[UP]
[1][TOP] >UniRef100_A8IE32 75 kDa chloroplast membrane translocon n=1 Tax=Chlamydomonas reinhardtii RepID=A8IE32_CHLRE Length = 798 Score = 268 bits (686), Expect = 1e-70 Identities = 133/133 (100%), Positives = 133/133 (100%) Frame = +2 Query: 116 MQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSA 295 MQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSA Sbjct: 1 MQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSA 60 Query: 296 LGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLPLPLYE 475 LGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLPLPLYE Sbjct: 61 LGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLPLPLYE 120 Query: 476 LAEESSDEKEKQQ 514 LAEESSDEKEKQQ Sbjct: 121 LAEESSDEKEKQQ 133 [2][TOP] >UniRef100_C5KAA2 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAA2_9ALVE Length = 2139 Score = 64.3 bits (155), Expect = 5e-09 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -2 Query: 450 PSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSL 301 P+ P P PPPPPPPPPPP PP PP P +G +T +ADD P P L Sbjct: 1755 PATSPPPVSPPPPPPPPPPPPPPPPPPQEPPVGETTPCGQADDTPARPKL 1804 [3][TOP] >UniRef100_A8P236 Ground-like domain containing protein n=1 Tax=Brugia malayi RepID=A8P236_BRUMA Length = 205 Score = 63.9 bits (154), Expect = 6e-09 Identities = 36/91 (39%), Positives = 45/91 (49%), Gaps = 1/91 (1%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA 328 F ++++S S PP+ C PP PPPPPPPPPP PP PP PP Sbjct: 13 FYITTIESFVSGHGCGQGPPAPCGAPPPPPPPPPPPPP---PPPPPQPPCSCPQLCLPCP 69 Query: 327 DDNPNLPSLPSAEGWFTLTP-LPLLEHSCCS 238 P LP LPS P +P+L +SCC+ Sbjct: 70 PPLPPLPPLPSLPCPCLPCPCMPMLLNSCCN 100 [4][TOP] >UniRef100_B9F794 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9F794_ORYSJ Length = 249 Score = 63.2 bits (152), Expect = 1e-08 Identities = 47/134 (35%), Positives = 60/134 (44%), Gaps = 3/134 (2%) Frame = +2 Query: 110 LIMQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQP 289 L L A P R GR + A +H SQP H +Q +S S S ++ Sbjct: 8 LFFSPLAAGPSRRVR-GRGRSTSVSAAASASSHNSQPHG--HPQQPLAVASSSSKSESKG 64 Query: 290 SALGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGG---GGGGSGGQGQPDGGLP 460 S L ++A AF+L + GGFGG G GGGGGG GGGG GG G GG Sbjct: 65 SKTFALASAITAAASGAFLLASSGGGFGGGAGGPLGGGGGGWGAGGGGGGGGGGGGGGFW 124 Query: 461 LPLYELAEESSDEK 502 ++ +DEK Sbjct: 125 SRIFSGGAAHADEK 138 [5][TOP] >UniRef100_Q84Q83 Protein TOC75, chloroplastic n=2 Tax=Oryza sativa Japonica Group RepID=TOC75_ORYSJ Length = 817 Score = 63.2 bits (152), Expect = 1e-08 Identities = 47/134 (35%), Positives = 60/134 (44%), Gaps = 3/134 (2%) Frame = +2 Query: 110 LIMQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQP 289 L L A P R GR + A +H SQP H +Q +S S S ++ Sbjct: 8 LFFSPLAAGPSRRVR-GRGRSTSVSAAASASSHNSQPHG--HPQQPLAVASSSSKSESKG 64 Query: 290 SALGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGG---GGGGSGGQGQPDGGLP 460 S L ++A AF+L + GGFGG G GGGGGG GGGG GG G GG Sbjct: 65 SKTFALASAITAAASGAFLLASSGGGFGGGAGGPLGGGGGGWGAGGGGGGGGGGGGGGFW 124 Query: 461 LPLYELAEESSDEK 502 ++ +DEK Sbjct: 125 SRIFSGGAAHADEK 138 [6][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/67 (46%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL--PSLPSAE 289 S +PP P PP PPPPPPPPPPP PP PP PP +P L PS+PS Sbjct: 214 SPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSPP 273 Query: 288 GWFTLTP 268 F P Sbjct: 274 FAFGFRP 280 [7][TOP] >UniRef100_A8J0N1 Chloroplast lumenal protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J0N1_CHLRE Length = 404 Score = 61.6 bits (148), Expect = 3e-08 Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 1/130 (0%) Frame = +2 Query: 116 MQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSA 295 + G ++ G++A++ P +R + A Q + SN +E+ E S+ G + + S Sbjct: 9 LSGFRSALGVQAAAPVPRFAVSRRVAITYA---QLAPSNSSERDE-SADGKSAAGSVQSP 64 Query: 296 LGRLGKFGLSSALSAFVLVPNFGGFGGN-GGNRGGGGGGGGGGGSGGQGQPDGGLPLPLY 472 LG + L A GG GG+ GG+ GGGGGGGGGGG G G D L L Sbjct: 65 LGTVSPVPLVPARDVRAEAATGGGDGGSTGGSSGGGGGGGGGGGGEGAGNSDDDRILTLS 124 Query: 473 ELAEESSDEK 502 E+ ++++K Sbjct: 125 EVEAFAAEKK 134 [8][TOP] >UniRef100_UPI000060414B formin-like domain containing protein MAN n=1 Tax=Mus musculus RepID=UPI000060414B Length = 1083 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 10/55 (18%) Frame = -2 Query: 495 SLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRL----------PPLPPNPP 361 S D+S ++ +G+ +PP P PP PPPPPPPPPPP L PPLPP PP Sbjct: 536 SSDTSEAAQNGTASPPMSPPPPPPPPPPPPPPPPPPLPGPAAETSPAPPLPPPPP 590 [9][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 60.8 bits (146), Expect = 5e-08 Identities = 33/78 (42%), Positives = 38/78 (48%), Gaps = 6/78 (7%) Frame = -2 Query: 501 FSSLDSSASS*SGSGNP------PSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 340 F+ LD+ S +G GN P+G PP PPPPPPPPPPP PP PP PP Sbjct: 1381 FAFLDAMVSYTAGDGNDVGLTLTPTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPT 1440 Query: 339 ADRADDNPNLPSLPSAEG 286 A P P P + G Sbjct: 1441 PPPAPPPPPPPPPPISSG 1458 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/37 (59%), Positives = 24/37 (64%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTST 343 PP P PP PPPPPPP PPP PP PP PP + + T Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGT 1459 [10][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 60.8 bits (146), Expect = 5e-08 Identities = 30/50 (60%), Positives = 31/50 (62%) Frame = -2 Query: 510 CFSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 C SFSS +S S PPS P PP PPPPPPPPPPP PP PP PP Sbjct: 359 CKSFSSYPIDCASFGCS--PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP + P PP PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 [11][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = -2 Query: 483 SASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 SASS S +P P PP+PPPPPPPPPPP PP PP+PP Sbjct: 227 SASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPP 267 Score = 60.1 bits (144), Expect = 9e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PP P PP PPPPPPPPPPP LPPLPP P K Sbjct: 259 PPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAK 290 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/48 (58%), Positives = 28/48 (58%) Frame = -2 Query: 504 SFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S SS SS S PP P PP PPPPPPPPPPP PP PP PP Sbjct: 227 SASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPP 274 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP P LPP PP Sbjct: 256 PPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPP PPP PP PP PP L Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPL 280 [12][TOP] >UniRef100_A2APV2-3 Isoform 3 of Formin-like protein 2 n=1 Tax=Mus musculus RepID=A2APV2-3 Length = 1091 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 10/55 (18%) Frame = -2 Query: 495 SLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRL----------PPLPPNPP 361 S D+S ++ +G+ +PP P PP PPPPPPPPPPP L PPLPP PP Sbjct: 536 SSDTSEAAQNGTASPPMSPPPPPPPPPPPPPPPPPPLPGPAAETSPAPPLPPPPP 590 [13][TOP] >UniRef100_A2APV2 Formin-like protein 2 n=1 Tax=Mus musculus RepID=FMNL2_MOUSE Length = 1086 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 10/55 (18%) Frame = -2 Query: 495 SLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRL----------PPLPPNPP 361 S D+S ++ +G+ +PP P PP PPPPPPPPPPP L PPLPP PP Sbjct: 536 SSDTSEAAQNGTASPPMSPPPPPPPPPPPPPPPPPPLPGPAAETSPAPPLPPPPP 590 [14][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 60.5 bits (145), Expect = 7e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PPS PC P PPPPPPPPPPP PP PP PP Sbjct: 348 PPSANPCQPCPPPPPPPPPPPPPPPPPPPPP 378 Score = 60.5 bits (145), Expect = 7e-08 Identities = 36/77 (46%), Positives = 38/77 (49%), Gaps = 6/77 (7%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK------LGTSTKADRADDNPNLPSLPSA 292 PPS P PP PPPPPPPPPPP PP PP PP TS + LP+L Sbjct: 377 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTSCGFGCHYRDRLLPTLTYP 436 Query: 291 EGWFTLTPLPLLEHSCC 241 TL LP E SCC Sbjct: 437 CDTCTLICLPGCEQSCC 453 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S NP CP PP PPPPPPPPPPP PP PP+PP Sbjct: 350 SANPCQPCPPPPPPPPPPPPPPPP--PPPPPSPP 381 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 388 [15][TOP] >UniRef100_Q4SHS7 Chromosome 5 SCAF14581, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SHS7_TETNG Length = 789 Score = 60.5 bits (145), Expect = 7e-08 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S PP+ CPP+PPPPPPPPPPP PP+PP P Sbjct: 633 SAPPPATATCPPVPPPPPPPPPPPPPPPMPPTVP 666 [16][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 60.1 bits (144), Expect = 9e-08 Identities = 33/80 (41%), Positives = 39/80 (48%), Gaps = 3/80 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA---DDNPNLPSLPSAEGW 283 PP P PP PPPPPPPPPPP PP PP PP G A P P+LP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPPALPCFHEG 989 Query: 282 FTLTPLPLLEHSCCSAWLLL 223 P ++E + C++ LL Sbjct: 990 QEYPPNTIIEEASCTSSGLL 1009 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/52 (50%), Positives = 27/52 (51%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PP P PP PPPPPPPPPPP PP PP PP P P+LP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALP 973 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 450 PSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 P+ P PP PPPPPPPPPPP PP PP PP Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPPP 880 [17][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP PCPP PPPPPPPPPPP PP PP PP Sbjct: 61 PPPPRPCPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP CP PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPPR P PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 PP P PP PPPPPPPPPPP PP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 PP P PP PPPPPPPPPPP PP PP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 104 [18][TOP] >UniRef100_A4Z338 Putative Peptidase, Caspase-like domain and TPR repeats n=1 Tax=Bradyrhizobium sp. ORS278 RepID=A4Z338_BRASO Length = 529 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/56 (50%), Positives = 33/56 (58%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 295 S +P P PPLPPPPPP PPPP PP PP+PP KA+ P +P +PS Sbjct: 299 SPSPTLQPPAPPLPPPPPPSPPPPAPPPSPPSPP------KAELVPPLPPVPPVPS 348 [19][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP CP PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [20][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP CP PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [21][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 60.1 bits (144), Expect = 9e-08 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTS 346 PP P PP PPPPPPPPPPP PP PP PP+L TS Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTS 103 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [22][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 60.1 bits (144), Expect = 9e-08 Identities = 27/53 (50%), Positives = 28/53 (52%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 295 PPS P PP PPPPPPPPPPP PP PP PP + P P PS Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPS 307 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/53 (49%), Positives = 28/53 (52%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 295 PP P PP PPPP PPPPPP PP PP PP S +P +P PS Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPS 315 Score = 56.6 bits (135), Expect = 9e-07 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PP P PP PPPPPP PPPP PP PP PP S R +P+ P P Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPP 312 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +PP P PP PPPPPPPPPPP PP PP PP Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPP-PPSPPPPP 282 [23][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP PCPP PPPPPPPPPPP PP PP PP Sbjct: 255 PPCPPPCPPPPPPPPPPPPPPPPPPPPPCPP 285 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/51 (50%), Positives = 27/51 (52%) Frame = -2 Query: 513 CCFSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 CC S + A PP PCPP PPPPPPPPPP PP PP PP Sbjct: 231 CCPSAAPCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPP 281 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP PCPP PPPPPPPPPPP PP PP PP Sbjct: 298 PPPPPPCPP-PPPPPPPPPPPCPPPPPPPPP 327 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPCPPPCPPPPP 292 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP CP PP PPPP PPPPPP PP PP PP Sbjct: 290 PPPPCPPPPPPPPPCPPPPPPPPPPPPPCPP 320 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP CP PP PPPPPPPP PP PP PP PP Sbjct: 300 PPPPCPPPPPPPPPPPPPCPPPPPPPPPCPP 330 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = -2 Query: 453 PPSGCPCPPLPPP--PPPPPPPPRLPPLPPNPP 361 PP PCPP PPP PPPPPPPP PP PP PP Sbjct: 281 PPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPP 313 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 295 PPPPPPPPPCPPPPPPPPPPP--PPCPPPPP 323 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPP-PPPPPRLPPLPPNPP 361 PP CP PP PPPPPP PPPPP PP PP PP Sbjct: 279 PPPPCP-PPCPPPPPPCPPPPPPPPPCPPPPP 309 [24][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/61 (47%), Positives = 33/61 (54%), Gaps = 8/61 (13%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKA--------DRADDNPNLPSLP 298 PP P PP PPPPPPPPPPP PP PP PPK +T A D A P+ + P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAFPPAPLRRDTASTGPSQETYP 73 Query: 297 S 295 + Sbjct: 74 A 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 [25][TOP] >UniRef100_UPI0000E1F761 PREDICTED: formin-like 2 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E1F761 Length = 1087 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/52 (53%), Positives = 31/52 (59%) Frame = -2 Query: 447 SGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 +G PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 595 Score = 55.8 bits (133), Expect = 2e-06 Identities = 30/66 (45%), Positives = 34/66 (51%) Frame = -2 Query: 495 SLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 316 S D+ + +G PP P PP PPPPPPPPPPP PPLP P T A P Sbjct: 536 SSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLP 593 Query: 315 NLPSLP 298 + P LP Sbjct: 594 SAPPLP 599 [26][TOP] >UniRef100_UPI0000E1F760 PREDICTED: formin-like 2 isoform 8 n=1 Tax=Pan troglodytes RepID=UPI0000E1F760 Length = 1093 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/52 (53%), Positives = 31/52 (59%) Frame = -2 Query: 447 SGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 +G PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 595 Score = 55.8 bits (133), Expect = 2e-06 Identities = 30/66 (45%), Positives = 34/66 (51%) Frame = -2 Query: 495 SLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 316 S D+ + +G PP P PP PPPPPPPPPPP PPLP P T A P Sbjct: 536 SSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLP 593 Query: 315 NLPSLP 298 + P LP Sbjct: 594 SAPPLP 599 [27][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP LPP PP PP L Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPL 282 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PPLPP PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 56.6 bits (135), Expect = 9e-07 Identities = 30/65 (46%), Positives = 31/65 (47%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 274 PP P PP PPPPPPPPPPP PP PP PP P LP P + Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPS------ 288 Query: 273 TPLPL 259 PLPL Sbjct: 289 LPLPL 293 Score = 56.6 bits (135), Expect = 9e-07 Identities = 27/53 (50%), Positives = 28/53 (52%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 295 PP P PP PPPPP PPPPP PPLPP PP L A P S P+ Sbjct: 257 PPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVAPPSTSQPT 309 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 264 [28][TOP] >UniRef100_UPI0001B798A6 UPI0001B798A6 related cluster n=1 Tax=Homo sapiens RepID=UPI0001B798A6 Length = 625 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/52 (53%), Positives = 32/52 (61%) Frame = -2 Query: 447 SGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 +G PP+PPPPPPPPPPP PP PP PP G + A+ P P LPSA Sbjct: 83 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPA--AETVPAPPLAPPLPSA 132 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNP-PKLGTSTKADRADDNPNLPSLP 298 N P P PP PPPPPPPPPPP PP PP P P T A P+ P LP Sbjct: 83 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 136 [29][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PPLPP+PP Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PPLPPPPPPPPPPP PP PP PP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP LPP PP PP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PP P PP PPPPPPPPPPP PP PP PP L S P P P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PP P PPLPP PPPPPPPP PP PP PP P +P+LP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALP 717 Score = 56.6 bits (135), Expect = 9e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +PP P PP PPPPPPPPPPP PP PP PP Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PP P PP PPPPPPPPPPP PP PP PP P LP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PPS P PP PPPP PPPPPP PP PP PP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPP 256 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLP-PLPPNPPKL 355 +PP P PP PPPPPPPPPPP P P PP+PP L Sbjct: 678 SPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPL 712 [30][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTS 346 PP P PP PPPPPPPPPPP PP PP PP LG++ Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSN 55 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 [31][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/46 (56%), Positives = 28/46 (60%) Frame = -2 Query: 498 SSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S +S SS + PS P PP PPPPPPPPPPP PP PP PP Sbjct: 478 SKKNSECSSQDSTRGGPSSTPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = -2 Query: 480 ASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 340 +S S G P S P PP PPPPPPPPPPP PP PP PP + S++ Sbjct: 485 SSQDSTRGGPSSTPPPPPPPPPPPPPPPPPPPPPPPPPPPSVTLSSQ 531 [32][TOP] >UniRef100_Q96PY5-3 Isoform 2 of Formin-like protein 2 n=1 Tax=Homo sapiens RepID=Q96PY5-3 Length = 1092 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/52 (53%), Positives = 32/52 (61%) Frame = -2 Query: 447 SGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 +G PP+PPPPPPPPPPP PP PP PP G + A+ P P LPSA Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPA--AETVPAPPLAPPLPSA 594 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNP-PKLGTSTKADRADDNPNLPSLP 298 N P P PP PPPPPPPPPPP PP PP P P T A P+ P LP Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 598 [33][TOP] >UniRef100_Q96PY5 Formin-like protein 2 n=1 Tax=Homo sapiens RepID=FMNL2_HUMAN Length = 1086 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/52 (53%), Positives = 32/52 (61%) Frame = -2 Query: 447 SGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 +G PP+PPPPPPPPPPP PP PP PP G + A+ P P LPSA Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPA--AETVPAPPLAPPLPSA 594 