[UP]
[1][TOP] >UniRef100_Q93WE0 Light-harvesting chlorophyll-a/b binding protein LhcII-3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q93WE0_CHLRE Length = 249 Score = 120 bits (302), Expect(2) = 1e-29 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 27 MAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 MAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP Sbjct: 1 MAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 58 Score = 32.7 bits (73), Expect(2) = 1e-29 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R LIHARW Sbjct: 58 PGDYGWDTAGLSADPETFKRY--RELELIHARW 88 [2][TOP] >UniRef100_A2SY44 Light-harvesting chlorophyll-a/b binding protein LhcbM2a (Fragment) n=1 Tax=Chlamydomonas incerta RepID=A2SY44_CHLIN Length = 246 Score = 115 bits (289), Expect(2) = 4e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP Sbjct: 1 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 55 Score = 32.7 bits (73), Expect(2) = 4e-28 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R LIHARW Sbjct: 55 PGDYGWDTAGLSADPETFKRY--RELELIHARW 85 [3][TOP] >UniRef100_Q9AXF6 Light-harvesting complex II protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q9AXF6_CHLRE Length = 249 Score = 114 bits (285), Expect(2) = 1e-27 Identities = 55/58 (94%), Positives = 56/58 (96%) Frame = +3 Query: 27 MAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 MAAIMKS+VRSSVR TVS RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP Sbjct: 1 MAAIMKSSVRSSVRSTVSSRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 58 Score = 32.7 bits (73), Expect(2) = 1e-27 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R LIHARW Sbjct: 58 PGDYGWDTAGLSADPETFKRY--RELELIHARW 88 [4][TOP] >UniRef100_A2SY45 Light-harvesting chlorophyll-a/b binding protein LhcbM2b (Fragment) n=1 Tax=Chlamydomonas incerta RepID=A2SY45_CHLIN Length = 229 Score = 85.5 bits (210), Expect(2) = 4e-19 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 87 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP Sbjct: 1 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 38 Score = 32.7 bits (73), Expect(2) = 4e-19 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R LIHARW Sbjct: 38 PGDYGWDTAGLSADPETFKRY--RELELIHARW 68 [5][TOP] >UniRef100_A2SY33 Light-harvesting chlorophyll-a/b binding protein LhcbM2 n=1 Tax=Scenedesmus obliquus RepID=A2SY33_SCEOB Length = 249 Score = 80.5 bits (197), Expect(2) = 7e-17 Identities = 40/57 (70%), Positives = 43/57 (75%) Frame = +3 Query: 27 MAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 197 MA +K AV + T R+ R V RAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF Sbjct: 1 MAFALKQAVATKAAAT---RATRQVTRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 54 Score = 30.0 bits (66), Expect(2) = 7e-17 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P+ A R +IHARW Sbjct: 56 GDYGWDTAGLSADPQTF--AKYREIEVIHARW 85 [6][TOP] >UniRef100_C4P6Y3 Chloroplast light-harvesting chlorophyll-a/b binding protein n=1 Tax=Ankistrodesmus convolutus RepID=C4P6Y3_9CHLO Length = 248 Score = 74.3 bits (181), Expect(2) = 6e-16 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = +3 Query: 54 RSSVRPTVSGRSARVV-PRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+++R + +AR V +AAIEWYGPDRPKFLGPFSEGDTP YLTGEFP Sbjct: 5 RTALRAAAARPAARNVRAKAAIEWYGPDRPKFLGPFSEGDTPEYLTGEFP 54 Score = 33.1 bits (74), Expect(2) = 6e-16 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R LIHARW Sbjct: 54 PGDYGWDTAGLSADPATF--ARYREIELIHARW 84 [7][TOP] >UniRef100_A1XKU7 Major light-harvesting chlorophyll a/b protein 2.2 n=1 Tax=Dunaliella salina RepID=A1XKU7_DUNSA Length = 253 Score = 70.5 bits (171), Expect(2) = 5e-15 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +3 Query: 30 AAIMKSAVRS-SVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A I +S +++ ++R T R A VPRAA+E+YGPDR KFLGPFSE DTP YLTGEFP Sbjct: 3 ALIARSGLKALNIRQTRQQRMA-TVPRAAVEFYGPDRAKFLGPFSENDTPEYLTGEFP 59 Score = 33.9 bits (76), Expect(2) = 5e-15 Identities = 18/33 (54%), Positives = 19/33 (57%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P+ A R LIHARW Sbjct: 59 PGDYGWDTAGLSADPQTF--ARYREIELIHARW 89 [8][TOP] >UniRef100_A1XKU6 Major light-harvesting chlorophyll a/b protein 2.1 n=1 Tax=Dunaliella salina RepID=A1XKU6_DUNSA Length = 253 Score = 70.5 bits (171), Expect(2) = 5e-15 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +3 Query: 30 AAIMKSAVRS-SVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A I +S +++ ++R T R A VPRAA+E+YGPDR KFLGPFSE DTP YLTGEFP Sbjct: 3 ALIARSGLKALNIRQTRQQRMA-TVPRAAVEFYGPDRAKFLGPFSENDTPEYLTGEFP 59 Score = 33.9 bits (76), Expect(2) = 5e-15 Identities = 18/33 (54%), Positives = 19/33 (57%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P+ A R LIHARW Sbjct: 59 PGDYGWDTAGLSADPQTF--ARYREIELIHARW 89 [9][TOP] >UniRef100_P27517 Chlorophyll a-b binding protein of LHCII type I, chloroplastic n=1 Tax=Dunaliella tertiolecta RepID=CB2_DUNTE Length = 253 Score = 70.5 bits (171), Expect(2) = 5e-15 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +3 Query: 30 AAIMKSAVRS-SVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A I +S +++ ++R T R A VPRAA+E+YGPDR KFLGPFSE DTP YLTGEFP Sbjct: 3 ALIARSGLKALNIRQTRQQRMA-TVPRAAVEFYGPDRAKFLGPFSENDTPEYLTGEFP 59 Score = 33.9 bits (76), Expect(2) = 5e-15 Identities = 18/33 (54%), Positives = 19/33 (57%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P+ A R LIHARW Sbjct: 59 PGDYGWDTAGLSADPQTF--ARYREIELIHARW 89 [10][TOP] >UniRef100_A4QPJ6 Chloroplast light-harvesting complex II protein Lhcbm9 (Fragment) n=1 Tax=Acetabularia acetabulum RepID=A4QPJ6_ACEAT Length = 229 Score = 70.9 bits (172), Expect = 4e-11 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +3 Query: 87 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S R V R AIEWYGPDRPK+LGPFSEGD P+YLTGEFP Sbjct: 1 SVRNVSRNAIEWYGPDRPKWLGPFSEGDVPSYLTGEFP 38 [11][TOP] >UniRef100_A9NL12 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NL12_PICSI Length = 266 Score = 58.9 bits (141), Expect(2) = 6e-11 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++K S R T+ R+ R+ P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 25 LVKKVGASQARITMR-RTVRIAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 75 Score = 31.6 bits (70), Expect(2) = 6e-11 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 105 [12][TOP] >UniRef100_A4QPJ3 Chloroplast light-harvesting complex II protein Lhcbm13 n=1 Tax=Acetabularia acetabulum RepID=A4QPJ3_ACEAT Length = 255 Score = 57.0 bits (136), Expect(2) = 1e-10 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDRP+FLGPFS GDTP+YLTGEFP Sbjct: 37 WYGPDRPQFLGPFS-GDTPSYLTGEFP 62 Score = 32.7 bits (73), Expect(2) = 1e-10 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R LIHARW Sbjct: 62 PGDYGWDTAGLSADPETFRRY--RELELIHARW 92 [13][TOP] >UniRef100_Q00984 Chlorophyll a/b-binding protein n=1 Tax=Pinus thunbergii RepID=Q00984_PINTH Length = 266 Score = 58.2 bits (139), Expect(2) = 1e-10 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ R P + WYGPDRPK+LGPFSEG TP+YLTGEFP Sbjct: 40 RTVRSAPESI--WYGPDRPKYLGPFSEG-TPSYLTGEFP 75 Score = 31.2 bits (69), Expect(2) = 1e-10 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 105 [14][TOP] >UniRef100_P10049 Chlorophyll a-b binding protein type I, chloroplastic n=1 Tax=Pinus thunbergii RepID=CB21_PINTH Length = 266 Score = 58.2 bits (139), Expect(2) = 1e-10 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ R P + WYGPDRPK+LGPFSEG TP+YLTGEFP Sbjct: 40 RTVRSAPESI--WYGPDRPKYLGPFSEG-TPSYLTGEFP 75 Score = 31.2 bits (69), Expect(2) = 1e-10 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAAVSADPETF--AKNRELEVIHCRW 105 [15][TOP] >UniRef100_A4QPK3 Chloroplast light-harvesting complex II protein Lhcbm8 (Fragment) n=1 Tax=Acetabularia acetabulum RepID=A4QPK3_ACEAT Length = 220 Score = 68.9 bits (167), Expect = 2e-10 Identities = 32/54 (59%), Positives = 39/54 (72%) Frame = +3 Query: 39 MKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 M++AV + +S R V R A+EWYGPDR K+LGPFSEGD P+YLTGEFP Sbjct: 1 MQTAVVVNSAVLAQTKSIRNVSRNAVEWYGPDRAKWLGPFSEGDVPSYLTGEFP 54 [16][TOP] >UniRef100_B8LPT5 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=B8LPT5_PICSI Length = 266 Score = 57.0 bits (136), Expect(2) = 2e-10 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++K S R T+ R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 25 LVKKVGASQARITMR-RTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 75 Score = 31.6 bits (70), Expect(2) = 2e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 105 [17][TOP] >UniRef100_A9NLB8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NLB8_PICSI Length = 266 Score = 57.0 bits (136), Expect(2) = 2e-10 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++K S R T+ R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 25 LVKKVGASQARITMR-RTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 75 Score = 31.6 bits (70), Expect(2) = 2e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 105 [18][TOP] >UniRef100_A2SY34 Light-harvesting chlorophyll-a/b binding protein LhcbM3 n=1 Tax=Scenedesmus obliquus RepID=A2SY34_SCEOB Length = 248 Score = 56.2 bits (134), Expect(2) = 2e-10 Identities = 33/59 (55%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = +3 Query: 27 MAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFS-EGDTPAYLTGEFP 200 MA +K AV + T R+ R V RAA+E+YGPDR KFLGPF+ E D YLTGEFP Sbjct: 1 MAFALKQAVATKAAAT---RATRQVTRAAVEFYGPDRAKFLGPFTPESD---YLTGEFP 53 Score = 32.3 bits (72), Expect(2) = 2e-10 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P+ + R +IHARW Sbjct: 53 PGDYGWDTAGLSADPQTFSRY--REVEVIHARW 83 [19][TOP] >UniRef100_Q40956 Type 2 light-harvesting chlorophyll a/b-binding polypeptide (Fragment) n=1 Tax=Pinus palustris RepID=Q40956_PINPA Length = 246 Score = 57.0 bits (136), Expect(2) = 2e-10 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++K S R T+ R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 5 LVKKVGASQARITMR-RTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 55 Score = 31.6 bits (70), Expect(2) = 2e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 55 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 85 [20][TOP] >UniRef100_P12332 Chlorophyll a-b binding protein, chloroplastic (Fragment) n=1 Tax=Silene latifolia subsp. alba RepID=CB21_SILPR Length = 205 Score = 57.4 bits (137), Expect(2) = 2e-10 Identities = 29/48 (60%), Positives = 32/48 (66%), Gaps = 6/48 (12%) Frame = +3 Query: 75 VSGRSARVVPRAAIE------WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 V G RV R I+ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 27 VGGNGGRVSMRRTIKSAPESIWYGPDRPKYLGPFSE-QTPSYLTGEFP 73 Score = 31.2 bits (69), Expect(2) = 2e-10 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 73 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 103 [21][TOP] >UniRef100_A9NMJ8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NMJ8_PICSI Length = 266 Score = 57.0 bits (136), Expect(2) = 3e-10 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++K S R T+ R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 25 LVKKVGASQARITMR-RTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 75 Score = 31.2 bits (69), Expect(2) = 3e-10 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 105 [22][TOP] >UniRef100_A9TKU6 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TKU6_PHYPA Length = 266 Score = 53.9 bits (128), Expect(2) = 3e-10 Identities = 28/47 (59%), Positives = 31/47 (65%), Gaps = 5/47 (10%) Frame = +3 Query: 75 VSGRSARVVPRAAIE-----WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 V ARVV R + WYGPDRP FLGPFS G+TP+YL GEFP Sbjct: 28 VGSNQARVVMRGSKSSSGSMWYGPDRPLFLGPFS-GNTPSYLKGEFP 73 Score = 34.3 bits (77), Expect(2) = 3e-10 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA LIH RW Sbjct: 73 PGDYGWDTAGLSADPESF--ARNRALELIHGRW 103 [23][TOP] >UniRef100_A9PJH7 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PJH7_9ROSI Length = 265 Score = 56.6 bits (135), Expect(2) = 3e-10 Identities = 30/52 (57%), Positives = 33/52 (63%), Gaps = 6/52 (11%) Frame = +3 Query: 63 VRPTVSGRSARVVPRAAIE------WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 VR S RV R ++ WYGPDRPKFLGPFSE TP+YLTGEFP Sbjct: 24 VRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGPFSE-QTPSYLTGEFP 74 Score = 31.6 bits (70), Expect(2) = 3e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [24][TOP] >UniRef100_A9PFW7 Light-harvesting complex II protein Lhcb2 n=1 Tax=Populus trichocarpa RepID=A9PFW7_POPTR Length = 265 Score = 56.6 bits (135), Expect(2) = 3e-10 Identities = 30/52 (57%), Positives = 33/52 (63%), Gaps = 6/52 (11%) Frame = +3 Query: 63 VRPTVSGRSARVVPRAAIE------WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 VR S RV R ++ WYGPDRPKFLGPFSE TP+YLTGEFP Sbjct: 24 VRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGPFSE-QTPSYLTGEFP 74 Score = 31.6 bits (70), Expect(2) = 3e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [25][TOP] >UniRef100_B6T1H1 Chlorophyll a-b binding protein n=1 Tax=Zea mays RepID=B6T1H1_MAIZE Length = 260 Score = 56.6 bits (135), Expect(2) = 3e-10 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + VP++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 34 RTVKSVPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 69 Score = 31.6 bits (70), Expect(2) = 3e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 69 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 99 [26][TOP] >UniRef100_B6SZT9 Chlorophyll a-b binding protein n=1 Tax=Zea mays RepID=B6SZT9_MAIZE Length = 260 Score = 56.6 bits (135), Expect(2) = 3e-10 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + