAD 130 GG+GGG GGGGYG GGG GGYGGGG G + G +D Sbjct: 90 GGFGGGSGGGGYGGGGGGGGYGGGGGGRSGGGGSD 124 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 8/45 (17%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGG--------YGEANTGSADS 133 GGGGYGGG GGGGYGGGG G GGGG YG +G S Sbjct: 97 GGGGYGGGGGGGGYGGGGGGRSGGGGSDGGFRSPYGGGGSGGGRS 141 [232][TOP] >UniRef100_O24601 Glycine-rich RNA binding protein 1 n=1 Tax=Pelargonium x hortorum RepID=O24601_PELHO Length = 166 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGG----GYGEANTGSADSCNARFDYW 157 GGGGYGGG GGGYGGG GGYGGG GYG++ GS S ++ W Sbjct: 118 GGGGYGGG--GGGYGGGNGGGYGGGREQRGYGDSGGGSRYSRDSDGGNW 164 [233][TOP] >UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis RepID=B9S5R2_RICCO Length = 210 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 129 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 SA ++ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 SAAFLIVQPPPPPP-PPSPPPPSPPPPSPPPPPPPP 68 [234][TOP] >UniRef100_A9SDN8 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SDN8_PHYPA Length = 1271 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 145 GGGG GGG GGGG GGGG GG GGGG G + GS D R Sbjct: 149 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGESEGSEDEVTER 189 [235][TOP] >UniRef100_Q9XY11 Cold-inducible RNA-binding protein n=1 Tax=Ciona intestinalis RepID=Q9XY11_CIOIN Length = 158 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSA 127 GGG GGG GGGGYGGGG GGYGGGG G G + Sbjct: 88 GGGRGGGGYGGGGYGGGGGGGYGGGGGGGGRYGGS 122 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +2 Query: 32 GYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 G GGGRGGGGYGGGG GG GGGGYG G Sbjct: 86 GGGGGRGGGGYGGGGYGGGGGGGYGGGGGG 115 [236][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 100 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 127 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 114 LASP*PPPP*PPLPPPP*PPPPRPPP*PPP 25 L P PPPP PP PPPP PPPP PPP PPP Sbjct: 98 LQPPPPPPPPPPPPPPPPPPPPPPPPPPPP 127 [237][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 [238][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [239][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [240][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [241][TOP] >UniRef100_B7PKH3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKH3_IXOSC Length = 208 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GG G GGG GGGGYGGGG GGYGGG YG + G Sbjct: 147 GGLGGGGGLGGGGYGGGGLGGYGGGSYGGGSYG 179 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 6/40 (15%) Frame = +2 Query: 20 VGGGGYGGGR----GGGGYGGG--GSGGYGGGGYGEANTG 121 +GGGGYGGG GGG YGGG G GGYGGGGYG G Sbjct: 155 LGGGGYGGGGLGGYGGGSYGGGSYGGGGYGGGGYGGGGHG 194 [242][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 22 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 [243][TOP] >UniRef100_B3NYM7 GG10533 n=1 Tax=Drosophila erecta RepID=B3NYM7_DROER Length = 164 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%), Gaps = 3/34 (8%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGGGSGGYG---GGGYGEANT 118 GGGYGGG GGGGYGGG GGYG GGGYG +T Sbjct: 78 GGGYGGGYGGGGYGGGYGGGYGGGYGGGYGGGST 111 [244][TOP] >UniRef100_A7UTZ4 AGAP005965-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UTZ4_ANOGA Length = 113 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 157 GGGG GGG GGGG GGGG GG GGGG+G G R +W Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGGGGGGWGAGRGGKRLHTRFRLRWW 73 [245][TOP] >UniRef100_A7T285 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7T285_NEMVE Length = 278 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 1/29 (3%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGS-GGYGGGGYG 106 GGGGYGGG GGGGY GG S GGYGGGGYG Sbjct: 168 GGGGYGGGYGGGGYRGGYSGGGYGGGGYG 196 [246][TOP] >UniRef100_A4H3P3 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis RepID=A4H3P3_LEIBR Length = 1295 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 157 GGGG GGG GGGG GGGG GG GGGG G G R+ +W Sbjct: 1225 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRWRWW 1269 [247][TOP] >UniRef100_Q05966 Glycine-rich RNA-binding protein 10 n=1 Tax=Brassica napus RepID=GRP10_BRANA Length = 169 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = +2 Query: 26 GGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 121 GGG GGGRGGGGYGG G GGY GGGGYG+ G Sbjct: 86 GGGGGGGRGGGGYGGRGGGGYGGGGGGYGDRRGG 119 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 23 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 121 GGGGYG RGGGGYG GG GG GGGGYG G Sbjct: 109 GGGGYGDRRGGGGYGSGG-GGRGGGGYGSGGGG 140 [248][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -2 Query: 105 P*PPPP*PPLPPPP*PPPPRPPP*PPP 25 P PPPP PP PPPP PPPPRPPP PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPP 379 [249][TOP] >UniRef100_Q96VI4 Protease 1 n=1 Tax=Pneumocystis carinii RepID=Q96VI4_PNECA Length = 938 Score = 51.6 bits (122), Expect(2) = 1e-06 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = -2 Query: 186 PKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 28 P +Q D + S S+EP SP PPPP PP P P PPPP PPP P Sbjct: 760 PSSQKDPDTSLSSNPTSTSSSEPPPPSPPPPPPPPPAPAPAPPPPPPPPPPRP 812 Score = 23.9 bits (50), Expect(2) = 1e-06 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -1 Query: 334 PPP*PPPPAP*PPP--PLPPGK 275 PP P PP+ PP P PP K Sbjct: 730 PPSEPAPPSKPAPPSKPAPPSK 751 [250][TOP] >UniRef100_A6YP76 Flagelliform spidroin-like protein (Fragment) n=1 Tax=Nephilengys cruentata RepID=A6YP76_9ARAC Length = 1037 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 14 LCVGGGGYGG-GRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARF 148 L VGG G GG G GG G GG G GG G GG G G F Sbjct: 315 LTVGGPGAGGSGPGGAGPGGAGPGGAGPGGVGPGGAGGPGGAGGPF 360 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +3 Query: 270 PIFPGGNGGGGYGAGGGGYGGGG 338 P PGG+G GG G GG YG GG Sbjct: 359 PFGPGGSGPGGAGGAGGPYGPGG 381 Score = 38.9 bits (89), Expect(2) = 7e-06 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 23 GGGGYGG-GRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARF 148 GG G GG G GG G GG G GG G GG G G F Sbjct: 43 GGAGPGGAGPGGAGPGGAGPGGAGPGGVGPGGAGGPGGAGGPF 85 Score = 38.9 bits (89), Expect(2) = 7e-06 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 23 GGGGYGG-GRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARF 148 GG G GG G GG G GG G GG G GG G G F Sbjct: 597 GGAGPGGAGPGGAGPGGAGPGGAGPGGVGPGGAGGPGGAGGPF 639 Score = 34.3 bits (77), Expect(2) = 7e-06 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +3 Query: 270 PIFPGGNGGGGYGAGGGGYGGGG 338 P PGG+G GG G GG YG GG Sbjct: 84 PFGPGGSGPGGAGGAGGPYGPGG 106 Score = 34.3 bits (77), Expect(2) = 7e-06 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +3 Query: 270 PIFPGGNGGGGYGAGGGGYGGGG 338 P PGG+G GG G GG YG GG Sbjct: 638 PFGPGGSGPGGAGGAGGPYGPGG 660