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNP-PKLGTSTKADRADDNPNLPSLP 298 N P P PP PPPPPPPPPPP PP PP P P T A P+ P LP Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 598 [34][TOP] >UniRef100_UPI0000E1F767 PREDICTED: formin-like 2 isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E1F767 Length = 994 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 451 PPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 496 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 S PP P PP PPPPPPPPPPP PPLP P T A P+ P LP Sbjct: 448 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLPSAPPLP 500 [35][TOP] >UniRef100_UPI0000E1F766 PREDICTED: formin-like 2 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E1F766 Length = 1026 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 547 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 S PP P PP PPPPPPPPPPP PPLP P T A P+ P LP Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLPSAPPLP 551 [36][TOP] >UniRef100_UPI0000E1F765 PREDICTED: formin-like 2 isoform 7 n=1 Tax=Pan troglodytes RepID=UPI0000E1F765 Length = 1045 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 547 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 S PP P PP PPPPPPPPPPP PPLP P T A P+ P LP Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLPSAPPLP 551 [37][TOP] >UniRef100_UPI0000E1F763 PREDICTED: formin-like 2 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E1F763 Length = 1037 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 547 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 S PP P PP PPPPPPPPPPP PPLP P T A P+ P LP Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLPSAPPLP 551 [38][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/111 (32%), Positives = 42/111 (37%) Frame = -2 Query: 465 GSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 286 G+ PP P PP PPPPPPPPPPP PP PP PP + + DR Sbjct: 650 GAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPDVLAADAFDR--------------- 694 Query: 285 WFTLTPLPLLEHSCCSAWLLLEG*DAWARTTSAVRAVRSVGRPLEARRPGV 133 + + W AW SA R S G + PGV Sbjct: 695 ------------TVAAGWGSAPTGGAWTHAGSASRYAASAGAGIHRMGPGV 733 [39][TOP] >UniRef100_C1E983 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E983_9CHLO Length = 1724 Score = 58.9 bits (141), Expect = 2e-07 Identities = 37/108 (34%), Positives = 45/108 (41%), Gaps = 4/108 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPP----PPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 286 PP P PP PPPPPPP PPPP PLPP PP + D P +P P A Sbjct: 1142 PPPPSPPPPSPPPPPPPPPPAPPPPNANPLPPPPPPSPPPSPPPPPPDAPPMPPPPLAPY 1201 Query: 285 WFTLTPLPLLEHSCCSAWLLLEG*DAWARTTSAVRAVRSVGRPLEARR 142 + P E + C A + D + T A +V + R R Sbjct: 1202 ATPVAPADSNECTHCPAGTFSDLQDVLSCTPCAAGSVTATTRSRSCER 1249 [40][TOP] >UniRef100_B8AMH8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AMH8_ORYSI Length = 368 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/70 (48%), Positives = 34/70 (48%), Gaps = 3/70 (4%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPR---LPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 S PP P PP PPPPPPPPPR PP PP PP G T A P P P Sbjct: 179 SPTPPPPLPSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQPTLAP-----PPPPPPPPY 233 Query: 291 EGWFTLTPLP 262 G TL PLP Sbjct: 234 CGHPTLAPLP 243 [41][TOP] >UniRef100_A9RE09 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RE09_PHYPA Length = 705 Score = 58.5 bits (140), Expect = 2e-07 Identities = 46/123 (37%), Positives = 61/123 (49%), Gaps = 12/123 (9%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPL--PPNPPKLGTST--KADRADDNPNLPSLPSAEG 286 P P PP PPPPPPPPPPP LPPL P P ++ TST ++R D + L ++ Sbjct: 505 PAVPSPPPPRPPPPPPPPPPP-LPPLRSPTQPAQIKTSTTSSSERPDSSTQLEAVGP--- 560 Query: 285 WFTLTPLPLLEHSCCS-----AWLLLEG*DAWARTTSAVRA--VRSVGRP-LEARRPGVA 130 + PLP +EH CS WL+ TT A RA + S+ P ++ R+ V Sbjct: 561 --RILPLP-IEHWTCSMSYVACWLM--------TTTDASRAALLASIRNPSIQLRKTNVG 609 Query: 129 FNP 121 P Sbjct: 610 DKP 612 [42][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADD 322 PP P PP PPPPPPPPPPP PP PP PP S +A R D Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVD 74 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -2 Query: 492 LDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 LD+ +S + PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 LDTPVASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/55 (43%), Positives = 28/55 (50%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 289 PP P PP PPPPPPPPPPP PP PP P + D + P P+ + Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVDAVEVAPRSSVWPNGK 89 [43][TOP] >UniRef100_B4HDK5 GL19678 n=1 Tax=Drosophila persimilis RepID=B4HDK5_DROPE Length = 281 Score = 58.5 bits (140), Expect = 2e-07 Identities = 42/121 (34%), Positives = 58/121 (47%), Gaps = 2/121 (1%) Frame = +2 Query: 158 GRPTLRTARTALVVRAHASQPSSSNHAEQQ-ECSSSGSGVSVNQPSALGRLGKFGLSSAL 334 GRPTLR A+ ++ + A Q H E E + ++++ L S Sbjct: 41 GRPTLRRAKRSVHPKLQAVQEL---HVESPAEADTLDIDATLDEAIVLRERRAAEPGSQE 97 Query: 335 SAFVLVPNFGGFGGNGGNRGG-GGGGGGGGGSGGQGQPDGGLPLPLYELAEESSDEKEKQ 511 S+ G G NGGN GG GGGGGGGGGSGG G GG ++L ++ ++ KQ Sbjct: 98 SSVSQQSQEQGVGKNGGNNGGAGGGGGGGGGSGGGGGGGGGNNRRQHQLRKQQQQQRRKQ 157 Query: 512 Q 514 Q Sbjct: 158 Q 158 [44][TOP] >UniRef100_A1TG37 Putative uncharacterized protein n=1 Tax=Mycobacterium vanbaalenii PYR-1 RepID=A1TG37_MYCVP Length = 396 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/55 (50%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPP-RLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 PP+ P PP PPPPPPPPPPP + PP PP P T A + P P LP A Sbjct: 222 PPAPAPPPPPPPPPPPPPPPPAQQPPPPPQP----TPPPAQQPSPEPQFPWLPPA 272 [45][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/60 (46%), Positives = 32/60 (53%), Gaps = 5/60 (8%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPP-----NPPKLGTSTKADRADDNPNLPSLPSA 292 +PP P PP PPPPPPPPPPP PP P PP T T + LPS+P+A Sbjct: 103 SPPPPSPPPPSPPPPPPPPPPPSPPPPSPPPPTTTPPTTTTPTPSMHPIQPTQLPSIPNA 162 [46][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/62 (45%), Positives = 31/62 (50%) Frame = -2 Query: 459 GNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWF 280 G PP P PP PPPPPPPPPPP P PP+PP +P PS P W+ Sbjct: 1201 GQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPP---------PPPSPPPPSPPPPPPWW 1251 Query: 279 TL 274 L Sbjct: 1252 ML 1253 [47][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PPLPPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP CP PP PPPP PPPPPP PP PP PP Sbjct: 17 PPPHCPPPPPPPPPLPPPPPPPPPPPPPPPP 47 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 [48][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/68 (47%), Positives = 34/68 (50%), Gaps = 4/68 (5%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLP----PNPPKLGTSTKADRADDNPNLPSLPSAEG 286 PPS P PP PPPPPPPPPPP PP P P PP G + A + P P PS Sbjct: 420 PPS--PPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYP 477 Query: 285 WFTLTPLP 262 PLP Sbjct: 478 PSPAPPLP 485 [49][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 NPP P PP PPPPPPPPPPP PP PP PP + Sbjct: 42 NPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPI 75 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP PP PP P KL Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPIKL 77 [50][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PPLPP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 102 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP+ P PP PPPPPPPPPPP PP PP PP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 [51][TOP] >UniRef100_A4R6T5 Predicted protein n=1 Tax=Magnaporthe grisea RepID=A4R6T5_MAGGR Length = 166 Score = 58.2 bits (139), Expect = 3e-07 Identities = 48/137 (35%), Positives = 59/137 (43%), Gaps = 14/137 (10%) Frame = +2 Query: 92 ALY*IHLIMQGLKATPGLRASS-------GRPTLRTARTALVVRAHASQPSSSNHAEQQE 250 AL+ + L G+ A P AS G P + A A +Q ++N AE+++ Sbjct: 8 ALFILLLPFYGVMALPIDPASGSLDAVDHGVPAVARDVQAAAATADTAQIETANEAEKRK 67 Query: 251 CSSSGSGVSVNQPSALG-------RLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGG 409 G G G +GK GL S F FGG GG GG GGGGGG Sbjct: 68 KKGGGGGGGGGGGGGGGGGAGGFLEIGKDGLKLGGSGF----GFGGGGGGGGRNGGGGGG 123 Query: 410 GGGGGSGGQGQPDGGLP 460 G GG GG G GGLP Sbjct: 124 GLGGSGGGGG--GGGLP 138 [52][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 340 PPS P PP PPPPPPPPPPP PP PP PP + + + Sbjct: 171 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNAR 208 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 167 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 169 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 199 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 170 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PPS P PP PPPPPPPPPP PP PP PP Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 193 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/56 (46%), Positives = 27/56 (48%) Frame = -2 Query: 465 GSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 G PP CPP PPP PPPPPPP PP P PP S + P PS P Sbjct: 120 GCPPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPP 175 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPP PPP PP PP PP Sbjct: 156 PPPSPPPPPSPPPPPPPSPPPPPPPPPPPPP 186 [53][TOP] >UniRef100_UPI0000F53460 enabled homolog isoform 2 n=2 Tax=Mus musculus RepID=UPI0000F53460 Length = 789 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/59 (49%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPN--PPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP PPLPP PP S +A P P S PS++ Sbjct: 