VP++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 34 RTVKSVPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 69 Score = 31.6 bits (70), Expect(2) = 3e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 69 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 99 [27][TOP] >UniRef100_A4QPK2 Chloroplast light-harvesting complex II protein Lhcbm12 n=1 Tax=Acetabularia acetabulum RepID=A4QPK2_ACEAT Length = 255 Score = 54.7 bits (130), Expect(2) = 3e-10 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDRP+FLGPFS GD P+YLTGEFP Sbjct: 37 WYGPDRPQFLGPFS-GDCPSYLTGEFP 62 Score = 33.5 bits (75), Expect(2) = 3e-10 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R LIHARW Sbjct: 62 PGDYGWDTAGLSADPETFRRY--REQELIHARW 92 [28][TOP] >UniRef100_A9NWZ3 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NWZ3_PICSI Length = 240 Score = 57.0 bits (136), Expect(2) = 3e-10 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++K S R T+ R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 25 LVKKVGASQARITMR-RTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 75 Score = 31.2 bits (69), Expect(2) = 3e-10 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 105 [29][TOP] >UniRef100_A4QPK0 Chloroplast light-harvesting complex II protein Lhcbm11 (Fragment) n=1 Tax=Acetabularia acetabulum RepID=A4QPK0_ACEAT Length = 224 Score = 54.7 bits (130), Expect(2) = 3e-10 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDRP+FLGPFS GD P+YLTGEFP Sbjct: 37 WYGPDRPQFLGPFS-GDCPSYLTGEFP 62 Score = 33.5 bits (75), Expect(2) = 3e-10 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R LIHARW Sbjct: 62 PGDYGWDTAGLSADPETFRRY--REQELIHARW 92 [30][TOP] >UniRef100_A9NT55 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NT55_PICSI Length = 166 Score = 57.0 bits (136), Expect(2) = 3e-10 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++K S R T+ R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 25 LVKKVGASQARITMR-RTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 75 Score = 31.2 bits (69), Expect(2) = 3e-10 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 105 [31][TOP] >UniRef100_A9NP21 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NP21_PICSI Length = 266 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S V +S R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 27 SKVGASQARITMRRTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 75 Score = 31.6 bits (70), Expect(2) = 4e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 105 [32][TOP] >UniRef100_B9IAR5 Light-harvesting complex II protein Lhcb2 n=1 Tax=Populus trichocarpa RepID=B9IAR5_POPTR Length = 265 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 28/52 (53%), Positives = 33/52 (63%), Gaps = 6/52 (11%) Frame = +3 Query: 63 VRPTVSGRSARVVPRAAIE------WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 VR S R+ R ++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 24 VRKVGSSGDGRITMRRTVKSAPQSIWYGPDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 31.6 bits (70), Expect(2) = 4e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [33][TOP] >UniRef100_O49812 Chlorophyll a/b-binding protein n=1 Tax=Beta vulgaris subsp. vulgaris RepID=O49812_BETVU Length = 264 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+S+R TV + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 33 RASMRRTVKSAPQSI-------WYGPDRPKYLGPFSE-QTPSYLTGEFP 73 Score = 31.6 bits (70), Expect(2) = 4e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 73 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 103 [34][TOP] >UniRef100_A9NPD6 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NPD6_PICSI Length = 266 Score = 56.2 bits (134), Expect(2) = 5e-10 Identities = 32/62 (51%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = +3 Query: 18 HNKMAA-IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGE 194 HN++ + S R ++R TV R P + WYGPDRPK+LGPFSE TP+YLTGE Sbjct: 22 HNELVRKVGMSQARITMRRTV-----RSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGE 73 Query: 195 FP 200 FP Sbjct: 74 FP 75 Score = 31.2 bits (69), Expect(2) = 5e-10 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 105 [35][TOP] >UniRef100_Q3LFQ5 Chlorophyll a/b binding protein n=1 Tax=Panax ginseng RepID=Q3LFQ5_PANGI Length = 265 Score = 55.8 bits (133), Expect(2) = 5e-10 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 39 RTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 31.6 bits (70), Expect(2) = 5e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [36][TOP] >UniRef100_Q40934 Light-harvesting chlorophyll a/b binding protein of photosystem II (Fragment) n=1 Tax=Pseudotsuga menziesii RepID=Q40934_PSEMZ Length = 234 Score = 55.8 bits (133), Expect(2) = 5e-10 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 8 RTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 43 Score = 31.6 bits (70), Expect(2) = 5e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 43 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 73 [37][TOP] >UniRef100_A4QPK4 Chloroplast light-harvesting complex II protein Lhcbm4 (Fragment) n=1 Tax=Acetabularia acetabulum RepID=A4QPK4_ACEAT Length = 219 Score = 54.7 bits (130), Expect(2) = 5e-10 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +3 Query: 99 VPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 V R A+EWYGPDR +LGP+S+G P+YL GEFP Sbjct: 1 VSRNAVEWYGPDRALWLGPYSDGAVPSYLKGEFP 34 Score = 32.7 bits (73), Expect(2) = 5e-10 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P R LIHARW Sbjct: 34 PGDYGWDTAGLSADPETF--KAYREQELIHARW 64 [38][TOP] >UniRef100_Q9LKZ0 Chlorophyll a/b-binding protein n=1 Tax=Picea glauca RepID=Q9LKZ0_PICGL Length = 151 Score = 55.8 bits (133), Expect(2) = 5e-10 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 40 RTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 75 Score = 31.6 bits (70), Expect(2) = 5e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 105 [39][TOP] >UniRef100_A4QPL1 Chloroplast light-harvesting complex II protein Lhcbm2 (Fragment) n=1 Tax=Acetabularia acetabulum RepID=A4QPL1_ACEAT Length = 248 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = +3 Query: 33 AIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A+ S V ++ + T+ + RV +AA+EWYGPDR K+LGP+S+G P+YLTGEFP Sbjct: 1 AVQTSLVGTTTKSTLPKGNKRVSVQAAVEWYGPDRAKWLGPYSDGAVPSYLTGEFP 56 [40][TOP] >UniRef100_Q9SWE9 Chlorophyll a/b binding protein n=1 Tax=Rumex palustris RepID=Q9SWE9_9CARY Length = 264 Score = 55.5 bits (132), Expect(2) = 6e-10 Identities = 27/48 (56%), Positives = 31/48 (64%), Gaps = 6/48 (12%) Frame = +3 Query: 75 VSGRSARVVPRAAIE------WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 V G R R ++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 27 VGGNGGRFFMRRTVKSAPQSIWYGPDRPKYLGPFSE-QTPSYLTGEFP 73 Score = 31.6 bits (70), Expect(2) = 6e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 73 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 103 [41][TOP] >UniRef100_P12328 Chlorophyll a-b binding protein of LHCII type I, chloroplastic n=1 Tax=Lemna gibba RepID=CB21_LEMGI Length = 264 Score = 55.5 bits (132), Expect(2) = 6e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + VP++ WYG DRPKFLGPFSE TP+YLTGEFP Sbjct: 38 RTVKAVPQSI--WYGADRPKFLGPFSE-QTPSYLTGEFP 73 Score = 31.6 bits (70), Expect(2) = 6e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 73 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 103 [42][TOP] >UniRef100_Q9S7J7 Putative chlorophyll a/b binding protein n=1 Tax=Arabidopsis thaliana RepID=Q9S7J7_ARATH Length = 265 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 29/55 (52%), Positives = 38/55 (69%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 I K V R T+ R+ + P++ WYGPDRPK+LGPFSE +TP+YLTGE+P Sbjct: 24 IQKVGVLGGGRVTMR-RTVKSTPQSI--WYGPDRPKYLGPFSE-NTPSYLTGEYP 74 Score = 31.6 bits (70), Expect(2) = 8e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [43][TOP] >UniRef100_Q38713 Chlorophyll a/b binding protein n=1 Tax=Amaranthus hypochondriacus RepID=Q38713_AMAHP Length = 264 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 38 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 73 Score = 31.6 bits (70), Expect(2) = 8e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 73 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 103 [44][TOP] >UniRef100_C1K5B9 Chlorophyll a-b binding protein n=1 Tax=Triticum aestivum RepID=C1K5B9_WHEAT Length = 263 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 37 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 72 Score = 31.6 bits (70), Expect(2) = 8e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 72 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 102 [45][TOP] >UniRef100_B6RAX2 Light-harvesting chlorophyll a/b binding protein n=1 Tax=Bambusa oldhamii RepID=B6RAX2_BAMOL Length = 263 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 37 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 72 Score = 31.6 bits (70), Expect(2) = 8e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 72 PGDYGWDTAGLSADPETF--ARNRELGVIHSRW 102 [46][TOP] >UniRef100_B0L0Y2 Chloroplast chlorophyll a/b binding protein n=1 Tax=Phyllostachys edulis RepID=B0L0Y2_9POAL Length = 263 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 37 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 72 Score = 31.6 bits (70), Expect(2) = 8e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 72 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 102 [47][TOP] >UniRef100_Q10HD0 Chlorophyll a-b binding protein, chloroplastic n=2 Tax=Oryza sativa RepID=CB23_ORYSJ Length = 263 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 37 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 72 Score = 31.6 bits (70), Expect(2) = 8e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 72 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 102 [48][TOP] >UniRef100_C5WTC1 Putative uncharacterized protein Sb01g015400 n=1 Tax=Sorghum bicolor RepID=C5WTC1_SORBI Length = 262 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 36 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 71 Score = 31.6 bits (70), Expect(2) = 8e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 71 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 101 [49][TOP] >UniRef100_Q41823 Type II light-harvesting chlorophyll a /b-binding protein n=1 Tax=Zea mays RepID=Q41823_MAIZE Length = 229 Score = 56.6 bits (135), Expect(2) = 8e-10 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + VP++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 3 RTVKSVPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 38 Score = 30.0 bits (66), Expect(2) = 8e-10 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGW+TA P A R +IH+RW Sbjct: 38 PGDYGWETAGVSADPETF--ARNRELEVIHSRW 68 [50][TOP] >UniRef100_A4QPK5 Chloroplast light-harvesting complex II protein Lhcbm10 (Fragment) n=1 Tax=Acetabularia acetabulum RepID=A4QPK5_ACEAT Length = 224 Score = 53.1 bits (126), Expect(2) = 8e-10 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGP+RP+FLGPFS GD P+YLTGEFP Sbjct: 37 WYGPERPQFLGPFS-GDCPSYLTGEFP 62 Score = 33.5 bits (75), Expect(2) = 8e-10 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R LIHARW Sbjct: 62 PGDYGWDTAGLSADPETFRRY--REQELIHARW 92 [51][TOP] >UniRef100_C1K5B7 Chlorophyll a-b binding protein n=1 Tax=Triticum aestivum RepID=C1K5B7_WHEAT Length = 215 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 37 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 72 Score = 31.6 bits (70), Expect(2) = 8e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 72 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 102 [52][TOP] >UniRef100_C1K5B6 Chlorophyll a-b binding protein n=1 Tax=Triticum aestivum RepID=C1K5B6_WHEAT Length = 196 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 37 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 72 Score = 31.6 bits (70), Expect(2) = 8e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 72 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 102 [53][TOP] >UniRef100_Q10HC9 Chlorophyll a-b binding protein, chloroplast, putative, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q10HC9_ORYSJ Length = 118 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 37 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 72 Score = 31.6 bits (70), Expect(2) = 8e-10 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 72 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 102 [54][TOP] >UniRef100_Q9XF87 Lhcb2 protein n=1 Tax=Arabidopsis thaliana RepID=Q9XF87_ARATH Length = 266 Score = 54.7 bits (130), Expect(2) = 1e-09 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 6/47 (12%) Frame = +3 Query: 78 SGRSARVVPRAAIE------WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S R++ R ++ WYGPDRPK+LGPFSE +TP+YLTGE+P Sbjct: 30 SNGGGRIIMRRTVKSTPQSIWYGPDRPKYLGPFSE-NTPSYLTGEYP 75 Score = 31.6 bits (70), Expect(2) = 1e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 105 [55][TOP] >UniRef100_B9T0C1 Chlorophyll A/B binding protein, putative n=1 Tax=Ricinus communis RepID=B9T0C1_RICCO Length = 265 Score = 55.1 bits (131), Expect(2) = 1e-09 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 39 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 1e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [56][TOP] >UniRef100_A5ASG6 Chromosome chr12 scaffold_47, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A5ASG6_VITVI Length = 265 Score = 55.1 bits (131), Expect(2) = 1e-09 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 39 RTVKSTPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 1e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [57][TOP] >UniRef100_Q19UF9 Chloroplast chlorophyll a/b binding protein n=1 Tax=Pachysandra terminalis RepID=Q19UF9_9MAGN Length = 264 Score = 55.1 bits (131), Expect(2) = 1e-09 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 38 RTVKSTPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 73 Score = 31.2 bits (69), Expect(2) = 1e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 73 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 103 [58][TOP] >UniRef100_D0F1Q5 Chlorophyll A/B binding protein n=1 Tax=Jatropha curcas RepID=D0F1Q5_9ROSI Length = 261 Score = 55.1 bits (131), Expect(2) = 1e-09 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 39 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 1e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [59][TOP] >UniRef100_Q5PYQ1 Chloroplast chlorophyll A/B binding protein (Fragment) n=1 Tax=Manihot esculenta RepID=Q5PYQ1_MANES Length = 243 Score = 55.1 bits (131), Expect(2) = 1e-09 Identities = 28/49 (57%), Positives = 32/49 (65%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R S+R TV + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 12 RFSMRRTVKSAPPSI-------WYGPDRPKYLGPFSE-QTPSYLTGEFP 52 Score = 31.2 bits (69), Expect(2) = 1e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 52 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 82 [60][TOP] >UniRef100_Q9XF86 Lhcb2 protein n=1 Tax=Arabidopsis thaliana RepID=Q9XF86_ARATH Length = 265 Score = 54.3 bits (129), Expect(2) = 1e-09 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE +TP+YLTGE+P Sbjct: 39 RTVKSTPQSI--WYGPDRPKYLGPFSE-NTPSYLTGEYP 74 Score = 31.6 bits (70), Expect(2) = 1e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [61][TOP] >UniRef100_Q9SYW9 Lhcb2 protein n=1 Tax=Arabidopsis thaliana RepID=Q9SYW9_ARATH Length = 265 Score = 54.3 bits (129), Expect(2) = 1e-09 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE +TP+YLTGE+P Sbjct: 39 RTVKSTPQSI--WYGPDRPKYLGPFSE-NTPSYLTGEYP 74 Score = 31.6 bits (70), Expect(2) = 1e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [62][TOP] >UniRef100_Q9SHR7 Putative chlorophyll a/b binding protein n=1 Tax=Arabidopsis thaliana RepID=Q9SHR7_ARATH Length = 265 Score = 54.3 bits (129), Expect(2) = 1e-09 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE +TP+YLTGE+P Sbjct: 39 RTVKSTPQSI--WYGPDRPKYLGPFSE-NTPSYLTGEYP 74 Score = 31.6 bits (70), Expect(2) = 1e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [63][TOP] >UniRef100_A4QPK8 Chloroplast light-harvesting complex II protein Lhcbm5 n=1 Tax=Acetabularia acetabulum RepID=A4QPK8_ACEAT Length = 244 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 87 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 + R + R A+EWYGPDR K+LGPFSEGD P+YLTGEFP Sbjct: 16 NVRNIARNAVEWYGPDRAKWLGPFSEGDVPSYLTGEFP 53 [64][TOP] >UniRef100_Q39768 Light-harvesting chlorophyll a/b binding protein of photosystem II n=1 Tax=Ginkgo biloba RepID=Q39768_GINBI Length = 270 Score = 53.9 bits (128), Expect(2) = 2e-09 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +3 Query: 87 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S +VV + WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 43 SKKVVASSGSPWYGPDRVKYLGPFS-GEAPSYLTGEFP 79 Score = 31.6 bits (70), Expect(2) = 2e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 79 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 109 [65][TOP] >UniRef100_O82425 Light harvesting chlorophyll A/B binding protein n=1 Tax=Prunus persica RepID=O82425_PRUPE Length = 265 Score = 55.1 bits (131), Expect(2) = 2e-09 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 39 RTVKSTPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 30.4 bits (67), Expect(2) = 2e-09 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXL--IHARW 297 PGDYGWDTA P + + G L IH+RW Sbjct: 74 PGDYGWDTAGLSADP----ETFAKNGELEVIHSRW 104 [66][TOP] >UniRef100_A9NLD5 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NLD5_PICSI Length = 266 Score = 56.6 bits (135), Expect(2) = 2e-09 Identities = 30/56 (53%), Positives = 35/56 (62%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFPXRLR 212 S V +S R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP R Sbjct: 27 SKVGASQARITMRRTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFPGDYR 79 Score = 28.5 bits (62), Expect(2) = 2e-09 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDY WDTA P A R +IH+RW Sbjct: 75 PGDYRWDTAGLSADPETF--AKNRELEVIHSRW 105 [67][TOP] >UniRef100_Q93YG3 Chlorophyll a/b binding protein type II n=1 Tax=Glycine max RepID=Q93YG3_SOYBN Length = 265 Score = 53.5 bits (127), Expect(2) = 2e-09 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = +3 Query: 72 TVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 T R+ + P++ WYGPDRPK+LGPFSE P+YLTGEFP Sbjct: 35 TTMRRTVKSAPQSI--WYGPDRPKYLGPFSE-QIPSYLTGEFP 74 Score = 31.6 bits (70), Expect(2) = 2e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 104 [68][TOP] >UniRef100_P08963 Chlorophyll a-b binding protein 2, chloroplastic n=1 Tax=Hordeum vulgare RepID=CB22_HORVU Length = 264 Score = 53.5 bits (127), Expect(2) = 3e-09 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = +3 Query: 75 VSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 VS R + WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 33 VSMRKTAATKKVGSPWYGPDRVKYLGPFS-GESPSYLTGEFP 73 Score = 31.2 bits (69), Expect(2) = 3e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 73 PGDYGWDTAGLSADPETF--AKNRELEVIHGRW 103 [69][TOP] >UniRef100_O64444 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64444_NICSY Length = 265 Score = 53.1 bits (126), Expect(2) = 4e-09 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R S+R TV+ A P WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 32 RVSMRKTVAKPVASSSP-----WYGPDRVKYLGPFS-GESPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 4e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [70][TOP] >UniRef100_O64443 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64443_NICSY Length = 265 Score = 53.1 bits (126), Expect(2) = 4e-09 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R S+R TV+ A P WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 32 RVSMRKTVAKPVASSSP-----WYGPDRVKYLGPFS-GESPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 4e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [71][TOP] >UniRef100_P27493 Chlorophyll a-b binding protein 21, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB22_TOBAC Length = 265 Score = 53.1 bits (126), Expect(2) = 4e-09 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R S+R TV+ A P WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 32 RVSMRKTVAKPVASSSP-----WYGPDRVKYLGPFS-GESPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 4e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [72][TOP] >UniRef100_C6TD73 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TD73_SOYBN Length = 265 Score = 52.8 bits (125), Expect(2) = 4e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE P+YLTGEFP Sbjct: 39 RTVKSAPQSI--WYGPDRPKYLGPFSE-QIPSYLTGEFP 74 Score = 31.6 bits (70), Expect(2) = 4e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 104 [73][TOP] >UniRef100_C6T8R7 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T8R7_SOYBN Length = 265 Score = 52.8 bits (125), Expect(2) = 4e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFSE P+YLTGEFP Sbjct: 39 RTVKSAPQSI--WYGPDRPKYLGPFSE-QIPSYLTGEFP 74 Score = 31.6 bits (70), Expect(2) = 4e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 104 [74][TOP] >UniRef100_A4QPK7 Chloroplast light-harvesting complex II protein Lhcbm6 n=1 Tax=Acetabularia acetabulum RepID=A4QPK7_ACEAT Length = 244 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +3 Query: 87 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 + R + R A+EWYGPDR K+LGPFSEGD P+YLTG+FP Sbjct: 16 NVRNIVRNAVEWYGPDRAKWLGPFSEGDVPSYLTGQFP 53 [75][TOP] >UniRef100_Q945D1 Putative chlorophyll-A-B-binding protein (Fragment) n=1 Tax=Castanea sativa RepID=Q945D1_CASSA Length = 120 Score = 55.8 bits (133), Expect(2) = 4e-09 Identities = 29/52 (55%), Positives = 33/52 (63%), Gaps = 6/52 (11%) Frame = +3 Query: 63 VRPTVSGRSARVVPRAAIE------WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 VR S RV R ++ WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 24 VRKVGSFAGGRVTMRRTVKSAPQSIWYGPDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 28.5 bits (62), Expect(2) = 4e-09 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 P DYGWDTA P A R +IH+RW Sbjct: 74 PEDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [76][TOP] >UniRef100_O64445 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64445_NICSY Length = 265 Score = 52.8 bits (125), Expect(2) = 5e-09 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R S+R TV+ A P WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 32 RVSMRKTVAKPVASSSP-----WYGPDRVKYLGPFS-GEAPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 5e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [77][TOP] >UniRef100_B7FHZ5 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FHZ5_MEDTR Length = 265 Score = 52.4 bits (124), Expect(2) = 5e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDRPK+LGPFSE P+YLTGEFP Sbjct: 49 WYGPDRPKYLGPFSE-QIPSYLTGEFP 74 Score = 31.6 bits (70), Expect(2) = 5e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 104 [78][TOP] >UniRef100_P27520 Chlorophyll a-b binding protein 215, chloroplastic n=1 Tax=Pisum sativum RepID=CB215_PEA Length = 265 Score = 52.4 bits (124), Expect(2) = 5e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDRPK+LGPFSE P+YLTGEFP Sbjct: 49 WYGPDRPKYLGPFSE-QIPSYLTGEFP 74 Score = 31.6 bits (70), Expect(2) = 5e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 104 [79][TOP] >UniRef100_P92919 Chlorophyll a-b binding protein, chloroplastic n=1 Tax=Apium graveolens RepID=CB23_APIGR Length = 264 Score = 52.4 bits (124), Expect(2) = 5e-09 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +3 Query: 75 VSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 VS R P + WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 33 VSMRKTVKAPVSDSPWYGPDRVKYLGPFS-GEAPSYLTGEFP 73 Score = 31.6 bits (70), Expect(2) = 5e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 73 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 103 [80][TOP] >UniRef100_A5HSG6 Chloroplast light-harvesting chlorophyll a/b-binding protein (Fragment) n=1 Tax=Artemisia annua RepID=A5HSG6_ARTAN Length = 254 Score = 52.4 bits (124), Expect(2) = 5e-09 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R S+R T + + +V P + WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 19 RVSMRKTAAPK--KVAPSGS-PWYGPDRVKYLGPFS-GEAPSYLTGEFP 63 Score = 31.6 bits (70), Expect(2) = 5e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 63 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 93 [81][TOP] >UniRef100_A9NQ87 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NQ87_PICSI Length = 253 Score = 57.0 bits (136), Expect(2) = 5e-09 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++K S R T+ R+ R P + WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 25 LVKKVGASQARITMR-RTVRSAPESI--WYGPDRPKYLGPFSE-QTPSYLTGEFP 75 Score = 26.9 bits (58), Expect(2) = 5e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 199 PGDYGWDTA 225 PGDYGWDTA Sbjct: 75 PGDYGWDTA 83 [82][TOP] >UniRef100_A6N154 Chloroplast chlorophyll a-b binding protein (Fragment) n=1 Tax=Oryza sativa Indica Group RepID=A6N154_ORYSI Length = 253 Score = 55.5 bits (132), Expect(2) = 5e-09 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFPXRLR 212 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEFP R Sbjct: 27 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEFPGDYR 66 Score = 28.5 bits (62), Expect(2) = 5e-09 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDY WDTA P A R +IH+RW Sbjct: 62 PGDYRWDTAGLSADPETF--ARNRELEVIHSRW 92 [83][TOP] >UniRef100_Q8LK17 A-B binding protein (Fragment) n=1 Tax=Vicia faba RepID=Q8LK17_VICFA Length = 136 Score = 52.4 bits (124), Expect(2) = 5e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDRPK+LGPFSE P+YLTGEFP Sbjct: 46 WYGPDRPKYLGPFSE-QIPSYLTGEFP 71 Score = 31.6 bits (70), Expect(2) = 5e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 71 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 101 [84][TOP] >UniRef100_C5XBK1 Putative uncharacterized protein Sb02g036380 n=1 Tax=Sorghum bicolor RepID=C5XBK1_SORBI Length = 268 Score = 50.4 bits (119), Expect(2) = 7e-09 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 +A S +R + S R+ + WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 26 AANASPLRDVAAAASGRITMGNDL-WYGPDRVKYLGPFS-AQTPSYLTGEFP 75 Score = 33.1 bits (74), Expect(2) = 7e-09 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 75 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 105 [85][TOP] >UniRef100_P04780 Chlorophyll a-b binding protein 22L, chloroplastic n=1 Tax=Petunia sp. RepID=CB22_PETSP Length = 267 Score = 52.4 bits (124), Expect(2) = 7e-09 Identities = 30/66 (45%), Positives = 38/66 (57%) Frame = +3 Query: 3 SVHYTHNKMAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAY 182 S T N A + K+A ++ +P SG WYGPDR K+LGPFS G+ P+Y Sbjct: 24 SSEITGNGKATMRKTATKA--KPVSSGSP----------WYGPDRVKYLGPFS-GEAPSY 70 Query: 183 LTGEFP 200 LTGEFP Sbjct: 71 LTGEFP 76 Score = 31.2 bits (69), Expect(2) = 7e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [86][TOP] >UniRef100_B7SAW3 Chloroplast chlorophyll a/b binding protein cab-BO3 n=1 Tax=Bambusa oldhamii RepID=B7SAW3_BAMOL Length = 267 Score = 50.4 bits (119), Expect(2) = 7e-09 Identities = 25/53 (47%), Positives = 34/53 (64%) Frame = +3 Query: 42 KSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++A S +R + + R+ + WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 24 RTANASPLRDVAAAANGRITMSNDL-WYGPDRVKYLGPFS-AQTPSYLTGEFP 74 Score = 33.1 bits (74), Expect(2) = 7e-09 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 74 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 104 [87][TOP] >UniRef100_Q41425 Chlorophyll a/b binding protein n=1 Tax=Solanum tuberosum RepID=Q41425_SOLTU Length = 265 Score = 52.4 bits (124), Expect(2) = 7e-09 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S + + R T+ A+ P ++ WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEISGNGRITMRKAVAKSAPSSS-PWYGPDRVKYLGPFS-GESPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 7e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [88][TOP] >UniRef100_Q41424 Chlorophyll a/b binding protein n=1 Tax=Solanum tuberosum RepID=Q41424_SOLTU Length = 265 Score = 52.4 bits (124), Expect(2) = 7e-09 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S + + R T+ A+ P ++ WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEITGNGRITMRKAVAKSAPSSS-PWYGPDRVKYLGPFS-GESPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 7e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [89][TOP] >UniRef100_Q41423 Chlorophyll a/b binding protein n=1 Tax=Solanum tuberosum RepID=Q41423_SOLTU Length = 265 Score = 52.4 bits (124), Expect(2) = 7e-09 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S + + R T+ A+ P ++ WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEITGNGRITMRKAVAKSAPSSS-PWYGPDRVKYLGPFS-GESPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 7e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [90][TOP] >UniRef100_Q41422 Chlorophyll a/b binding protein n=1 Tax=Solanum tuberosum RepID=Q41422_SOLTU Length = 265 Score = 52.4 bits (124), Expect(2) = 7e-09 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S + + R T+ A+ P ++ WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEISGNGRITMRKAVAKSAPSSS-PWYGPDRVKYLGPFS-GESPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 7e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [91][TOP] >UniRef100_Q41421 Chlorophyll a/b binding protein n=1 Tax=Solanum tuberosum RepID=Q41421_SOLTU Length = 265 Score = 52.4 bits (124), Expect(2) = 7e-09 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S + + R T+ A+ P ++ WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEISGNGRITMRKAVAKSAPSSS-PWYGPDRVKYLGPFS-GESPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 7e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [92][TOP] >UniRef100_P07370 Chlorophyll a-b binding protein 1B, chloroplastic n=1 Tax=Solanum lycopersicum RepID=CB2B_SOLLC Length = 265 Score = 52.4 bits (124), Expect(2) = 7e-09 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S + + R T+ A+ P ++ WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEISGNGRITMRKAVAKSAPSSS-PWYGPDRVKYLGPFS-GESPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 7e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [93][TOP] >UniRef100_B2BAK8 Chlorophyll a/b binding protein of LHCII type I n=1 Tax=Lilium longiflorum RepID=B2BAK8_LILLO Length = 264 Score = 52.0 bits (123), Expect(2) = 7e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYG DRPK+LGPFSE TP+YLTGEFP Sbjct: 38 RTVKSAPQSI--WYGADRPKYLGPFSE-QTPSYLTGEFP 73 Score = 31.6 bits (70), Expect(2) = 7e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 73 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 103 [94][TOP] >UniRef100_B8XLF1 Putative chloroplast chlorophyll a/b binding protein (Fragment) n=1 Tax=Solanum nigrum RepID=B8XLF1_SOLNI Length = 249 Score = 52.4 bits (124), Expect(2) = 7e-09 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S + + R T+ A+ P ++ WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 9 SEISGNGRITMRKAVAKSAPSSS-PWYGPDRVKYLGPFS-GESPSYLTGEFP 58 Score = 31.2 bits (69), Expect(2) = 7e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 58 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 88 [95][TOP] >UniRef100_Q41426 Chlorophyll a/b binding protein (Fragment) n=1 Tax=Solanum tuberosum RepID=Q41426_SOLTU Length = 135 Score = 52.4 bits (124), Expect(2) = 7e-09 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S + + R T+ A+ P ++ WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEITGNGRITMRKAVAKSAPSSS-PWYGPDRVKYLGPFS-GESPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 7e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [96][TOP] >UniRef100_A4QPL2 Chloroplast light-harvesting complex II protein Lhcbm7 (Fragment) n=1 Tax=Acetabularia acetabulum RepID=A4QPL2_ACEAT Length = 244 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 87 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 + R + R A+EWYGPDR K+LGPF EGD P+YLTGEFP Sbjct: 16 NVRNIARNAVEWYGPDRAKWLGPFFEGDVPSYLTGEFP 53 [97][TOP] >UniRef100_A3FPF0 Chlorophyll a/b-binding protein n=1 Tax=Nelumbo nucifera RepID=A3FPF0_NELNU Length = 269 Score = 52.0 bits (123), Expect(2) = 9e-09 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = +3 Query: 84 RSARVVPRAAIE---WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 RS PR +I WYGPDR K++GPFS G TP+YLTGEFP Sbjct: 37 RSTLSRPRQSITGGPWYGPDRVKYMGPFS-GQTPSYLTGEFP 77 Score = 31.2 bits (69), Expect(2) = 9e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWD+A P A R +IHARW Sbjct: 77 PGDYGWDSAGLSAEPETF--AKNRELEVIHARW 107 [98][TOP] >UniRef100_C5G6D5 Chloroplast chlorophyll a/b binding protein n=1 Tax=Phyllostachys edulis RepID=C5G6D5_9POAL Length = 267 Score = 50.1 bits (118), Expect(2) = 9e-09 Identities = 25/53 (47%), Positives = 34/53 (64%) Frame = +3 Query: 42 KSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++A S +R + + R+ + WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 24 RAANASPLRDVAAAANGRITMSNDL-WYGPDRLKYLGPFS-AQTPSYLTGEFP 74 Score = 33.1 bits (74), Expect(2) = 9e-09 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 74 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 104 [99][TOP] >UniRef100_C5G6D4 Chloroplast chlorophyll a/b binding protein n=1 Tax=Phyllostachys edulis RepID=C5G6D4_9POAL Length = 267 Score = 50.1 bits (118), Expect(2) = 9e-09 Identities = 25/53 (47%), Positives = 34/53 (64%) Frame = +3 Query: 42 KSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++A S +R + + R+ + WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 24 RAANASPLRDVAAAANGRITMSNDL-WYGPDRLKYLGPFS-AQTPSYLTGEFP 74 Score = 33.1 bits (74), Expect(2) = 9e-09 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 74 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 104 [100][TOP] >UniRef100_Q41449 Chlorophyll a,b binding protein type I n=1 Tax=Solanum tuberosum RepID=Q41449_SOLTU Length = 265 Score = 52.4 bits (124), Expect(2) = 9e-09 Identities = 27/52 (51%), Positives = 32/52 (61%), Gaps = 6/52 (11%) Frame = +3 Query: 63 VRPTVSGRSARVVPRAAIE------WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 +R S RV R ++ WYG DRPK+LGPFSE TP+YLTGEFP Sbjct: 24 IRKIGSFEGGRVTMRRTVKSAPQSIWYGEDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 30.8 bits (68), Expect(2) = 9e-09 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + L +IH RW Sbjct: 74 PGDYGWDTAGLSADPETFARNLEL--EVIHCRW 104 [101][TOP] >UniRef100_Q84TM7 Chlorophyll a/b binding protein n=1 Tax=Nicotiana tabacum RepID=Q84TM7_TOBAC Length = 265 Score = 52.0 bits (123), Expect(2) = 9e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYG DRPK+LGPFSE TP+YLTGEFP Sbjct: 39 RTVKSAPQSI--WYGEDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 9e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--ARNRELEVIHCRW 104 [102][TOP] >UniRef100_P12062 Chlorophyll a-b binding protein 37, chloroplastic n=1 Tax=Petunia sp. RepID=CB26_PETSP Length = 265 Score = 52.0 bits (123), Expect(2) = 9e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYG DRPK+LGPFSE TP+YLTGEFP Sbjct: 39 RTVKSAPQSI--WYGEDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 9e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--ARNRELEVIHCRW 104 [103][TOP] >UniRef100_P14278 Chlorophyll a-b binding protein 4, chloroplastic n=1 Tax=Solanum lycopersicum RepID=CB24_SOLLC Length = 265 Score = 52.0 bits (123), Expect(2) = 9e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYG DRPK+LGPFSE TP+YLTGEFP Sbjct: 39 RTVKSAPQSI--WYGEDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 9e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--ARNRELEVIHCRW 104 [104][TOP] >UniRef100_P27494 Chlorophyll a-b binding protein 36, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB23_TOBAC Length = 265 Score = 52.0 bits (123), Expect(2) = 9e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYG DRPK+LGPFSE TP+YLTGEFP Sbjct: 39 RTVKSAPQSI--WYGEDRPKYLGPFSE-QTPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 9e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--ARNRELEVIHCRW 104 [105][TOP] >UniRef100_P27518 Chlorophyll a-b binding protein 151, chloroplastic n=1 Tax=Gossypium hirsutum RepID=CB21_GOSHI Length = 265 Score = 52.0 bits (123), Expect(2) = 9e-09 Identities = 26/49 (53%), Positives = 31/49 (63%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R S+R TV + WYGPDRPK+LGPFS+ P+YLTGEFP Sbjct: 34 RVSMRRTVKSAPTSI-------WYGPDRPKYLGPFSD-QIPSYLTGEFP 74 Score = 31.2 bits (69), Expect(2) = 9e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [106][TOP] >UniRef100_Q9LKI1 LHCII type II chlorophyll a/b-binding protein n=1 Tax=Vigna radiata var. radiata RepID=Q9LKI1_PHAAU Length = 265 Score = 51.6 bits (122), Expect(2) = 9e-09 Identities = 23/39 (58%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYGPDRPK+LGPFS+ P+YLTGEFP Sbjct: 39 RTVKSAPQSI--WYGPDRPKYLGPFSD-QIPSYLTGEFP 74 Score = 31.6 bits (70), Expect(2) = 9e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 74 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 104 [107][TOP] >UniRef100_Q9LKH9 LHCII type I chlorophyll a/b-binding protein n=1 Tax=Vigna radiata var. radiata RepID=Q9LKH9_PHAAU Length = 264 Score = 51.6 bits (122), Expect(2) = 9e-09 Identities = 28/52 (53%), Positives = 33/52 (63%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S R S+R T S + P WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 28 SGGRISMRKTASKSVSSGSP-----WYGPDRVKYLGPFS-GEAPSYLTGEFP 73 Score = 31.6 bits (70), Expect(2) = 9e-09 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 73 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 103 [108][TOP] >UniRef100_P14279 Chlorophyll a-b binding protein 5, chloroplastic (Fragment) n=1 Tax=Solanum lycopersicum RepID=CB25_SOLLC Length = 237 Score = 52.0 bits (123), Expect(2) = 9e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R+ + P++ WYG DRPK+LGPFSE TP+YLTGEFP Sbjct: 11 RTVKSAPQSI--WYGEDRPKYLGPFSE-QTPSYLTGEFP 46 Score = 31.2 bits (69), Expect(2) = 9e-09 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 46 PGDYGWDTAGLSADPETF--ARNRELEVIHCRW 76 [109][TOP] >UniRef100_O64446 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64446_NICSY Length = 267 Score = 51.6 bits (122), Expect(2) = 1e-08 Identities = 30/66 (45%), Positives = 37/66 (56%) Frame = +3 Query: 3 SVHYTHNKMAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAY 182 S T N + K+A S +P SG WYGPDR K+LGPFS G++P+Y Sbjct: 24 SSEITGNGKVTMRKTA--SKAKPVSSGSP----------WYGPDRVKYLGPFS-GESPSY 70 Query: 183 LTGEFP 200 LTGEFP Sbjct: 71 LTGEFP 76 Score = 31.2 bits (69), Expect(2) = 1e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [110][TOP] >UniRef100_P07369 Chlorophyll a-b binding protein 3C, chloroplastic n=1 Tax=Solanum lycopersicum RepID=CB2G_SOLLC Length = 267 Score = 51.6 bits (122), Expect(2) = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAA-IEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S + + R T+ + + P ++ WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFS-GESPSYLTGEFP 76 Score = 31.2 bits (69), Expect(2) = 1e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [111][TOP] >UniRef100_P27492 Chlorophyll a-b binding protein 16, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB21_TOBAC Length = 266 Score = 51.6 bits (122), Expect(2) = 1e-08 Identities = 30/66 (45%), Positives = 37/66 (56%) Frame = +3 Query: 3 SVHYTHNKMAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAY 182 S T N + K+A S +P SG WYGPDR K+LGPFS G++P+Y Sbjct: 23 SSEVTGNGKVTMRKTA--SKAKPVSSGSP----------WYGPDRVKYLGPFS-GESPSY 69 Query: 183 LTGEFP 200 LTGEFP Sbjct: 70 LTGEFP 75 Score = 31.2 bits (69), Expect(2) = 1e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 105 [112][TOP] >UniRef100_Q9ZSV2 Chlorophyll a/b binding protein n=1 Tax=Acetabularia acetabulum RepID=Q9ZSV2_ACEAT Length = 251 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/56 (48%), Positives = 39/56 (69%) Frame = +3 Query: 33 AIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A+ V ++ + + + RV +AA+EWYGPDR K+LGP+S+G P+YLTGEFP Sbjct: 4 AVQSVLVGATAKTALVKGNKRVSVQAAVEWYGPDRAKWLGPYSDGAVPSYLTGEFP 59 [113][TOP] >UniRef100_B6SUM9 Chlorophyll a-b binding protein of LHCII type III n=1 Tax=Zea mays RepID=B6SUM9_MAIZE Length = 272 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 54 WYGPDRVKYLGPFS-AQTPSYLTGEFP 79 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 79 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 109 [114][TOP] >UniRef100_A5BW14 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BW14_VITVI Length = 269 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-AQTPSYLTGEFP 76 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 76 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 