419 PPTSGPAAPPPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 477 [54][TOP] >UniRef100_UPI0000E1203E Os03g0308700 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E1203E Length = 464 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/70 (48%), Positives = 34/70 (48%), Gaps = 3/70 (4%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPR---LPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 S PP P PP PPPPPPPPPR PP PP PP G T A P P P Sbjct: 276 SPTPPPPPPSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQPTLA------PPPPPPPPY 329 Query: 291 EGWFTLTPLP 262 G TL PLP Sbjct: 330 CGHPTLAPLP 339 [55][TOP] >UniRef100_UPI000047625B enabled homolog isoform 3 n=1 Tax=Mus musculus RepID=UPI000047625B Length = 785 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/59 (49%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPN--PPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP PPLPP PP S +A P P S PS++ Sbjct: 415 PPTSGPAAPPPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 473 [56][TOP] >UniRef100_UPI00015DF6E5 enabled homolog (Drosophila) n=1 Tax=Mus musculus RepID=UPI00015DF6E5 Length = 391 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/59 (49%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPN--PPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP PPLPP PP S +A P P S PS++ Sbjct: 22 PPTSGPAAPPPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 80 [57][TOP] >UniRef100_UPI00015DF6E3 enabled homolog (Drosophila) n=1 Tax=Mus musculus RepID=UPI00015DF6E3 Length = 701 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/59 (49%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPN--PPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP PPLPP PP S +A P P S PS++ Sbjct: 331 PPTSGPAAPPPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 389 [58][TOP] >UniRef100_UPI000056479E enabled homolog isoform 1 n=1 Tax=Mus musculus RepID=UPI000056479E Length = 804 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/59 (49%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPN--PPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP PPLPP PP S +A P P S PS++ Sbjct: 434 PPTSGPAAPPPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 492 [59][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PPS P PP PPPPPPPPPPP PP PNPP Sbjct: 240 PPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 Score = 57.0 bits (136), Expect = 7e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP+PP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 53.9 bits (128), Expect = 6e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 PP P PP PPPPPPPPPPP PP PP P Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S +PP P PP PPPPPPP PPP PP PP PP Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 [60][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 57.8 bits (138), Expect = 4e-07 Identities = 32/80 (40%), Positives = 38/80 (47%), Gaps = 11/80 (13%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP--------KLGTSTKADRADDNPNLPSLP 298 PP P PP PPPPPPPPPPP PP PP PP + T + A +P L Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLIEEAQSSPALGGCR 554 Query: 297 SAEGWFTLT---PLPLLEHS 247 ++T P P+ EHS Sbjct: 555 RPVMTVSITSHIPRPIPEHS 574 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +PP P PP PPPPPPPPPPP PP PP PP Sbjct: 487 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 [61][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 P +G PP PPPPPPPPPPP PP PP PP +A P LP P Sbjct: 453 PHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPLDVGEASNLQPPPPLPPPP 504 [62][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 57.4 bits (137), Expect = 6e-07 Identities = 30/52 (57%), Positives = 33/52 (63%), Gaps = 2/52 (3%) Frame = -2 Query: 510 CFSFSSLDS-SASS*SGSGNPPSGCPCPP-LPPPPPPPPPPPRLPPLPPNPP 361 C+ +S +S SS GS PP P PP LPPPPP PPPPP PPLPP PP Sbjct: 58 CWKPASTESWQCSSTLGSVPPPPPLPPPPPLPPPPPLPPPPPPPPPLPPPPP 109 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PPLPPPPPPPPP P PPLPP PP Sbjct: 85 PPPLPPPPPLPPPPPPPPPLPPPPPLPPPPP 115 [63][TOP] >UniRef100_Q9Q5L3 EBNA-2 n=1 Tax=Macacine herpesvirus 4 RepID=Q9Q5L3_9GAMA Length = 605 Score = 57.4 bits (137), Expect = 6e-07 Identities = 31/62 (50%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Frame = -2 Query: 459 GNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK---LGTSTKADRADDNPNLPSLPSAE 289 G PP P PPLPPPPPPP PPP PP+ P PP+ +GT + D D NP SA Sbjct: 63 GAPPPPPPPPPLPPPPPPPLPPPPPPPVQPPPPERRDVGTQ-EPDPRDRNPLGGPGGSAV 121 Query: 288 GW 283 W Sbjct: 122 SW 123 [64][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/46 (56%), Positives = 27/46 (58%) Frame = -2 Query: 450 PSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPN 313 P P PP PPPPPPPPPPP PP PP PP + TS K A N Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVETSPKIVLAGTTAN 513 [65][TOP] >UniRef100_C4DHS6 Predicted RNA-binding protein containing a PIN domain n=1 Tax=Stackebrandtia nassauensis DSM 44728 RepID=C4DHS6_9ACTO Length = 494 Score = 57.4 bits (137), Expect = 6e-07 Identities = 30/63 (47%), Positives = 31/63 (49%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 274 PP G P PP PP PP PPP P PP PP PP+ T DD P LP W L Sbjct: 21 PPPGPPVPPDPPGPPEPPPGPLPPPPPPGPPE---PTDPPSVDDEPELPEAV----WQKL 73 Query: 273 TPL 265 PL Sbjct: 74 LPL 76 [66][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 468 SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S S PP P PP PPPPPPPPPPP PP PP PP Sbjct: 84 SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPP 119 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PPS P PP PPP PPPPPPP PP PP+PP Sbjct: 82 PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPP 112 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/52 (48%), Positives = 28/52 (53%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PP P PP PPPPPPPPPPP PP PP PP + + P+ P P Sbjct: 118 PPPPPPSPP-PPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSP 168 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 5/37 (13%) Frame = -2 Query: 459 GNPPSGCPCPPL-----PPPPPPPPPPPRLPPLPPNP 364 G PP G P P PPPPPPPPPPP PPLPP+P Sbjct: 49 GTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSP 85 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPP PPPPPP PP PP+PP Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPSPP 126 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/35 (65%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPP----PPPPPRLPPLPPNPP 361 PP P PP PPPPPP PPPPP PP PPNPP Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPP 140 [67][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 57.4 bits (137), Expect = 6e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP PP PP PP+L Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQL 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 [68][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 57.4 bits (137), Expect = 6e-07 Identities = 31/75 (41%), Positives = 36/75 (48%), Gaps = 11/75 (14%) Frame = -2 Query: 489 DSSASS*SGSGNP-----------PSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTST 343 DSS+SS + S P P P PP+ PPPPPPPPPP PP PP PP G Sbjct: 105 DSSSSSRAASATPVHHHRGRFMPPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPP 164 Query: 342 KADRADDNPNLPSLP 298 +P P+ P Sbjct: 165 PPGPPPPHPPPPAGP 179 [69][TOP] >UniRef100_C5FCB8 Epstein-Barr nuclear antigen 2 n=1 Tax=Microsporum canis CBS 113480 RepID=C5FCB8_NANOT Length = 951 Score = 57.4 bits (137), Expect = 6e-07 Identities = 29/65 (44%), Positives = 34/65 (52%), Gaps = 12/65 (18%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPP-------RLPPL-----PPNPPKLGTSTKADRADDNPNL 310 PP G P PP PPPPPPPPPPP LPP PP+PP + D AD N + Sbjct: 417 PPVGAPPPPPPPPPPPPPPPPPPPIQQQELPPAPTQASPPSPPPQVVTNPPDTADSNMSA 476 Query: 309 PSLPS 295 ++ S Sbjct: 477 TTVRS 481 [70][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/49 (53%), Positives = 28/49 (57%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 307 PP P PP PPPPPPPPPPP PP PP PP RA + N+P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNIP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 [71][TOP] >UniRef100_UPI0000F2B430 PREDICTED: similar to SRY (sex determining region Y)-box 30 n=1 Tax=Monodelphis domestica RepID=UPI0000F2B430 Length = 844 Score = 57.0 bits (136), Expect = 7e-07 Identities = 35/75 (46%), Positives = 37/75 (49%), Gaps = 16/75 (21%) Frame = -2 Query: 468 SGSGNPPS---GCPCPPL---------PPPPPPPPPPPRLPPLPPNPPKL----GTSTKA 337 SG+G PP C P L PPPPPPP PPP PPLPP PP L A Sbjct: 88 SGAGGPPPRGPACAAPRLLLQVKAEQPPPPPPPPLPPPPPPPLPPPPPLLFLHPTPHPAA 147 Query: 336 DRADDNPNLPSLPSA 292 + A P LPS PSA Sbjct: 148 EEAATPPLLPSHPSA 162 [72][TOP] >UniRef100_A0YMD7 Putative uncharacterized protein n=1 Tax=Lyngbya sp. PCC 8106 RepID=A0YMD7_9CYAN Length = 1010 Score = 57.0 bits (136), Expect = 7e-07 Identities = 33/72 (45%), Positives = 36/72 (50%), Gaps = 11/72 (15%) Frame = +2 Query: 257 SSGSGVSVNQPSALGRLGKFGLSSALSAF-----------VLVPNFGGFGGNGGNRGGGG 403 S G+G S P+ G G GL + A V PN GG GGNGG G GG Sbjct: 181 SGGNGASDQTPAGSGEAGSGGLFATGGASGGGGGGGGGEAVSFPNAGGQGGNGGAGGFGG 240 Query: 404 GGGGGGGSGGQG 439 GGGGGGG GG G Sbjct: 241 GGGGGGGGGGGG 252 [73][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/50 (52%), Positives = 28/50 (56%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPS 304 PP P PP PPPPPPPPPPP PP PP PP + A+ P PS Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILPAPANRAPPAPS 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [74][TOP] >UniRef100_A4S6G3 