106 [115][TOP] >UniRef100_O64450 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64450_NICSY Length = 267 Score = 51.2 bits (121), Expect(2) = 1e-08 Identities = 29/66 (43%), Positives = 38/66 (57%) Frame = +3 Query: 3 SVHYTHNKMAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAY 182 S T N + K+A ++ +P SG WYGPDR K+LGPFS G++P+Y Sbjct: 24 SSEITGNGKVTMRKTATKA--KPVSSGSP----------WYGPDRVKYLGPFS-GESPSY 70 Query: 183 LTGEFP 200 LTGEFP Sbjct: 71 LTGEFP 76 Score = 31.2 bits (69), Expect(2) = 1e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [116][TOP] >UniRef100_O64449 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64449_NICSY Length = 267 Score = 51.2 bits (121), Expect(2) = 1e-08 Identities = 28/56 (50%), Positives = 34/56 (60%) Frame = +3 Query: 33 AIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 AIM+ V + +P SG WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 33 AIMRKTV-TKAKPVSSGSP----------WYGPDRVKYLGPFS-GEAPSYLTGEFP 76 Score = 31.2 bits (69), Expect(2) = 1e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [117][TOP] >UniRef100_P27491 Chlorophyll a-b binding protein 7, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB27_TOBAC Length = 267 Score = 51.2 bits (121), Expect(2) = 1e-08 Identities = 28/56 (50%), Positives = 34/56 (60%) Frame = +3 Query: 33 AIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 AIM+ V + +P SG WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 33 AIMRKTV-TKAKPVSSGSP----------WYGPDRVKYLGPFS-GEAPSYLTGEFP 76 Score = 31.2 bits (69), Expect(2) = 1e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [118][TOP] >UniRef100_Q40247 Light-harvesting chlorophyll a/b-binding protein (LHCP) n=1 Tax=Lactuca sativa RepID=Q40247_LACSA Length = 266 Score = 52.4 bits (124), Expect(2) = 1e-08 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R S+R T + + A + WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 31 RVSMRKTAAAKKAAP---SGSPWYGPDRVKYLGPFS-GEAPSYLTGEFP 75 Score = 30.0 bits (66), Expect(2) = 1e-08 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R +IH RW Sbjct: 75 PGDYGWDTAGLSADPETF--SKNRELEVIHCRW 105 [119][TOP] >UniRef100_O64447 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64447_NICSY Length = 266 Score = 51.2 bits (121), Expect(2) = 1e-08 Identities = 30/66 (45%), Positives = 37/66 (56%) Frame = +3 Query: 3 SVHYTHNKMAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAY 182 S T N + K+A S +P SG WYGPDR K+LGPFS G++P+Y Sbjct: 23 SSEITGNGKVTMRKTA--SKAKPVSSGSL----------WYGPDRVKYLGPFS-GESPSY 69 Query: 183 LTGEFP 200 LTGEFP Sbjct: 70 LTGEFP 75 Score = 31.2 bits (69), Expect(2) = 1e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 105 [120][TOP] >UniRef100_B1P0S0 Chloroplast chlorophyll-a/b binding protein n=1 Tax=Medicago sativa subsp. falcata RepID=B1P0S0_MEDFA Length = 266 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 48 WYGPDRVKYLGPFS-AQTPSYLTGEFP 73 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 73 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 103 [121][TOP] >UniRef100_Q5I8X1 Light-harvesting chlorophyll-a/b binding protein Lhcb3 n=1 Tax=Pisum sativum RepID=Q5I8X1_PEA Length = 265 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 47 WYGPDRVKYLGPFS-AQTPSYLTGEFP 72 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 72 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 102 [122][TOP] >UniRef100_Q04918 Chlorophyll a/b-binding protein n=1 Tax=Pisum sativum RepID=Q04918_PEA Length = 265 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 47 WYGPDRVKYLGPFS-AQTPSYLTGEFP 72 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 72 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 102 [123][TOP] >UniRef100_A7QYH5 Chromosome undetermined scaffold_247, whole genome shotgun sequence n=2 Tax=Vitis vinifera RepID=A7QYH5_VITVI Length = 264 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 46 WYGPDRVKYLGPFS-AQTPSYLTGEFP 71 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 71 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 101 [124][TOP] >UniRef100_A7P1F1 Chromosome chr19 scaffold_4, whole genome shotgun sequence n=2 Tax=Vitis vinifera RepID=A7P1F1_VITVI Length = 264 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 46 WYGPDRVKYLGPFS-AQTPSYLTGEFP 71 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 71 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 101 [125][TOP] >UniRef100_Q9SDT2 Chlorophyll a/b-binding protein n=1 Tax=Daucus carota RepID=Q9SDT2_DAUCA Length = 264 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 46 WYGPDRVKYLGPFS-AQTPSYLTGEFP 71 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 71 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 101 [126][TOP] >UniRef100_B9N576 Light-harvesting complex II protein Lhcb3 n=1 Tax=Populus trichocarpa RepID=B9N576_POPTR Length = 263 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 45 WYGPDRVKYLGPFS-AQTPSYLTGEFP 70 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 70 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 100 [127][TOP] >UniRef100_B9I013 Light-harvesting complex II protein Lhcb3 n=1 Tax=Populus trichocarpa RepID=B9I013_POPTR Length = 263 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 45 WYGPDRVKYLGPFS-AQTPSYLTGEFP 70 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 70 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 100 [128][TOP] >UniRef100_Q5ZF93 Light harvesting protein 1 (Fragment) n=1 Tax=Plantago major RepID=Q5ZF93_PLAMJ Length = 229 Score = 50.8 bits (120), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 13 WYGPDRVKYLGPFS-GESPSYLTGEFP 38 Score = 31.6 bits (70), Expect(2) = 1e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 38 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 68 [129][TOP] >UniRef100_A9PJV4 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PJV4_9ROSI Length = 224 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 6 WYGPDRVKYLGPFS-AQTPSYLTGEFP 31 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 31 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 61 [130][TOP] >UniRef100_O22496 Chlorophyll a/b binding protein n=1 Tax=Tetraselmis sp. RG-15 RepID=O22496_9CHLO Length = 251 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/60 (55%), Positives = 43/60 (71%), Gaps = 2/60 (3%) Frame = +3 Query: 27 MAAIMKSAVRSSVRPTV--SGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 MAA+ + ++V V S R + V RAA+E+YGPDR K+LGPFS+ DTP+YLTGEFP Sbjct: 1 MAAVAARSFAATVAGQVGASARGQKQVTRAAVEFYGPDRAKWLGPFSD-DTPSYLTGEFP 59 [131][TOP] >UniRef100_O04685 Chlorophyll a/b-binding protein n=1 Tax=Mesembryanthemum crystallinum RepID=O04685_MESCR Length = 267 Score = 50.8 bits (120), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GESPSYLTGEFP 76 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [132][TOP] >UniRef100_P12333 Chlorophyll a-b binding protein, chloroplastic n=2 Tax=Spinacia oleracea RepID=CB2A_SPIOL Length = 267 Score = 50.8 bits (120), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GESPSYLTGEFP 76 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [133][TOP] >UniRef100_P27496 Chlorophyll a-b binding protein 50, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB25_TOBAC Length = 267 Score = 50.8 bits (120), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GESPSYLTGEFP 76 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [134][TOP] >UniRef100_P04783 Chlorophyll a-b binding protein 91R, chloroplastic n=1 Tax=Petunia sp. RepID=CB25_PETSP Length = 267 Score = 50.8 bits (120), Expect(2) = 2e-08 Identities = 29/66 (43%), Positives = 37/66 (56%) Frame = +3 Query: 3 SVHYTHNKMAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAY 182 S T N A + K+ ++ +P SG WYGPDR K+LGPFS G+ P+Y Sbjct: 24 SSEITGNGKATMRKTVTKA--KPVSSGSP----------WYGPDRVKYLGPFS-GEAPSY 70 Query: 183 LTGEFP 200 LTGEFP Sbjct: 71 LTGEFP 76 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAELSADPETF--AKNRELEVIHCRW 106 [135][TOP] >UniRef100_P27495 Chlorophyll a-b binding protein 40, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB24_TOBAC Length = 267 Score = 50.8 bits (120), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GESPSYLTGEFP 76 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [136][TOP] >UniRef100_Q40961 Light-harvesting chlorophyll a/b-binding protein n=1 Tax=Prunus persica RepID=Q40961_PRUPE Length = 267 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GEAPSYLTGEFP 76 Score = 31.6 bits (70), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 106 [137][TOP] >UniRef100_P12470 Chlorophyll a-b binding protein E, chloroplastic n=1 Tax=Nicotiana plumbaginifolia RepID=CB25_NICPL Length = 266 Score = 50.8 bits (120), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 50 WYGPDRVKYLGPFS-GESPSYLTGEFP 75 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 105 [138][TOP] >UniRef100_P04782 Chlorophyll a-b binding protein 25, chloroplastic n=1 Tax=Petunia sp. RepID=CB24_PETSP Length = 266 Score = 50.8 bits (120), Expect(2) = 2e-08 Identities = 29/66 (43%), Positives = 37/66 (56%) Frame = +3 Query: 3 SVHYTHNKMAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAY 182 S T N A + K+ ++ +P SG WYGPDR K+LGPFS G+ P+Y Sbjct: 23 SSQITGNGKATMRKTVTKA--KPVSSGSP----------WYGPDRVKYLGPFS-GEAPSY 69 Query: 183 LTGEFP 200 LTGEFP Sbjct: 70 LTGEFP 75 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 105 [139][TOP] >UniRef100_O22669 Chlorophyll a/b binding protein of LHCII type I n=1 Tax=Panax ginseng RepID=O22669_PANGI Length = 266 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 50 WYGPDRVKYLGPFS-GEAPSYLTGEFP 75 Score = 31.6 bits (70), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 105 [140][TOP] >UniRef100_A9RT62 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RT62_PHYPA Length = 265 Score = 52.0 bits (123), Expect(2) = 2e-08 Identities = 26/47 (55%), Positives = 31/47 (65%), Gaps = 6/47 (12%) Frame = +3 Query: 75 VSGRSARVVPRAAIE------WYGPDRPKFLGPFSEGDTPAYLTGEF 197 V ARV R ++ WYG DRPK+LGPFS G+TP+YLTGEF Sbjct: 28 VGSSEARVTMRRTVKSTSDSIWYGADRPKYLGPFS-GETPSYLTGEF 73 Score = 30.0 bits (66), Expect(2) = 2e-08 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 75 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 104 [141][TOP] >UniRef100_Q9LKI0 LHCII type I chlorophyll a/b-binding protein n=1 Tax=Vigna radiata var. radiata RepID=Q9LKI0_PHAAU Length = 264 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 48 WYGPDRVKYLGPFS-GEAPSYLTGEFP 73 Score = 31.6 bits (70), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 73 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 103 [142][TOP] >UniRef100_Q10HC8 Chlorophyll a-b binding protein, chloroplast, putative, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q10HC8_ORYSJ Length = 219 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +3 Query: 123 YGPDRPKFLGPFSEGDTPAYLTGEFP 200 YGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 4 YGPDRPKYLGPFSE-QTPSYLTGEFP 28 Score = 31.6 bits (70), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 28 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 58 [143][TOP] >UniRef100_B1PL33 Chloroplast chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera elata subsp. hookeri RepID=B1PL33_OENEH Length = 119 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GEAPSYLTGEFP 76 Score = 31.6 bits (70), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 106 [144][TOP] >UniRef100_B1PL34 Chloroplast chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera grandiflora RepID=B1PL34_9MYRT Length = 118 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 38 WYGPDRVKYLGPFS-GEAPSYLTGEFP 63 Score = 31.6 bits (70), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 63 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 93 [145][TOP] >UniRef100_P07371 Chlorophyll a-b binding protein AB80, chloroplastic n=1 Tax=Pisum sativum RepID=CB22_PEA Length = 269 Score = 51.2 bits (121), Expect(2) = 2e-08 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +3 Query: 87 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 + + V + WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 42 TTKKVASSGSPWYGPDRVKYLGPFS-GESPSYLTGEFP 78 Score = 30.4 bits (67), Expect(2) = 2e-08 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R +IH+RW Sbjct: 78 PGDYGWDTAGLSADPETF--SKNRELEVIHSRW 108 [146][TOP] >UniRef100_P27490 Chlorophyll a-b binding protein 8, chloroplastic n=1 Tax=Pisum sativum RepID=CB28_PEA Length = 268 Score = 51.2 bits (121), Expect(2) = 2e-08 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +3 Query: 87 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 + + V + WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 41 TTKKVASSGSPWYGPDRVKYLGPFS-GESPSYLTGEFP 77 Score = 30.4 bits (67), Expect(2) = 2e-08 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R +IH+RW Sbjct: 77 PGDYGWDTAGLSADPETF--SKNRELEVIHSRW 107 [147][TOP] >UniRef100_O64448 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64448_NICSY Length = 267 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GNSPSYLTGEFP 76 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [148][TOP] >UniRef100_O04687 Chlorophyll a/b-binding protein n=1 Tax=Mesembryanthemum crystallinum RepID=O04687_MESCR Length = 267 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GEAPSYLTGEFP 76 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [149][TOP] >UniRef100_A3F6K2 Chloroplast chlorophyll a/b binding protein n=1 Tax=Pisum sativum RepID=A3F6K2_PEA Length = 266 Score = 51.2 bits (121), Expect(2) = 2e-08 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +3 