Predicted protein (Fragment) n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S6G3_OSTLU Length = 2146 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S +PPS P PP+P PPPP PPPP PPLPP PP Sbjct: 927 SPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPP 960 [75][TOP] >UniRef100_A4LAN9 Androgen receptor n=1 Tax=Saimiri boliviensis RepID=A4LAN9_9PRIM Length = 918 Score = 57.0 bits (136), Expect = 7e-07 Identities = 39/102 (38%), Positives = 47/102 (46%), Gaps = 4/102 (3%) Frame = +2 Query: 203 AHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSSALSAFVLVPNFGGFGGNG 382 A A+Q + A ++GSG PSA L +A + P GG GG G Sbjct: 395 AAAAQCRYGDLASLHGAGAAGSGSG--SPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGG 452 Query: 383 GNRGGGGGGGGGGGSGGQGQPDG----GLPLPLYELAEESSD 496 G GGGGGGGGGGG GG G+ G P P LA + D Sbjct: 453 GGGGGGGGGGGGGGGGGGGEAGAVDPYGYPRPPQGLASQEGD 494 [76][TOP] >UniRef100_Q5CLH8 Protease n=1 Tax=Cryptosporidium hominis RepID=Q5CLH8_CRYHO Length = 1569 Score = 57.0 bits (136), Expect = 7e-07 Identities = 29/55 (52%), Positives = 32/55 (58%), Gaps = 12/55 (21%) Frame = -2 Query: 489 DSSASS*SGSGNPP-----SGCPCPPLPPPPPPPP-------PPPRLPPLPPNPP 361 + S S+ SGS +PP S P PP PPPPPPPP PPP PPLPP PP Sbjct: 1510 NGSPSAGSGSNSPPLPPPSSSSPSPPPPPPPPPPPPSSSSPSPPPPPPPLPPPPP 1564 [77][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 57.0 bits (136), Expect = 7e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPP PPPPPPP PP PPNPP Sbjct: 312 PPPPLPSPPPPPPTPPPPPPPPPPPPPPNPP 342 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/56 (48%), Positives = 29/56 (51%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 289 +PP P PPLP PPPPPP PP PP PP PP PN P +P AE Sbjct: 306 SPPPPPPPPPLPSPPPPPPTPPPPPPPPPPPPP-------------PNPPFIPPAE 348 [78][TOP] >UniRef100_A4HXH1 Formin, putative n=1 Tax=Leishmania infantum RepID=A4HXH1_LEIIN Length = 1436 Score = 57.0 bits (136), Expect = 7e-07 Identities = 25/52 (48%), Positives = 31/52 (59%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PP+G P P PPPPPPPPPPPR+ PP PP G S A ++ ++P Sbjct: 796 PPTGGPKQPPPPPPPPPPPPPRMGNGPPPPPGKGASGAAAPVPNSSTTRNVP 847 [79][TOP] >UniRef100_B8M4W4 Actin associated protein Wsp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M4W4_TALSN Length = 648 Score = 57.0 bits (136), Expect = 7e-07 Identities = 33/78 (42%), Positives = 34/78 (43%), Gaps = 12/78 (15%) Frame = -2 Query: 453 PPSGCPCPPLPPP----------PPPPPPPPRL--PPLPPNPPKLGTSTKADRADDNPNL 310 PPSG P PP PPP PPPPPPPP PP PP PP G+ P Sbjct: 485 PPSGIPQPPPPPPPPPPSGIPQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGA 544 Query: 309 PSLPSAEGWFTLTPLPLL 256 P P G P PLL Sbjct: 545 PPPPPPGG---AVPPPLL 559 [80][TOP] >UniRef100_B8M4W3 Actin associated protein Wsp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M4W3_TALSN Length = 822 Score = 57.0 bits (136), Expect = 7e-07 Identities = 33/78 (42%), Positives = 34/78 (43%), Gaps = 12/78 (15%) Frame = -2 Query: 453 PPSGCPCPPLPPP----------PPPPPPPPRL--PPLPPNPPKLGTSTKADRADDNPNL 310 PPSG P PP PPP PPPPPPPP PP PP PP G+ P Sbjct: 485 PPSGIPQPPPPPPPPPPSGIPQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGA 544 Query: 309 PSLPSAEGWFTLTPLPLL 256 P P G P PLL Sbjct: 545 PPPPPPGG---AVPPPLL 559 [81][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 57.0 bits (136), Expect = 7e-07 Identities = 34/87 (39%), Positives = 39/87 (44%), Gaps = 12/87 (13%) Frame = -2 Query: 513 CCFSFSS------------LDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPP 370 CCF SS +++A+S + PP P PP PPPPPPPPPPP PP PP Sbjct: 321 CCFKTSSDATTPTLVTGGTQENNATSDAPKLMPP---PPPPPPPPPPPPPPPPPRPPPPP 377 Query: 369 NPPKLGTSTKADRADDNPNLPSLPSAE 289 P K G A P L E Sbjct: 378 PPIKKGAPPPAPPKATMARFPKLSPTE 404 [82][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -2 Query: 450 PSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA 328 P PP PPPPPPPPPPP PP PP PP STK +A Sbjct: 346 PPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPASTKPPQA 386 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGT 349 P + P PP PPPPPPPPPPP PP PP PP T Sbjct: 347 PAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPAST 381 [83][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 56.6 bits (135), Expect = 9e-07 Identities = 30/67 (44%), Positives = 36/67 (53%) Frame = -2 Query: 498 SSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDN 319 S+++S S P S P PP P PPPPPPPPP PP PP PP L + +N Sbjct: 316 STVESPPKISSAFLKPVSAPPPPPPPRPPPPPPPPPPPPPPPPPPPAL-------KNVEN 368 Query: 318 PNLPSLP 298 P +PS P Sbjct: 369 PMIPSPP 375 [84][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 56.6 bits (135), Expect = 9e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP C PP PPPPPPPPPPP PP PP PP Sbjct: 132 PPPMCAPPPPPPPPPPPPPPPPPPPPPPPPP 162 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 133 PPMCAPPPPPPPPPPPPPPPPPPPPPPPPPP 163 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP CP PP P PPPPPPPP LPP PP PP Sbjct: 171 PPPPCPPPPAPCPPPPPPPPMCLPPPPPPPP 201 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 5/36 (13%) Frame = -2 Query: 453 PPSGCP-----CPPLPPPPPPPPPPPRLPPLPPNPP 361 PP CP C P PPPPPPPPPPP PP PP PP Sbjct: 125 PPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPP 160 [85][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 56.6 bits (135), Expect = 9e-07 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 4/50 (8%) Frame = -2 Query: 498 SSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRL----PPLPPNPP 361 S L S+S +G + PS P PP PPPPPPPPPPP L PP+PP PP Sbjct: 535 SPLLGSSSVENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 584 [86][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 56.6 bits (135), Expect = 9e-07 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 4/50 (8%) Frame = -2 Query: 498 SSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRL----PPLPPNPP 361 S L S+S +G + PS P PP PPPPPPPPPPP L PP+PP PP Sbjct: 547 SPLLGSSSVENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 596 [87][TOP] >UniRef100_Q92P87 Putative glycine-rich protein n=1 Tax=Sinorhizobium meliloti RepID=Q92P87_RHIME Length = 192 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +2 Query: 353 PNFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDGG 454 P GG GG GG GGGGGGGGGGG GG G P GG Sbjct: 105 PGGGGGGGGGGGGGGGGGGGGGGGGGGGGDPGGG 138 [88][TOP] >UniRef100_O22459 Hydroxyproline-rich glycoprotein gas29p n=1 Tax=Chlamydomonas reinhardtii RepID=O22459_CHLRE Length = 433 Score = 56.6 bits (135), Expect = 9e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 P S P PP PPPPPPPPPPP LPP P PP Sbjct: 49 PQSPSPPPPPPPPPPPPPPPPPLPPFPAKPP 79 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 +PP P PP PPPPPPPPPPP PPLPP P K Sbjct: 46 SPPPQSPSPP-PPPPPPPPPPPPPPPLPPFPAK 77 [89][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 56.6 bits (135), Expect = 9e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPTPPPPPPRPP 449 Score = 53.9 bits (128), Expect = 6e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPP PP PP PP+PP Sbjct: 422 PPPPPPPPPPPPPPPPPPTPPPPPPRPPSPP 452 [90][TOP] >UniRef100_A8IC93 Heavy metal transporting ATPase n=1 Tax=Chlamydomonas reinhardtii RepID=A8IC93_CHLRE Length = 1086 Score = 56.6 bits (135), Expect = 9e-07 Identities = 45/113 (39%), Positives = 56/113 (49%), Gaps = 1/113 (0%) Frame = +2 Query: 173 RTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSS-ALSAFVL 349 R AR ALV A S P ++ + Q +S + V L F +S A +A V Sbjct: 24 RRARPALVTLA-VSCPGNNTSLQSQPQHASWAQKFVRATVVATTLQFFAAASHAANASV- 81 Query: 350 VPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLPLPLYELAEESSDEKEK 508 GG G GG+RGGGGGG GGGG G GG P L ++AE SSD E+ Sbjct: 82 ---GGGIGAGGGHRGGGGGG-GGGGDGHSSMSHGGSPTVLGDIAEASSDLVEE 130 [91][TOP] >UniRef100_A2XDP2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XDP2_ORYSI Length = 820 Score = 56.6 bits (135), Expect = 9e-07 Identities = 30/77 (38%), Positives = 39/77 (50%), Gaps = 9/77 (11%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNP--PSGCPCPPLPPPPPPPPPP-------PRLPPLPPNPPKL 355 FS S + S S P PS P PP PPPPPPPPPP P+ PP PP PP + Sbjct: 324 FSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSV 383 Query: 354 GTSTKADRADDNPNLPS 304 ++ + + P +P+ Sbjct: 384 PSNNNLPKPAEPPAVPT 400 [92][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLG 352 PP P PPLPPPPPPPPP P PP PP PP +G Sbjct: 1215 PPPPPPPPPLPPPPPPPPPLPPPPPPPPPPPPVG 1248 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/35 (68%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPP----PPPPPRLPPLPPNPP 361 PP P PPLPPPPPP PPPPP PPLPP PP Sbjct: 1205 PPLTPPPPPLPPPPPPPPPLPPPPPPPPPLPPPPP 1239 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PP PPPPPPPP LPP PP PP Sbjct: 1212 PPLPPPPPPPPPLPPPPPPPPPLPPPPPPPP 1242 [93][TOP] >UniRef100_C0SUE0 Ecdysone receptor A isoform n=1 Tax=Apis mellifera RepID=C0SUE0_APIME Length = 629 Score = 56.6 bits (135), Expect = 9e-07 Identities = 35/84 (41%), Positives = 43/84 (51%) Frame = +2 Query: 203 AHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSSALSAFVLVPNFGGFGGNG 382 AH Q +SN+ S+S S + S ++G+ LS S + GG GG G Sbjct: 145 AHQQQQPNSNNGYASPMSTS----SYDPYSPNSKIGRDELSQPGSLNGYGSSGGGGGGGG 200 Query: 383 GNRGGGGGGGGGGGSGGQGQPDGG 454 G GGGGGGGGGGG GG G GG Sbjct: 201 GGGGGGGGGGGGGGGGGGGGGGGG 224 [94][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 39 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA 328 PP P PP PPPPPPPPPPP PP PP PP +A A Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPSA 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 [95][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [96][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 56.6 bits (135), Expect = 9e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 113 PPIFTPAPPPPPPPPPPPPPPPPPPPPPPPP 143 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/63 (44%), Positives = 31/63 (49%), Gaps = 12/63 (19%) Frame = -2 Query: 450 PSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP------------NLP 307 P P PP PPPPPPPPPPP PP PP P+ T + NP NLP Sbjct: 120 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPRFTTRGVSFPPHGNPYPYPPRTPRPIFNLP 179 Query: 306 SLP 298 +LP Sbjct: 180 TLP 182 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 450 PSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 P+ P PP PPPPPPPPPPP PP PP PP Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 147 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 PP P PP PPPPPPPPPPP PP PP P Sbjct: 120 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTP 149 [97][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 56.6 bits (135), Expect = 9e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 113 PPIFTPAPPPPPPPPPPPPPPPPPPPPPPPP 143 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/59 (47%), Positives = 30/59 (50%), Gaps = 12/59 (20%) Frame = -2 Query: 438 PCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP------------NLPSLP 298 P PP PPPPPPPPPPP PP PP PP T + NP NLP+LP Sbjct: 120 PPPPPPPPPPPPPPPPPPPPPPPPPPLFTTRGVSFPPHGNPYPYPPRTPRPIFNLPTLP 178 [98][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 56.6 bits (135), Expect = 9e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -2 Query: 465 GSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 340 G G P PP PPPPPPPPPPP PP PP PPK + TK Sbjct: 33 GGGKKQEQAPPPPPPPPPPPPPPPPP-PPPPPPPPKKTSDTK 73 [99][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 PP P PP PPPPPPPPPPP PPLPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 100 [100][TOP] >UniRef100_Q10Q99 Formin-like protein 8 n=1 Tax=Oryza sativa Japonica Group RepID=FH8_ORYSJ Length = 892 Score = 56.6 bits (135), Expect = 9e-07 Identities = 30/77 (38%), Positives = 39/77 (50%), Gaps = 9/77 (11%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNP--PSGCPCPPLPPPPPPPPPP-------PRLPPLPPNPPKL 355 FS S + S S P PS P PP PPPPPPPPPP P+ PP PP PP + Sbjct: 324 FSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSV 383 Query: 354 GTSTKADRADDNPNLPS 304 ++ + + P +P+ Sbjct: 384 PSNNNLPKPAEPPAVPT 400 [101][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 PP P PP PPPPPPPPPPP PP PP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [102][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 1472 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 1504 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/48 (50%), Positives = 25/48 (52%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 310 PP P PP PPPPPPPPPPP PPLP P K + P L Sbjct: 1479 PPPPPPPPPPPPPPPPPPPPPPPPPLPRTPRGGKRKHKQQQQQQQPQL 1526 [103][TOP] >UniRef100_UPI0001B7A6BD enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6BD Length = 804 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP PP PP PP S +A P P S PS++ Sbjct: 437 PPTSGPAAP-PPPPPPPPPPPPPPPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 492 [104][TOP] >UniRef100_UPI0001B7A6BC enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6BC Length = 808 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP PP PP PP S +A P P S PS++ Sbjct: 441 PPTSGPAAP-PPPPPPPPPPPPPPPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 496 [105][TOP] >UniRef100_UPI0001B7A6A7 enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6A7 Length = 823 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP PP PP PP S +A P P S PS++ Sbjct: 456 PPTSGPAAP-PPPPPPPPPPPPPPPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 511 [106][TOP] >UniRef100_UPI0000DC0B78 similar to Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (LOC307738), mRNA n=1 Tax=Rattus norvegicus RepID=UPI0000DC0B78 Length = 387 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/53 (49%), Positives = 32/53 (60%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 +PP P PP PPPP PPPPP P LPP+PP L +S + + P+ PS P Sbjct: 2 SPPPSSPPPPSPPPPLTPPPPP--PSLPPSPPPLLSSPPSPPSPPRPSSPSPP 52 [107][TOP] >UniRef100_UPI0000DC0B77 similar to Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (LOC307738), mRNA n=1 Tax=Rattus norvegicus RepID=UPI0000DC0B77 Length = 430 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/53 (49%), Positives = 32/53 (60%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 +PP P PP PPPP PPPPP P LPP+PP L +S + + P+ PS P Sbjct: 44 SPPPSSPPPPSPPPPLTPPPPP--PSLPPSPPPLLSSPPSPPSPPRPSSPSPP 94 [108][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/49 (51%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPL-PPNPPKLGTSTKADRADDNPN 313 +PP+ P PP PPPPPPPPPPP PP PP PP T PN Sbjct: 88 SPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTPPPTPPPTPPPTPPPTPN 136 Score = 53.9 bits (128), Expect = 6e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 450 PSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PS PP PPPPPPPPPPP PP PP PP Sbjct: 87 PSPPTAPPQPPPPPPPPPPPPPPPPPPTPP 116 [109][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -2 Query: 468 SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S S +PP P PP PPPPPPPPPPP P PNPP Sbjct: 201 SASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPP 236 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -2 Query: 486 SSASS*SGSGNPPSGCPCPP--LPPPPPPPPPPPRLPPLPPNPP 361 S SS S + PPS P PP PPPP PPPPPP PP PP+PP Sbjct: 188 SPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPP 231 Score = 53.5 bits (127), Expect = 8e-06 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 +PP P PP PPPP PPP PP LPP P PP S +P+ PS P Sbjct: 21 SPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPP 73 Score = 53.5 bits (127), Expect = 8e-06 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 +PPS P PP P PPPP PPPP PP P PP S + +P PS P Sbjct: 86 SPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPP 138 [110][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/58 (48%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP--NLPSLPSAEG 286 PP P PP PPPPPPPPPPP PP PP PP + D P P S EG Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPPVTTAPGSNSVEG 384 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 [111][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTS 346 PPS P PP PPPPPPPPPP PP PP PP G S Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPS 537 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -2 Query: 465 GSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 G PP P PP PPPPPPP PPP PP PP PP Sbjct: 483 GVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPP 517 [112][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 465 GSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 G PP P PP PPPPPPPPPPP PP PP PP Sbjct: 220 GGEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 459 GNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGT 349 G P P PP PPPPPPPPPPP PP PP PP T Sbjct: 221 GEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCNT 257 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -2 Query: 465 GSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLG 352 G PP P PP PPPPPPPPPPP PP PP P G Sbjct: 221 GEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCNTG 258 [113][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 237 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPP PPPP PP PP+PP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 242 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPP PPPP PP PP+PP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 254 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 PP P PP PPPPPPPPPPP PP PP P Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 [114][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 272 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PPS P PP PPPPPPP PPP PP PP PP Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPP 261 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 PPS P PP PPPPPPPPPPP PP PP P Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PPS P PP PPPPPPPPPPP PP PP+PP Sbjct: 250 PPS--PPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 53.9 bits (128), Expect = 6e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPP PP PP PP Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPP 257 [115][TOP] >UniRef100_C5WQ18 Putative uncharacterized protein Sb01g039800 n=1 Tax=Sorghum bicolor RepID=C5WQ18_SORBI Length = 850 Score = 56.2 bits (134), Expect = 1e-06 Identities = 45/136 (33%), Positives = 65/136 (47%), Gaps = 4/136 (2%) Frame = +2 Query: 107 HLIMQGLKATPGLRASSGRPTLRTARTALVVRAHAS---QPSSSNHAEQQECSSSGSGVS 277 H Q L +P + RP R ++ +RA AS QP S + Sbjct: 40 HHAGQALSISPARYEPAARPP-RGGSSSSAIRAAASAGAQPGSDPVPAEPRIELPAIFTV 98 Query: 278 VNQPSALGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGL 457 ++ + G F ++S+ +AF+L +FGGFGG G GGGGGGGG G+GG G GG Sbjct: 99 FSEAAKTG--AAFFIASSGAAFLL-GSFGGFGGGAGGLFGGGGGGGGWGAGGAGGGGGGD 155 Query: 458 PLP-LYELAEESSDEK 502 L L+ + +D+K Sbjct: 156 FLSRLFSVGAAHADDK 171 [116][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/53 (50%), Positives = 28/53 (52%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 295 PPS P PP PPP P PPPPP PP PP PP S A P P+ PS Sbjct: 2124 PPSPPPPPPSPPPAPLPPPPPSPPPSPPPPPSPPPSPPAPPPHPPPEPPAPPS 