Query: 87 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 + + V + WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 39 TTKKVASSGSPWYGPDRVKYLGPFS-GESPSYLTGEFP 75 Score = 30.4 bits (67), Expect(2) = 2e-08 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--SKNRELEVIHSRW 105 [150][TOP] >UniRef100_Q9S7M0 Lhcb3 chlorophyll a/b binding protein n=1 Tax=Arabidopsis thaliana RepID=Q9S7M0_ARATH Length = 265 Score = 48.5 bits (114), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 47 WYGPDRVKYLGPFSV-QTPSYLTGEFP 72 Score = 33.1 bits (74), Expect(2) = 2e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 72 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 102 [151][TOP] >UniRef100_Q677F6 Chloroplast chlorophyll A-B binding protein 40 (Fragment) n=1 Tax=Hyacinthus orientalis RepID=Q677F6_HYAOR Length = 237 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 36 WYGPDRVKYLGPFS-GEAPSYLTGEFP 61 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 61 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 91 [152][TOP] >UniRef100_A2SY32 Light-harvesting chlorophyll-a/b binding protein LhcbM1 (Fragment) n=1 Tax=Scenedesmus obliquus RepID=A2SY32_SCEOB Length = 223 Score = 51.6 bits (122), Expect(2) = 2e-08 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 10/67 (14%) Frame = +3 Query: 27 MAAIMKSAVRSSVRPT-VSGRSARVVPRAAIE---------WYGPDRPKFLGPFSEGDTP 176 MA + K+ ++ VRP R +V R ++ WYGPDRPK+LG S G+TP Sbjct: 1 MALLCKTFSKAGVRPARAQRRVVKVEARRTVKGASSAPDSVWYGPDRPKYLGWLS-GETP 59 Query: 177 AYLTGEF 197 AYLTGEF Sbjct: 60 AYLTGEF 66 Score = 30.0 bits (66), Expect(2) = 2e-08 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P + R LIHARW Sbjct: 68 GDYGWDTAGLSADPETFKRY--RELELIHARW 97 [153][TOP] >UniRef100_Q39339 LHC II Type III chlorophyll a /b binding protein (Fragment) n=1 Tax=Brassica napus RepID=Q39339_BRANA Length = 202 Score = 48.5 bits (114), Expect(2) = 2e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 47 WYGPDRVKYLGPFSV-QTPSYLTGEFP 72 Score = 33.1 bits (74), Expect(2) = 2e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 72 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 102 [154][TOP] >UniRef100_Q42016 CHLOROPHYLL A-B BINDING PROTEIN (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q42016_ARATH Length = 104 Score = 48.5 bits (114), Expect(2) = 3e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 47 WYGPDRVKYLGPFSV-QTPSYLTGEFP 72 Score = 33.1 bits (74), Expect(2) = 3e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 72 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 102 [155][TOP] >UniRef100_P27523 Chlorophyll a-b binding protein of LHCII type III, chloroplastic n=1 Tax=Hordeum vulgare RepID=CB23_HORVU Length = 268 Score = 48.1 bits (113), Expect(2) = 3e-08 Identities = 24/53 (45%), Positives = 33/53 (62%) Frame = +3 Query: 42 KSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 ++A S +R + + R+ + WYGPDR K+LGPFS TP+YL GEFP Sbjct: 25 RAASASPLRDIAAATNGRITMGNDL-WYGPDRVKYLGPFS-AQTPSYLNGEFP 75 Score = 33.1 bits (74), Expect(2) = 3e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 75 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 105 [156][TOP] >UniRef100_A9RAS2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RAS2_PHYPA Length = 267 Score = 51.2 bits (121), Expect(2) = 3e-08 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEF 197 WYG DRPKFLGPFS G+TP+YLTGEF Sbjct: 51 WYGADRPKFLGPFS-GETPSYLTGEF 75 Score = 30.0 bits (66), Expect(2) = 3e-08 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 77 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 106 [157][TOP] >UniRef100_O04686 Chlorophyll a/b-binding protein n=1 Tax=Mesembryanthemum crystallinum RepID=O04686_MESCR Length = 267 Score = 50.8 bits (120), Expect(2) = 3e-08 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GESPSYLTGEFP 76 Score = 30.4 bits (67), Expect(2) = 3e-08 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETFTK--NRELEVIHCRW 106 [158][TOP] >UniRef100_Q8VZ87 Chlorophyll a/b-binding protein n=1 Tax=Arabidopsis thaliana RepID=Q8VZ87_ARATH Length = 267 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S V S R T+ A+ + WYG DR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFS-GESPSYLTGEFP 75 Score = 31.6 bits (70), Expect(2) = 3e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 105 [159][TOP] >UniRef100_P04778 Chlorophyll a-b binding protein 2, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=CB22_ARATH Length = 267 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S V S R T+ A+ + WYG DR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFS-GESPSYLTGEFP 75 Score = 31.6 bits (70), Expect(2) = 3e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 105 [160][TOP] >UniRef100_P04777 Chlorophyll a-b binding protein 165/180, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=CB21_ARATH Length = 267 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S V S R T+ A+ + WYG DR K+LGPFS G++P+YLTGEFP Sbjct: 25 SEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFS-GESPSYLTGEFP 75 Score = 31.6 bits (70), Expect(2) = 3e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 75 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 105 [161][TOP] >UniRef100_P04779 Chlorophyll a-b binding protein 13, chloroplastic n=1 Tax=Petunia sp. RepID=CB21_PETSP Length = 266 Score = 50.4 bits (119), Expect(2) = 3e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 50 WYGPDRVKYLGPFS-GEAPSYLTGEFP 75 Score = 30.8 bits (68), Expect(2) = 3e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 75 PGDYGWDTAGLSADPATF--AKNRKLEVIHCRW 105 [162][TOP] >UniRef100_B0L0Y1 Chloroplast chlorophyll a/b binding protein n=1 Tax=Phyllostachys edulis RepID=B0L0Y1_9POAL Length = 263 Score = 52.4 bits (124), Expect(2) = 3e-08 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 197 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEF Sbjct: 37 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEF 71 Score = 28.9 bits (63), Expect(2) = 3e-08 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IH+RW Sbjct: 73 GDYGWDTAGLSADPETF--ARNRELEVIHSRW 102 [163][TOP] >UniRef100_Q9C8S5 Chlorophyll A-B-binding protein 2, 5' partial; 1-750 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q9C8S5_ARATH Length = 249 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S V S R T+ A+ + WYG DR K+LGPFS G++P+YLTGEFP Sbjct: 7 SEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFS-GESPSYLTGEFP 57 Score = 31.6 bits (70), Expect(2) = 3e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 57 PGDYGWDTAGLSADPETF--ARNRELEVIHSRW 87 [164][TOP] >UniRef100_B3VN37 Chloroplast chlorophyll a/b binding protein (Fragment) n=1 Tax=Phyllostachys edulis RepID=B3VN37_9POAL Length = 181 Score = 52.4 bits (124), Expect(2) = 3e-08 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 197 R+ + P++ WYGPDRPK+LGPFSE TP+YLTGEF Sbjct: 30 RTVKSAPQSI--WYGPDRPKYLGPFSE-QTPSYLTGEF 64 Score = 28.9 bits (63), Expect(2) = 3e-08 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IH+RW Sbjct: 66 GDYGWDTAGLSADPETF--ARNRELEVIHSRW 95 [165][TOP] >UniRef100_Q765P6 Light-harvesting chlorophyll a/b-binding protein 1 n=1 Tax=Physcomitrella patens subsp. patens RepID=Q765P6_PHYPA Length = 267 Score = 50.8 bits (120), Expect(2) = 4e-08 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 197 S R ++R TVS S + WYG DRPKFLGPFS G+TP+YL GEF Sbjct: 31 SQARVTMRKTVSKSSG-----SDSIWYGADRPKFLGPFS-GETPSYLNGEF 75 Score = 30.0 bits (66), Expect(2) = 4e-08 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 77 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 106 [166][TOP] >UniRef100_A9T769 Predicted protein n=2 Tax=Physcomitrella patens RepID=A9T769_PHYPA Length = 268 Score = 50.4 bits (119), Expect(2) = 5e-08 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 8/55 (14%) Frame = +3 Query: 57 SSVRPTVSGRSARVVPRAAIE--------WYGPDRPKFLGPFSEGDTPAYLTGEF 197 S + V+ ARV R + WYG DRPKFLGPFS G+TP+YL GEF Sbjct: 23 SELSRKVNAGEARVTMRKTVSKSSGSDSIWYGADRPKFLGPFS-GETPSYLNGEF 76 Score = 30.0 bits (66), Expect(2) = 5e-08 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 78 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 107 [167][TOP] >UniRef100_B9SID9 Chlorophyll A/B binding protein, putative n=1 Tax=Ricinus communis RepID=B9SID9_RICCO Length = 268 Score = 47.4 bits (111), Expect(2) = 5e-08 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YL GEFP Sbjct: 50 WYGPDRVKYLGPFS-AQTPSYLNGEFP 75 Score = 33.1 bits (74), Expect(2) = 5e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 75 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 105 [168][TOP] >UniRef100_A4F3R4 Major chlorophyll a/b binding protein LHCb1.1 n=1 Tax=Spinacia oleracea RepID=A4F3R4_SPIOL Length = 267 Score = 50.4 bits (119), Expect(2) = 5e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GEAPSYLTGEFP 76 Score = 30.0 bits (66), Expect(2) = 5e-08 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--SKNRELEVIHCRW 106 [169][TOP] >UniRef100_A4F3R3 Major chlorophyll a/b binding protein LHCb1.2 n=1 Tax=Spinacia oleracea RepID=A4F3R3_SPIOL Length = 267 Score = 50.4 bits (119), Expect(2) = 5e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GEAPSYLTGEFP 76 Score = 30.0 bits (66), Expect(2) = 5e-08 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--SKNRELEVIHCRW 106 [170][TOP] >UniRef100_Q6ZF30 Os07g0562700 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ZF30_ORYSJ Length = 266 Score = 47.4 bits (111), Expect(2) = 5e-08 Identities = 23/46 (50%), Positives = 29/46 (63%) Frame = +3 Query: 63 VRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 VR + + R+ + WYGPDR K+LGPFS TP+YL GEFP Sbjct: 30 VRDIAAAATGRITMSKEL-WYGPDRVKYLGPFS-AQTPSYLRGEFP 73 Score = 33.1 bits (74), Expect(2) = 5e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 73 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 103 [171][TOP] >UniRef100_P27489 Chlorophyll a-b binding protein 13, chloroplastic n=1 Tax=Solanum lycopersicum RepID=CB23_SOLLC Length = 265 Score = 47.4 bits (111), Expect(2) = 5e-08 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YL GEFP Sbjct: 47 WYGPDRVKYLGPFS-AQTPSYLNGEFP 72 Score = 33.1 bits (74), Expect(2) = 5e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 72 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 102 [172][TOP] >UniRef100_Q677D0 Chloroplast chlorophyll A-B binding protein 40 n=1 Tax=Hyacinthus orientalis RepID=Q677D0_HYAOR Length = 211 Score = 50.4 bits (119), Expect(2) = 5e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GEAPSYLTGEFP 76 Score = 30.0 bits (66), Expect(2) = 5e-08 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P + R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--SKNRELEVIHCRW 106 [173][TOP] >UniRef100_Q9XQB1 LHCII type III chlorophyll a/b binding protein n=1 Tax=Vigna radiata var. radiata RepID=Q9XQB1_PHAAU Length = 269 Score = 47.0 bits (110), Expect(2) = 7e-08 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YL GEFP Sbjct: 51 WYGPDRVKYLGPFS-AQTPSYLKGEFP 76 Score = 33.1 bits (74), Expect(2) = 7e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 76 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 106 [174][TOP] >UniRef100_C6TKW2 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TKW2_SOYBN Length = 268 Score = 47.0 bits (110), Expect(2) = 7e-08 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YL GEFP Sbjct: 50 WYGPDRVKYLGPFS-AQTPSYLKGEFP 75 Score = 33.1 bits (74), Expect(2) = 7e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 75 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 105 [175][TOP] >UniRef100_P12469 Chlorophyll a-b binding protein C, chloroplastic n=1 Tax=Nicotiana plumbaginifolia RepID=CB23_NICPL Length = 267 Score = 48.9 bits (115), Expect(2) = 7e-08 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGP+R K+LGPFS G++P+YLTGEFP Sbjct: 51 WYGPNRVKYLGPFS-GESPSYLTGEFP 76 Score = 31.2 bits (69), Expect(2) = 7e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 76 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [176][TOP] >UniRef100_C6T868 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T868_SOYBN Length = 267 Score = 47.0 bits (110), Expect(2) = 7e-08 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YL GEFP Sbjct: 49 WYGPDRVKYLGPFS-AQTPSYLKGEFP 74 Score = 33.1 bits (74), Expect(2) = 7e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 74 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 104 [177][TOP] >UniRef100_A9SGM1 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SGM1_PHYPA Length = 266 Score = 50.1 bits (118), Expect(2) = 7e-08 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 197 S R S+R TVS S + WYG DRPK+LGPFS G+TP+YL GEF Sbjct: 30 SQARVSMRKTVSKSSG-----SDSIWYGADRPKWLGPFS-GETPSYLNGEF 74 Score = 30.0 bits (66), Expect(2) = 7e-08 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 76 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 105 [178][TOP] >UniRef100_A2YMN1 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YMN1_ORYSI Length = 266 Score = 47.0 bits (110), Expect(2) = 7e-08 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YL GEFP Sbjct: 48 WYGPDRVKYLGPFS-AQTPSYLRGEFP 73 Score = 33.1 bits (74), Expect(2) = 7e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 73 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 103 [179][TOP] >UniRef100_A9T914 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9T914_PHYPA Length = 263 Score = 50.1 bits (118), Expect(2) = 7e-08 Identities = 26/45 (57%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = +3 Query: 75 