2176 [117][TOP] >UniRef100_Q16U10 Putative uncharacterized protein n=1 Tax=Aedes aegypti RepID=Q16U10_AEDAE Length = 1808 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/71 (45%), Positives = 36/71 (50%), Gaps = 6/71 (8%) Frame = -2 Query: 486 SSASS*SGSGNPPS--GCPCPPLPPPPP----PPPPPPRLPPLPPNPPKLGTSTKADRAD 325 +S SS + +PPS G P PP PPPPP PPPPPP P PP PP G A Sbjct: 349 NSTSSTHSTTSPPSITGAPAPPPPPPPPNLAPPPPPPPPCAPPPPPPPMAG----GPSAR 404 Query: 324 DNPNLPSLPSA 292 P +P P A Sbjct: 405 GGPPVPPAPPA 415 [118][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -2 Query: 492 LDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 L S ++ S PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 LQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [119][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLG 352 PP P PP PPPPPPPPPPP PP PP PP G Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 80 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLG 352 PP P PP PPPPPPPPPPP PP PP PP G Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGG 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 [120][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [121][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 114 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 [122][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/62 (50%), Positives = 34/62 (54%) Frame = -2 Query: 483 SASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPS 304 SA +G+ PP P PPLPPPPPPPPPPP PP PP PP L + P LP Sbjct: 460 SAIPHAGASLPPP--PPPPLPPPPPPPPPPP--PPPPPPPPALDVG-ETSSLQPPPPLPP 514 Query: 303 LP 298 P Sbjct: 515 PP 516 [123][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -2 Query: 468 SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +G G PP P PP PPPPPPPPPPP PP PP PP Sbjct: 266 TGPGPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPP 299 [124][TOP] >UniRef100_Q0GNC1-3 Isoform 2 of Inverted formin-2 n=1 Tax=Mus musculus RepID=Q0GNC1-3 Length = 1264 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/88 (38%), Positives = 46/88 (52%), Gaps = 8/88 (9%) Frame = -2 Query: 468 SGSGNPPSGCPCPPLP------PPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 307 +G+ +PP P P LP PPPPPPPP P + P+PP PP +A + P LP Sbjct: 503 TGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPPPPP----LPRAGQIPPPPPLP 558 Query: 306 --SLPSAEGWFTLTPLPLLEHSCCSAWL 229 S+PS G + ++HS SAW+ Sbjct: 559 GFSVPSMMGGVEEIIVAQVDHSLGSAWV 586 [125][TOP] >UniRef100_Q0GNC1 Inverted formin-2 n=1 Tax=Mus musculus RepID=INF2_MOUSE Length = 1273 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/88 (38%), Positives = 46/88 (52%), Gaps = 8/88 (9%) Frame = -2 Query: 468 SGSGNPPSGCPCPPLP------PPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 307 +G+ +PP P P LP PPPPPPPP P + P+PP PP +A + P LP Sbjct: 503 TGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPPPPP----LPRAGQIPPPPPLP 558 Query: 306 --SLPSAEGWFTLTPLPLLEHSCCSAWL 229 S+PS G + ++HS SAW+ Sbjct: 559 GFSVPSMMGGVEEIIVAQVDHSLGSAWV 586 [126][TOP] >UniRef100_UPI00017C2B21 PREDICTED: similar to WAS/WASL interacting protein family, member 3 n=1 Tax=Bos taurus RepID=UPI00017C2B21 Length = 486 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/69 (50%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Frame = -2 Query: 459 GNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP-NLPSLPSAEGW 283 G+PP P P L PPPPPPPPPP LPP PP LG S KA + P +LP +P Sbjct: 211 GSPPV-VPPPLLCPPPPPPPPPPPLPP----PPALGPSDKAAKPQLAPLHLPPVP----- 260 Query: 282 FTLTPLPLL 256 PLPLL Sbjct: 261 ---PPLPLL 266 [127][TOP] >UniRef100_UPI0001795F40 PREDICTED: leiomodin 2 (cardiac) n=1 Tax=Equus caballus RepID=UPI0001795F40 Length = 549 Score = 55.8 bits (133), Expect = 2e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 438 PCPPLPPPPPPPPPPPRLPPLPPNPP 361 P PP PPPPPPPPPP RLPP PP PP Sbjct: 423 PAPPPPPPPPPPPPPQRLPPPPPPPP 448 [128][TOP] >UniRef100_UPI0001661EAE PREDICTED: similar to Putative acrosin-like protease n=1 Tax=Homo sapiens RepID=UPI0001661EAE Length = 355 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTST 343 PP+ P PP PPPPPPPPP LPP PP PP +ST Sbjct: 273 PPAAQPRPPPSPPPPPPPPPSPLPPPPPPPPPTPSST 309 [129][TOP] >UniRef100_UPI0000E24D2B PREDICTED: SET binding protein 1 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E24D2B Length = 1596 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/45 (53%), Positives = 28/45 (62%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PPLPPPPPPP PPP PPLPP PP L + + + P P+ P Sbjct: 1520 PPLPPPPPPPLPPPPPPPLPP-PPPLPKTPRGGKRKHKPQAPAQP 1563 [130][TOP] >UniRef100_UPI000069FBE2 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE2 Length = 980 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = -2 Query: 489 DSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRL----PPLPPNPP 361 D S +G + PS P PP PPPPPPPPPPP L PP+PP PP Sbjct: 437 DGDISMENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 483 [131][TOP] >UniRef100_Q9Y6X0 SET-binding protein n=2 Tax=Homo sapiens RepID=SETBP_HUMAN Length = 1542 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/45 (53%), Positives = 28/45 (62%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PPLPPPPPPP PPP PPLPP PP L + + + P P+ P Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPP-PPPLPKTPRGGKRKHKPQAPAQP 1509 [132][TOP] >UniRef100_UPI0001951250 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Canis lupus familiaris RepID=UPI0001951250 Length = 1052 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = -2 Query: 447 SGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 +G PP+PPPPPPPPPPP PP PP PP G + + A P P PSA Sbjct: 504 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLPP-PPPPSA 554 [133][TOP] >UniRef100_UPI000179ED76 UPI000179ED76 related cluster n=1 Tax=Bos taurus RepID=UPI000179ED76 Length = 455 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/69 (50%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Frame = -2 Query: 459 GNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP-NLPSLPSAEGW 283 G+PP P P L PPPPPPPPPP LPP PP LG S KA + P +LP +P Sbjct: 180 GSPPV-VPPPLLCPPPPPPPPPPPLPP----PPALGPSDKAAKPQLAPLHLPPVP----- 229 Query: 282 FTLTPLPLL 256 PLPLL Sbjct: 230 ---PPLPLL 235 [134][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +PP P PPLPPPPPPPPPP PP PP PP Sbjct: 204 SPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPP 235 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/56 (44%), Positives = 28/56 (50%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 286 PP P PP PPPPP PPPP PP PP+PP + P P LP+ G Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPTG 265 [135][TOP] >UniRef100_Q2RTE8 Putative uncharacterized protein n=1 Tax=Rhodospirillum rubrum ATCC 11170 RepID=Q2RTE8_RHORT Length = 208 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = -2 Query: 450 PSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADD 322 P P PP PPPPPPPPPPP PP PP PP + + D D+ Sbjct: 87 PEPEPEPPPPPPPPPPPPPPPPPPPPPEPPPFVSEIEDDPVDE 129 [136][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +PP P PP PPPPPPPPPPP PP PP PP Sbjct: 305 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 [137][TOP] >UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia MC0-3 RepID=B1JXE0_BURCC Length = 505 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGG 454 GG GGNGGN GGGGGGGGGGG GG G GG Sbjct: 360 GGAGGNGGNGGGGGGGGGGGGGGGGGGGGGG 390 [138][TOP] >UniRef100_Q08RT8 Putative uncharacterized protein n=1 Tax=Stigmatella aurantiaca DW4/3-1 RepID=Q08RT8_STIAU Length = 909 Score = 55.8 bits (133), Expect = 2e-06 Identities = 37/100 (37%), Positives = 48/100 (48%), Gaps = 8/100 (8%) Frame = +2 Query: 179 ARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSS-------ALS 337 A + +R +ASQ + E +G+G S P G S+ + S Sbjct: 240 APSGATIRVYASQNCTGAEVASGE---AGAGNSCEIPIYTPGYTSGGYSARSYNGAGSAS 296 Query: 338 AFVLVPNFGGFGGNGG-NRGGGGGGGGGGGSGGQGQPDGG 454 +P++GG GG G GGGGGGGGGGG GGQG DGG Sbjct: 297 GCASIPSYGGGGGGGSCGGGGGGGGGGGGGYGGQGYGDGG 336 [139][TOP] >UniRef100_C1E4Y1 Putative uncharacterized protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E4Y1_9CHLO Length = 1031 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -2 Query: 450 PSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PS P PP PPPPPPPPPPPR P PPNPPK Sbjct: 463 PSRPPPPPPPPPPPPPPPPPR--PPPPNPPK 491 [140][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/46 (52%), Positives = 26/46 (56%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 316 PP P PP PPPPPPPPPPP PP PP PP T ++ P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPCCEKCRRGP 127 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 [141][TOP] >UniRef100_A8JII9 Flagellar associated protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JII9_CHLRE Length = 1202 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/52 (53%), Positives = 31/52 (59%), Gaps = 6/52 (11%) Frame = +2 Query: 317 GLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGG------QGQPDGG 454 G+ SA +AF+ GG GG GG GGGGGGGGGGG G QG P GG Sbjct: 264 GVMSAANAFMKAGQMGGGGGGGGGGGGGGGGGGGGGFAGAVASALQGVPSGG 315 [142][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLG 352 PP P PP PPPPPPPPPPP PP PP PP G Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPG 118 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 [143][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/53 (54%), Positives = 30/53 (56%), Gaps = 10/53 (18%) Frame = -2 Query: 486 