VSGRSARVVPRAAIE----WYGPDRPKFLGPFSEGDTPAYLTGEF 197 V ARV R + WYG DRPKFLGPFS G+TP+YL GEF Sbjct: 28 VGANEARVTMRKSAGSDSIWYGADRPKFLGPFS-GETPSYLNGEF 71 Score = 30.0 bits (66), Expect(2) = 7e-08 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 73 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 102 [180][TOP] >UniRef100_Q677H3 Chloroplast chlorophyll A-B binding protein (Fragment) n=1 Tax=Hyacinthus orientalis RepID=Q677H3_HYAOR Length = 239 Score = 48.9 bits (115), Expect(2) = 7e-08 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGP+R K+LGPFS G+ P+YLTGEFP Sbjct: 62 WYGPERVKYLGPFS-GEAPSYLTGEFP 87 Score = 31.2 bits (69), Expect(2) = 7e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 87 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 117 [181][TOP] >UniRef100_Q39341 LHCII Type III chlorophyll a/b binding protein (Fragment) n=1 Tax=Brassica napus RepID=Q39341_BRANA Length = 221 Score = 48.5 bits (114), Expect(2) = 7e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YLTGEFP Sbjct: 3 WYGPDRVKYLGPFSV-QTPSYLTGEFP 28 Score = 31.6 bits (70), Expect(2) = 7e-08 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PG+YGWDTA P A RA +IH RW Sbjct: 28 PGEYGWDTAGLSADPEAF--AKNRALEVIHGRW 58 [182][TOP] >UniRef100_Q677H7 Chloroplast chlorophyll A-B binding protein 3C (Fragment) n=1 Tax=Hyacinthus orientalis RepID=Q677H7_HYAOR Length = 220 Score = 48.9 bits (115), Expect(2) = 7e-08 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGP+R K+LGPFS G+ P+YLTGEFP Sbjct: 7 WYGPERVKYLGPFS-GEAPSYLTGEFP 32 Score = 31.2 bits (69), Expect(2) = 7e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 32 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 62 [183][TOP] >UniRef100_A6H5B7 Putative LHCII type III chlorophyll a/b binding protein (Fragment) n=1 Tax=Vigna unguiculata RepID=A6H5B7_VIGUN Length = 211 Score = 47.0 bits (110), Expect(2) = 7e-08 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+YL GEFP Sbjct: 51 WYGPDRVKYLGPFS-AQTPSYLKGEFP 76 Score = 33.1 bits (74), Expect(2) = 7e-08 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 76 PGDYGWDTAGLSADPEAF--AKNRALEVIHGRW 106 [184][TOP] >UniRef100_P20866 Chlorophyll a-b binding protein, chloroplastic n=1 Tax=Physcomitrella patens RepID=CB2_PHYPA Length = 269 Score = 49.7 bits (117), Expect(2) = 9e-08 Identities = 26/52 (50%), Positives = 30/52 (57%), Gaps = 8/52 (15%) Frame = +3 Query: 66 RPTVSGRSARVVPRAAIE--------WYGPDRPKFLGPFSEGDTPAYLTGEF 197 R + ARV R + WYG DRPKFLGPFS G+TP+YL GEF Sbjct: 26 RKVLGNVEARVTMRRTVSKSAGSDTIWYGADRPKFLGPFS-GETPSYLNGEF 76 Score = 30.0 bits (66), Expect(2) = 9e-08 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 78 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 107 [185][TOP] >UniRef100_A9RNP2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RNP2_PHYPA Length = 265 Score = 49.7 bits (117), Expect(2) = 9e-08 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 197 R S+R T S S + WYG DRPK+LGPFS G+TP+YL GEF Sbjct: 34 RISMRKTASKSSDSI-------WYGADRPKYLGPFS-GETPSYLNGEF 73 Score = 30.0 bits (66), Expect(2) = 9e-08 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 75 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 104 [186][TOP] >UniRef100_O64442 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64442_NICSY Length = 265 Score = 48.5 bits (114), Expect(2) = 9e-08 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLT EFP Sbjct: 49 WYGPDRVKYLGPFS-GESPSYLTSEFP 74 Score = 31.2 bits (69), Expect(2) = 9e-08 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 74 PGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104 [187][TOP] >UniRef100_P04781 Chlorophyll a-b binding protein 22R, chloroplastic n=1 Tax=Petunia sp. RepID=CB23_PETSP Length = 267 Score = 50.4 bits (119), Expect(2) = 1e-07 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 51 WYGPDRVKYLGPFS-GEAPSYLTGEFP 76 Score = 28.9 bits (63), Expect(2) = 1e-07 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 P DYGWDTA P A R +IH RW Sbjct: 76 PSDYGWDTAGLSADPETF--AKNRELEVIHCRW 106 [188][TOP] >UniRef100_A9S6F4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9S6F4_PHYPA Length = 267 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEF 197 WYG DRPKFLGPFS G+TP+YL GEF Sbjct: 51 WYGADRPKFLGPFS-GETPSYLNGEF 75 Score = 30.0 bits (66), Expect(2) = 1e-07 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 77 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 106 [189][TOP] >UniRef100_A9RBQ3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RBQ3_PHYPA Length = 267 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEF 197 WYG DRPKFLGPFS G+TP+YL GEF Sbjct: 51 WYGADRPKFLGPFS-GETPSYLNGEF 75 Score = 30.0 bits (66), Expect(2) = 1e-07 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 77 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 106 [190][TOP] >UniRef100_A9TL35 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TL35_PHYPA Length = 263 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEF 197 WYG DRPKFLGPFS G+TP+YL GEF Sbjct: 47 WYGADRPKFLGPFS-GETPSYLNGEF 71 Score = 30.0 bits (66), Expect(2) = 1e-07 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 73 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 102 [191][TOP] >UniRef100_B5A4I6 Light harvesting complex protein LHCII-3 n=1 Tax=Gymnochlora stellata RepID=B5A4I6_GYMST Length = 300 Score = 50.1 bits (118), Expect(2) = 1e-07 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +3 Query: 114 IEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 +EWYG +RPK+LGPF + TPAYLTGEFP Sbjct: 87 VEWYGENRPKYLGPF-QSYTPAYLTGEFP 114 Score = 28.9 bits (63), Expect(2) = 1e-07 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWD+A P R +IHARW Sbjct: 114 PGDYGWDSAGLSADPLTFKGY--RETEVIHARW 144 [192][TOP] >UniRef100_Q765P5 Light-harvesting chlorophyll a/b-binding protein 2 n=1 Tax=Physcomitrella patens subsp. patens RepID=Q765P5_PHYPA Length = 267 Score = 48.9 bits (115), Expect(2) = 2e-07 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 8/49 (16%) Frame = +3 Query: 75 VSGRSARVVPRAAIE--------WYGPDRPKFLGPFSEGDTPAYLTGEF 197 V ARV R + WYG DRPK+LGPFS G+TP+YL GEF Sbjct: 28 VGSSQARVTMRRTVNKSAGSDSIWYGADRPKYLGPFS-GETPSYLNGEF 75 Score = 30.0 bits (66), Expect(2) = 2e-07 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 77 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 106 [193][TOP] >UniRef100_A9S6S7 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9S6S7_PHYPA Length = 263 Score = 48.9 bits (115), Expect(2) = 2e-07 Identities = 26/45 (57%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = +3 Query: 75 VSGRSARVVPRAAIE----WYGPDRPKFLGPFSEGDTPAYLTGEF 197 V ARV R A WYG DRPK+LGP S G+TP+YLTGEF Sbjct: 28 VGNVQARVTMRKASSSDSIWYGADRPKYLGPLS-GETPSYLTGEF 71 Score = 30.0 bits (66), Expect(2) = 2e-07 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 73 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 102 [194][TOP] >UniRef100_O22542 Chlorophyll a-b binding protein n=1 Tax=Oryza sativa RepID=O22542_ORYSA Length = 304 Score = 45.4 bits (106), Expect(2) = 2e-07 Identities = 22/46 (47%), Positives = 28/46 (60%) Frame = +3 Query: 63 VRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 VR + + R+ + WYGPDR +LGPFS TP+YL GEFP Sbjct: 30 VRDIAAAATGRITMSKEL-WYGPDRVNYLGPFS-AQTPSYLRGEFP 73 Score = 33.1 bits (74), Expect(2) = 2e-07 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A RA +IH RW Sbjct: 73 PGDYGWDTAGLSADPEAF--ARNRALEVIHGRW 103 [195][TOP] >UniRef100_C0PQD7 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=C0PQD7_PICSI Length = 278 Score = 47.4 bits (111), Expect(2) = 2e-07 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR +LGPFS G+ P+YLTGEFP Sbjct: 62 WYGPDRVLYLGPFS-GEQPSYLTGEFP 87 Score = 31.2 bits (69), Expect(2) = 2e-07 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH RW Sbjct: 87 PGDYGWDTAGLSADPETF--AKNRELEVIHGRW 117 [196][TOP] >UniRef100_P04159 Chlorophyll a-b binding protein AB96 (Fragment) n=1 Tax=Pisum sativum RepID=CB21_PEA Length = 228 Score = 47.0 bits (110), Expect(2) = 2e-07 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = +3 Query: 87 SARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 + + V ++ W+GPD K+LGPFS G++P+YLTGEFP Sbjct: 1 TTKKVASSSSPWHGPDGVKYLGPFS-GESPSYLTGEFP 37 Score = 31.6 bits (70), Expect(2) = 2e-07 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A R +IH+RW Sbjct: 37 PGDYGWDTAGLSADPETF--AKNRELEVIHSRW 67 [197][TOP] >UniRef100_A9RJS3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RJS3_PHYPA Length = 267 Score = 48.1 bits (113), Expect(2) = 3e-07 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEF 197 WYG DRPK+LGPFS G+TP+YL GEF Sbjct: 51 WYGADRPKYLGPFS-GETPSYLNGEF 75 Score = 30.0 bits (66), Expect(2) = 3e-07 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 77 GDYGWDTAGLSSDPETF--ARNRELEVIHARW 106 [198][TOP] >UniRef100_B7SAW4 Chloroplast chlorophyll a/b binding protein cab-BO3-1 n=1 Tax=Bambusa oldhamii RepID=B7SAW4_BAMOL Length = 267 Score = 47.8 bits (112), Expect(2) = 3e-07 Identities = 24/52 (46%), Positives = 33/52 (63%) Frame = +3 Query: 42 KSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 197 ++A S +R + + R+ + WYGPDR K+LGPFS TP+YLTGEF Sbjct: 24 RTANASPLRDVAAAANGRITMSNDL-WYGPDRVKYLGPFS-AQTPSYLTGEF 73 Score = 30.4 bits (67), Expect(2) = 3e-07 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A RA +IH RW Sbjct: 75 GDYGWDTAGLSADPEAF--ARNRALEVIHGRW 104 [199][TOP] >UniRef100_B1PL28 Chloroplast chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera grandiflora RepID=B1PL28_9MYRT Length = 109 Score = 50.8 bits (120), Expect(2) = 3e-07 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 55 WYGPDRVKYLGPFS-GESPSYLTGEFP 80 Score = 27.3 bits (59), Expect(2) = 3e-07 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHAR 294 PGDYGWDTA P A R +IH+R Sbjct: 80 PGDYGWDTAGLSADPETF--AKNRELEVIHSR 109 [200][TOP] >UniRef100_Q40185 Light-harvesting chlorophyll a/b protein n=1 Tax=Lemna gibba RepID=Q40185_LEMGI Length = 266 Score = 47.8 bits (112), Expect(2) = 3e-07 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEF 197 WYGPDR K+LGPFS G+ P+YLTGEF Sbjct: 50 WYGPDRVKYLGPFS-GEAPSYLTGEF 74 Score = 30.0 bits (66), Expect(2) = 3e-07 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 GDYGWDTA P A R +IHARW Sbjct: 76 GDYGWDTAGLSADPETF--AKNRELEVIHARW 105 [201][TOP] >UniRef100_B1PL27 Chloroplast chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera elata subsp. hookeri RepID=B1PL27_OENEH Length = 94 Score = 50.8 bits (120), Expect(2) = 3e-07 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G++P+YLTGEFP Sbjct: 55 WYGPDRVKYLGPFS-GESPSYLTGEFP 80 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 199 PGDYGWDTA 225 PGDYGWDTA Sbjct: 80 PGDYGWDTA 88 [202][TOP] >UniRef100_A9RBQ5 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RBQ5_PHYPA Length = 267 Score = 50.4 bits (119), Expect(2) = 4e-07 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 197 R ++R TVS +SAR + WYG DRPKFLGPFS G+TP+YL GEF Sbjct: 34 RVTMRRTVS-KSAR----SDSIWYGADRPKFLGPFS-GETPSYLNGEF 75 Score = 26.9 bits (58), Expect(2) = 4e-07 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +1 Query: 202 GDYGWDTAXSVG*PRXXLQALPRAGXL--IHARW 297 GDYGWDTA L+ R L IHARW Sbjct: 77 GDYGWDTAGL----SSDLETFARNRELEVIHARW 106 [203][TOP] >UniRef100_B1PL36 Chloroplast photosystem II type I chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera grandiflora RepID=B1PL36_9MYRT Length = 103 Score = 50.4 bits (119), Expect(2) = 4e-07 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 50 WYGPDRVKYLGPFS-GEAPSYLTGEFP 75 Score = 26.9 bits (58), Expect(2) = 4e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 199 PGDYGWDTA 225 PGDYGWDTA Sbjct: 75 PGDYGWDTA 83 [204][TOP] >UniRef100_B1PL35 Chloroplast photosystem II type I chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera elata subsp. hookeri RepID=B1PL35_OENEH Length = 103 Score = 50.4 bits (119), Expect(2) = 4e-07 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 50 WYGPDRVKYLGPFS-GEAPSYLTGEFP 75 Score = 26.9 bits (58), Expect(2) = 4e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 199 PGDYGWDTA 225 PGDYGWDTA Sbjct: 75 PGDYGWDTA 83 [205][TOP] >UniRef100_Q9XFU8 Putative uncharacterized protein (Fragment) n=1 Tax=Chlamydomonas sp. HS-5 RepID=Q9XFU8_9CHLO Length = 222 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = +3 Query: 27 MAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 M+A++ VR G + V A+E+YGPDR K+LGPFS+ DTP+YLTGEFP Sbjct: 1 MSAMIAPLVRQGRCLRAQGERSTSVIARAVEFYGPDRAKWLGPFSD-DTPSYLTGEFP 57 [206][TOP] >UniRef100_A8HPF9 Chloroplast light-harvesting complex II protein (Fragment) n=1 Tax=Euglena gracilis RepID=A8HPF9_EUGGR Length = 613 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +3 Query: 78 SGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 +GR + WYGP+R K+LGPFSEG TP+YLTGEFP Sbjct: 125 AGRKSTPASDKLAAWYGPNRNKWLGPFSEGSTPSYLTGEFP 165 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +3 Query: 78 SGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 +GR + WYGP+R K+LGPFSEG TP+YLTGEFP Sbjct: 365 AGRKSTPASDKLAAWYGPNRNKWLGPFSEGSTPSYLTGEFP 405 [207][TOP] >UniRef100_A4QPK6 Chloroplast light-harvesting complex II protein Lhcbm3 (Fragment) n=1 Tax=Acetabularia acetabulum RepID=A4QPK6_ACEAT Length = 208 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +3 Query: 66 RPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R V + V +AA EWYGP+R K+LGP+S+G P+YLTGEFP Sbjct: 13 RSAVVNVARNVGAKAADEWYGPNRAKWLGPYSDGAVPSYLTGEFP 57 [208][TOP] >UniRef100_A4QPI3 Chloroplast light-harvesting complex II protein Lhcbm6 (Fragment) n=1 Tax=Euglena gracilis RepID=A4QPI3_EUGGR Length = 825 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +3 Query: 78 SGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 +GR + WYGP+R K+LGPFSEG TP+YLTGEFP Sbjct: 108 AGRKSTPASDKLAAWYGPNRNKWLGPFSEGSTPSYLTGEFP 148 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = +3 Query: 78 SGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 +GR + WYGP+R K+LGPFSE TP+YLTGEFP Sbjct: 348 AGRKSTPASDKLAAWYGPNRNKWLGPFSENSTPSYLTGEFP 388 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = +3 Query: 78 SGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 +GR + WYGP+R K+LGPFSE TP+YLTGEFP Sbjct: 588 AGRKSTPASDKLAAWYGPNRNKWLGPFSENSTPSYLTGEFP 628 [209][TOP] >UniRef100_Q9LE97 Chloroplast light-harvesting complex II protein Lhcbm3 n=1 Tax=Bigelowiella natans RepID=Q9LE97_BIGNA Length = 333 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/62 (46%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = +3 Query: 24 KMAAIMKSAVRSSVR-PTVSGRSA--RVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGE 194 K AI V+S + P ++ + ++ A EWYGPDR +LGPFSEG P+YLTGE Sbjct: 80 KTGAITNKLVKSGMSIPEIAQQVTCQKIGGAACQEWYGPDRALWLGPFSEGSVPSYLTGE 139 Query: 195 FP 200 FP Sbjct: 140 FP 141 [210][TOP] >UniRef100_B0L805 Chloroplast chlorophyll a/b binding protein n=1 Tax=Phyllostachys edulis RepID=B0L805_9POAL Length = 265 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 23/51 (45%), Positives = 30/51 (58%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 197 SA+ R T+ A+ + WYGPDR +LGP S G+ P+YLTGEF Sbjct: 24 SALFGDARMTMRKTGAKPKVASGSPWYGPDRVLYLGPLS-GEPPSYLTGEF 73 Score = 30.0 bits (66), Expect(2) = 2e-06 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +1 Query: 172 PPPT*LASSPGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PP GDYGWDTA P A R +IH+RW Sbjct: 65 PPSYLTGEFAGDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [211][TOP] >UniRef100_Q9LE96 Chloroplast light-harvesting complex II protein Lhcbm7 n=1 Tax=Bigelowiella natans RepID=Q9LE96_BIGNA Length = 346 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 108 AAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A EWYGPDR +LGPFSEG P+YLTGEFP Sbjct: 124 ACQEWYGPDRALWLGPFSEGSVPSYLTGEFP 154 [212][TOP] >UniRef100_A2SY48 Light-harvesting chlorophyll-a/b binding protein LhcbM9 n=1 Tax=Chlamydomonas incerta RepID=A2SY48_CHLIN Length = 254 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/51 (47%), Positives = 35/51 (68%) Frame = +3 Query: 48 AVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 +V ++ + T + A + +E+YGP+R K+LGP+SE TPAYLTGEFP Sbjct: 13 SVVAASKKTAPAKKAAAPKSSGVEFYGPNRAKWLGPYSENATPAYLTGEFP 63 [213][TOP] >UniRef100_Q9LE98 Chloroplast light-harvesting complex II protein Lhcbm2 n=1 Tax=Bigelowiella natans RepID=Q9LE98_BIGNA Length = 345 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/62 (46%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = +3 Query: 24 KMAAIMKSAVRSSVR-PTVSGRSA--RVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGE 194 K AI V+S + P ++ + ++ A EWYGPDR +LGPFSEG P+YLTGE Sbjct: 92 KTGAITNKLVKSGMSIPEIAQQVTCQKIGGAACQEWYGPDRALWLGPFSEGAVPSYLTGE 151 Query: 195 FP 200 FP Sbjct: 152 FP 153 [214][TOP] >UniRef100_Q7XYQ7 Chlorophyll a/b-binding protein II 1 n=1 Tax=Bigelowiella natans RepID=Q7XYQ7_BIGNA Length = 346 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/62 (46%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = +3 Query: 24 KMAAIMKSAVRSSVR-PTVSGRSA--RVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGE 194 K AI V+S + P ++ + ++ A EWYGPDR +LGPFSEG P+YLTGE Sbjct: 93 KTGAITNKLVKSGMSIPEIAQQVTCQKIGGAACQEWYGPDRALWLGPFSEGAVPSYLTGE 152 Query: 195 FP 200 FP Sbjct: 153 FP 154 [215][TOP] >UniRef100_P22686 Chlorophyll a-b binding protein of LHCII type I, chloroplastic n=1 Tax=Chlamydomonas moewusii RepID=CB2_CHLMO Length = 256 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 108 AAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A IEWYGPDR K+LGPFS +TPAYLTGEFP Sbjct: 35 AGIEWYGPDRAKWLGPFST-NTPAYLTGEFP 64 [216][TOP] >UniRef100_A8QJP9 Chloroplast light-harvesting chlorophyll a/b binding protein n=1 Tax=Bambusa oldhamii RepID=A8QJP9_BAMOL Length = 265 Score = 44.7 bits (104), Expect(2) = 3e-06 Identities = 22/54 (40%), Positives = 30/54 (55%) Frame = +3 Query: 36 IMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEF 197 + S + R T+ A+ + WYGPDR +LGP S G+ P+YLTGEF Sbjct: 21 VPSSGLFGEARMTMRKTGAKPKAASGSPWYGPDRVLYLGPLS-GEPPSYLTGEF 73 Score = 30.0 bits (66), Expect(2) = 3e-06 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +1 Query: 172 PPPT*LASSPGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PP GDYGWDTA P A R +IH+RW Sbjct: 65 PPSYLTGEFAGDYGWDTAGLSADPETF--AKNRELEVIHSRW 104 [217][TOP] >UniRef100_Q8S3T9 Chlorophyll a-b binding protein of LHCII n=1 Tax=Chlamydomonas reinhardtii RepID=Q8S3T9_CHLRE Length = 254 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 108 AAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A IE+YGP+R K+LGP+SE TPAYLTGEFP Sbjct: 33 AGIEFYGPNRAKWLGPYSENSTPAYLTGEFP 63 [218][TOP] >UniRef100_Q1EP00 Chlorophyll A-B binding protein (CAB), putative n=1 Tax=Musa acuminata RepID=Q1EP00_MUSAC Length = 264 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDRPK+LGPFSE TP+YLTGEFP Sbjct: 48 WYGPDRPKYLGPFSE-QTPSYLTGEFP 73 [219][TOP] >UniRef100_B5A4I4 Light harvesting complex protein LHCII-1 n=1 Tax=Gymnochlora stellata RepID=B5A4I4_GYMST Length = 335 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 108 AAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A EWYGPDR +LGPFSEG P+YLTGEFP Sbjct: 108 ACQEWYGPDRALWLGPFSEGAVPSYLTGEFP 138 [220][TOP] >UniRef100_Q9XQB3 LHCII type I chlorophyll a/b binding protein n=1 Tax=Vigna radiata var. radiata RepID=Q9XQB3_PHAAU Length = 263 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/59 (49%), Positives = 38/59 (64%) Frame = +3 Query: 24 KMAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 K+A R+S+R TV+ + + P WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 20 KLAPSAPEVGRASMRKTVTKQVSSGSP-----WYGPDRVKYLGPFS-GEPPSYLTGEFP 72 [221][TOP] >UniRef100_Q93WL4 Light-harvesting chlorophyll-a/b binding protein LhcII-1.3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q93WL4_CHLRE Length = 257 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/56 (46%), Positives = 36/56 (64%) Frame = +3 Query: 33 AIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A+ SA + + T + + + IE+YGP+R K+LGP+SE TPAYLTGEFP Sbjct: 11 ALQVSAKATGKKGTGKTAAKQAPASSGIEFYGPNRAKWLGPYSENATPAYLTGEFP 66 [222][TOP] >UniRef100_Q39340 LHC II Type III chlorophyll a/b binding protein n=1 Tax=Brassica napus RepID=Q39340_BRANA Length = 267 Score = 45.8 bits (107), Expect(2) = 4e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 WYGPDR K+LGPFS TP+Y TGEFP Sbjct: 47 WYGPDRVKYLGPFSV-QTPSYPTGEFP 72 Score = 28.1 bits (61), Expect(2) = 4e-06 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDTA P A A +I+ RW Sbjct: 72 PGDYGWDTAGLSADPEKAF-AKNIALEVIYGRW 103 [223][TOP] >UniRef100_Q9XFU7 Putative uncharacterized protein (Fragment) n=1 Tax=Chlamydomonas sp. HS-5 RepID=Q9XFU7_9CHLO Length = 155 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 108 AAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A EWYGPDRPK+LGPF + +TP+YLTGEFP Sbjct: 58 AGAEWYGPDRPKWLGPFFQ-NTPSYLTGEFP 87 [224][TOP] >UniRef100_A2SY21 Chloroplast light-harvesting complex II protein Lhcbm2 n=1 Tax=Mesostigma viride RepID=A2SY21_MESVI Length = 267 Score = 42.4 bits (98), Expect(2) = 6e-06 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Frame = +3 Query: 30 AAIMKSAVRSSVRPTVSGRSARVVPRAAIE--WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 AA++ A ++ + + AR A + +YGPDR FLGPF+ D P+YLTGE+P Sbjct: 13 AAVVAPAQKAEAKKINTVVEARRTKSATPDSPFYGPDRVTFLGPFT--DVPSYLTGEYP 69 Score = 31.2 bits (69), Expect(2) = 6e-06 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDT P A R L+HARW Sbjct: 69 PGDYGWDTVGLSADPETF--AAYREIELMHARW 99 [225][TOP] >UniRef100_Q9ZSJ5 Light harvesting complex II protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q9ZSJ5_CHLRE Length = 254 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 6/55 (10%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAA------IEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R +++ T + +AA +E+YGP+R K+LGP+SE TPAYLTGEFP Sbjct: 9 RKALQVTCKATGKKTAAKAAAPKSSGVEFYGPNRAKWLGPYSENSTPAYLTGEFP 63 [226][TOP] >UniRef100_Q1WLW0 Chloroplast light-harvesting chlorophyll-a/b binding protein n=1 Tax=Chlamydomonas incerta RepID=Q1WLW0_CHLIN Length = 257 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/56 (46%), Positives = 35/56 (62%) Frame = +3 Query: 33 AIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A+ SA + + T + + IE+YGP+R K+LGP+SE TPAYLTGEFP Sbjct: 11 ALQVSAKATGKKGTGKTAAKSAPASSGIEFYGPNRAKWLGPYSENATPAYLTGEFP 66 [227][TOP] >UniRef100_Q1EP45 Chlorophyll A-B binding protein (CAB), putative n=1 Tax=Musa balbisiana RepID=Q1EP45_MUSBA Length = 267 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/54 (53%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = +3 Query: 45 SAVRSSVRPTVSGRSARVVPRAAI--EWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 S V R T+ +A+ P AA WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 24 SDVLGEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFS-GEPPSYLTGEFP 76 [228][TOP] >UniRef100_O80388 Light-harvesting chlorophyll a/b-binding protein of photosystem II n=1 Tax=Cryptomeria japonica RepID=O80388_CRYJA Length = 266 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +3 Query: 84 RSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R A P ++ WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 38 RGATKAPVSSSPWYGPDRVKYLGPFS-GEPPSYLTGEFP 75 [229][TOP] >UniRef100_A8J287 Chloropyll a-b binding protein of LHCII type I, chloroplast n=1 Tax=Chlamydomonas reinhardtii RepID=A8J287_CHLRE Length = 253 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 6/57 (10%) Frame = +3 Query: 48 AVRSSVRPTVSGRSARVVPRAA------IEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A R +++ T + +AA +E+YGP+R K+LGP+SE TPAYLTGEFP Sbjct: 6 ASRKALQVTCKATGKKTAAKAAAPKSSGVEFYGPNRAKWLGPYSENATPAYLTGEFP 62 [230][TOP] >UniRef100_A8J270 Chlorophyll a-b binding protein of LHCII n=1 Tax=Chlamydomonas reinhardtii RepID=A8J270_CHLRE Length = 254 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 6/55 (10%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAA------IEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R +++ T + +AA +E+YGP+R K+LGP+SE TPAYLTGEFP Sbjct: 9 RKALQVTCKATGKKTAAKAAAPKSSGVEFYGPNRAKWLGPYSENSTPAYLTGEFP 63 [231][TOP] >UniRef100_A8J264 Chloropyll a-b binding protein of LHCII n=1 Tax=Chlamydomonas reinhardtii RepID=A8J264_CHLRE Length = 254 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 6/55 (10%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAA------IEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R +++ T + +AA +E+YGP+R K+LGP+SE TPAYLTGEFP Sbjct: 9 RKALQVTCKATGKKTAAKAAAPKSSGVEFYGPNRAKWLGPYSENSTPAYLTGEFP 63 [232][TOP] >UniRef100_P14273 Chlorophyll a-b binding protein of LHCII type I, chloroplastic n=2 Tax=Chlamydomonas reinhardtii RepID=CB2_CHLRE Length = 253 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 6/57 (10%) Frame = +3 Query: 48 AVRSSVRPTVSGRSARVVPRAA------IEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 A R +++ T + +AA +E+YGP+R K+LGP+SE TPAYLTGEFP Sbjct: 6 ASRKALQVTCKATGKKTAAKAAAPKSSGVEFYGPNRAKWLGPYSENATPAYLTGEFP 62 [233][TOP] >UniRef100_A2SY19 Chloroplast light-harvesting complex II protein Lhcbm1 n=1 Tax=Mesostigma viride RepID=A2SY19_MESVI Length = 267 Score = 42.0 bits (97), Expect(2) = 7e-06 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = +3 Query: 120 WYGPDRPKFLGPFSEGDTPAYLTGEFP 200 +YGPDR FLGPF+ D P+YLTGE+P Sbjct: 45 FYGPDRVTFLGPFT--DVPSYLTGEYP 69 Score = 31.2 bits (69), Expect(2) = 7e-06 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 199 PGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PGDYGWDT P A R L+HARW Sbjct: 69 PGDYGWDTVGLSADPETF--AAYREIELMHARW 99 [234][TOP] >UniRef100_Q39831 Chlorophyll a/b-binding protein n=1 Tax=Glycine max RepID=Q39831_SOYBN Length = 263 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R S+R TV+ +++ P WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 30 RVSMRKTVTKQASSGSP-----WYGPDRVKYLGPFS-GEPPSYLTGEFP 72 [235][TOP] >UniRef100_C6TLM4 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TLM4_SOYBN Length = 263 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +3 Query: 54 RSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 R S+R TV+ +++ P WYGPDR K+LGPFS G+ P+YLTGEFP Sbjct: 30 RVSMRKTVTKQASSGSP-----WYGPDRVKYLGPFS-GEPPSYLTGEFP 72 [236][TOP] >UniRef100_A2SY47 Light-harvesting chlorophyll-a/b binding protein LhcbM8 (Fragment) n=1 Tax=Chlamydomonas incerta RepID=A2SY47_CHLIN Length = 245 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +3 Query: 108 AAIEWYGPDRPKFLGPFSEGDTPAYLTGEFP 200 + +E+YGP+R K+LGP+SE TPAYLTGEFP Sbjct: 24 SGVEFYGPNRAKWLGPYSENSTPAYLTGEFP 54 [237][TOP] >UniRef100_O24226 Chlorophyll a/b binding protein n=1 Tax=Oryza sativa RepID=O24226_ORYSA Length = 265 Score = 43.1 bits (100), Expect(2) = 1e-05 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +3 Query: 33 AIMKSAVRSSVRPTVSGRSARVVPRAAI--EWYGPDRPKFLGPFSEGDTPAYLTGEF 197 A+ + V R T+ +A+ P AA WYG DR +LGP S G+ P+YLTGEF Sbjct: 18 AVANAKVFGEGRVTMRKSAAKPKPAAASGSPWYGADRVLYLGPLS-GEPPSYLTGEF 73 Score = 29.6 bits (65), Expect(2) = 1e-05 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 172 PPPT*LASSPGDYGWDTAXSVG*PRXXLQALPRAGXLIHARW 297 PP GDYGWDTA P A R +IH RW Sbjct: 65 PPSYLTGEFSGDYGWDTAGLSADPETF--AKNRELEVIHCRW 104