SSASS*SGSGNPP----------SGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 +SA S S S PP S P PP PPPPPPPPPPP PP PP PPK Sbjct: 1511 ASAGSGSNSSPPPPPPPPPPPSSSSSPSPP-PPPPPPPPPPPPPPPPPPPPPK 1562 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Frame = -2 Query: 483 SASS*SGSGNPPSGCPCPPLPP-------PPPPPPPPPRLPPLPPNPP 361 SAS+ SGS + P P PP PP PPPPPPPPP PP PP PP Sbjct: 1510 SASAGSGSNSSPPPPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPP 1557 [144][TOP] >UniRef100_Q20327 Ground-like (Grd related) protein 4 n=1 Tax=Caenorhabditis elegans RepID=Q20327_CAEEL Length = 210 Score = 55.8 bits (133), Expect = 2e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP CP PP+ PPPPPPPPPP PP PP P Sbjct: 52 PPQFCPPPPMCPPPPPPPPPPMCPPPPPPMP 82 [145][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 55.8 bits (133), Expect = 2e-06 Identities = 32/90 (35%), Positives = 37/90 (41%), Gaps = 15/90 (16%) Frame = -2 Query: 510 CFSFSSLDSSASS*SGSGNPPSGC--PCP-------------PLPPPPPPPPPPPRLPPL 376 CF S ++A + + +GC PCP P PPPPPPPPPPP PP Sbjct: 9 CFVLSIACTNAKTLHDTIKRQAGCAAPCPAVCAPACQPICCVPAPPPPPPPPPPPPPPPP 68 Query: 375 PPNPPKLGTSTKADRADDNPNLPSLPSAEG 286 PP PP NP P P G Sbjct: 69 PPPPPPPPPPPPQQPLPGNPGPPGRPGPAG 98 [146][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 [147][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 [148][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPE 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKAD 334 PP P PP PPPPPPPPPPP PP PP P +AD Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQAD 42 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -2 Query: 438 PCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 307 P PP PPPPPPPPPPP PP PP PP + + D P +P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQADPPAVP 47 [149][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP PP PP PP + Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHI 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [150][TOP] >UniRef100_B3MC79 GF12825 n=1 Tax=Drosophila ananassae RepID=B3MC79_DROAN Length = 503 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/54 (46%), Positives = 27/54 (50%) Frame = -2 Query: 468 SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 307 SG G PP PP PPPPPPPPPP PP+PP T +PN P Sbjct: 329 SGVGVPPPSALPPPPPPPPPPPPPPQPQTKKPPSPPPFPTKGAVKPLSPSPNTP 382 [151][TOP] >UniRef100_A9V866 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V866_MONBE Length = 135 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +2 Query: 353 PNFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDGG 454 P+ GG GG GG GGGGGGGGGGG GG G P GG Sbjct: 43 PSGGGGGGGGGGGGGGGGGGGGGGGGGGGPPVGG 76 [152][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 55.8 bits (133), Expect = 2e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 441 CPCPPLPPPPPPPPPPPRLPPLPPNPP 361 CP PP PPPPPPPPPPP PP PP PP Sbjct: 37 CPPPPPPPPPPPPPPPPPPPPPPPPPP 63 [153][TOP] >UniRef100_A8QDB8 Ground-like domain containing protein n=1 Tax=Brugia malayi RepID=A8QDB8_BRUMA Length = 276 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 5/36 (13%) Frame = -2 Query: 453 PPSGCP----CPPLPPPPPPPPP-PPRLPPLPPNPP 361 PP CP CPP PPPPPPPPP PP PP PP+PP Sbjct: 110 PPVVCPRPIICPPPPPPPPPPPPCPPSPPPCPPSPP 145 Score = 54.3 bits (129), Expect = 5e-06 Identities = 32/85 (37%), Positives = 38/85 (44%), Gaps = 13/85 (15%) Frame = -2 Query: 453 PPSGCPCPP---LPPP---------PPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 310 PP PCPP PPP PPPPPPPP PP PP+PP S P + Sbjct: 96 PPLPXPCPPPPICPPPVVCPRPIICPPPPPPPPPPPPCPPSPPPCPPS---------PPM 146 Query: 309 PSLPSAEGWFTLT-PLPLLEHSCCS 238 P P T T +P++ CC+ Sbjct: 147 PICPILAPKLTPTYTIPVINDCCCT 171 [154][TOP] >UniRef100_A0E3T6 Chromosome undetermined scaffold_77, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0E3T6_PARTE Length = 1215 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/60 (48%), Positives = 33/60 (55%), Gaps = 8/60 (13%) Frame = -2 Query: 453 PPS--GCPCPPLPPPPP------PPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PPS G P PP PPPPP PPPPPPR+ PP PP LG + + LPS+P Sbjct: 681 PPSRNGAPPPPPPPPPPSKTGAPPPPPPPRIGGAPPPPPPLGNNQQQISNQIVQQLPSVP 740 [155][TOP] >UniRef100_Q03173-5 Isoform 4 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-5 Length = 787 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP P PP PP S +A P P S PS++ Sbjct: 419 PPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 475 [156][TOP] >UniRef100_Q03173-2 Isoform 1 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-2 Length = 390 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP P PP PP S +A P P S PS++ Sbjct: 22 PPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 78 [157][TOP] >UniRef100_Q03173-4 Isoform 3 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-4 Length = 783 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP P PP PP S +A P P S PS++ Sbjct: 415 PPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 471 [158][TOP] >UniRef100_Q03173 Protein enabled homolog n=1 Tax=Mus musculus RepID=ENAH_MOUSE Length = 802 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 289 PP+ P P PPPPPPPPPPP P PP PP S +A P P S PS++ Sbjct: 434 PPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 490 [159][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 54.3 bits (129), Expect = 5e-06 Identities = 30/68 (44%), Positives = 32/68 (47%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGW 283 +G PP P PP PPPPPPPPPPP PP PP PP P P P Sbjct: 56 TGVPPP-LPPPPPPPPPPPPPPPPPPPPPPPPPPS---------PPPPPPPPPPPQRRDA 105 Query: 282 FTLTPLPL 259 +T P PL Sbjct: 106 WTQEPSPL 113 [160][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 447 SGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 S P PP PPPPPPPPPPP PP PP PPK Sbjct: 143 SQTPPPPPPPPPPPPPPPPPPPPPPPKPPK 172 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/73 (41%), Positives = 34/73 (46%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 274 PP P PP PPPPPPPPPPP PPL P PP S+ P +P P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPLLPPPPPPSISSFLVPPQSCP-IPCSPQC------ 479 Query: 273 TPLPLLEHSCCSA 235 P +CCS+ Sbjct: 480 --APSCSENCCSS 490 Score = 53.5 bits (127), Expect = 8e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPP 361 PPLPPPPPPPPPPP PP PP PP Sbjct: 422 PPLPPPPPPPPPPPPPPPPPPPPP 445 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 438 PCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 P PP PPPPPPPPPPP PP PP PP L Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPL 452 [161][TOP] >UniRef100_UPI000186A185 hypothetical protein BRAFLDRAFT_108752 n=1 Tax=Branchiostoma floridae RepID=UPI000186A185 Length = 742 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTST 343 PP GC PP PPPPPPP P LPP PP PP G T Sbjct: 575 PPPGCTLPPPPPPPPPPGPTLSLPPPPPPPPPPGFQT 611 [162][TOP] >UniRef100_UPI00017974C7 PREDICTED: similar to KIAA1902 protein n=1 Tax=Equus caballus RepID=UPI00017974C7 Length = 1089 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/52 (51%), Positives = 30/52 (57%) Frame = -2 Query: 447 SGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 +G PP+PPPPPPPPPPP PP PP PP G + A P P PSA Sbjct: 541 NGPATPPMPPPPPPPPPPPPPPPPPPPPPLPGPAADTVPAPPLPP-PPPPSA 591 Score = 54.7 bits (130), Expect = 4e-06 Identities = 29/70 (41%), Positives = 34/70 (48%) Frame = -2 Query: 495 SLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 316 +L S+ + N P+ P PP PPPPPPPPPPP PP PP P + A P Sbjct: 528 ALPPSSDTPEAVQNGPATPPMPPPPPPPPPPPPPPPPPPPPPLPGPAADTVPAPPLPPPP 587 Query: 315 NLPSLPSAEG 286 PS P G Sbjct: 588 P-PSAPPLPG 596 [163][TOP] >UniRef100_UPI00017615E4 PREDICTED: hypothetical protein, partial n=1 Tax=Danio rerio RepID=UPI00017615E4 Length = 1940 Score = 55.5 bits (132), Expect = 2e-06 Identities = 39/106 (36%), Positives = 48/106 (45%), Gaps = 7/106 (6%) Frame = -2 Query: 504 SFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPL--PPNPPKLGTSTKADR 331 S +SA S +G+ + +G PPL PPP PPPPPP PP PP PP S +D Sbjct: 1121 SLKPSSNSAFSRTGTFSKSTGSHRPPLHPPPHPPPPPPTQPPSQPPPPPPTQPPSPPSDL 1180 Query: 330 ADD-----NPNLPSLPSAEGWFTLTPLPLLEHSCCSAWLLLEG*DA 208 +D PN P G F L P+ C W +E DA Sbjct: 1181 TEDAKSAFGPN----PENSGQFLLKPV------CRRPWDAIEELDA 1216 [164][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2324 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [165][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2324 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [166][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 PPS P P PPPPPPPPPPPR PP PP P Sbjct: 477 PPSRPPSSPSPPPPPPPPPPPRPPPPPPPP 506 [167][TOP] >UniRef100_UPI0000DA3CD5 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3CD5 Length = 311 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/79 (41%), Positives = 37/79 (46%), Gaps = 18/79 (22%) Frame = +2 Query: 272 VSVNQPSALGRLGKFGLSSALSAF------------------VLVPNFGGFGGNGGNRGG 397 V +P +G + GL S + AF V VP GG GG GG GG Sbjct: 131 VDPKKPEFIGTVRASGLPSHVLAFFWKQEVCFPVIYRIKGCSVRVPGRGGGGGGGGGGGG 190 Query: 398 GGGGGGGGGSGGQGQPDGG 454 GGGGGGGGG GG G GG Sbjct: 191 GGGGGGGGGGGGGGGGGGG 209 [168][TOP] >UniRef100_UPI00005A3937 PREDICTED: similar to formin-like 2 isoform B n=1 Tax=Canis lupus familiaris RepID=UPI00005A3937 Length = 1119 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/47 (55%), Positives = 29/47 (61%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 PP+PPPPPPPPPPP PP PP PP G + + A P P PSA Sbjct: 576 PPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLPP-PPPPSA 621 [169][TOP] >UniRef100_UPI00005A3429 PREDICTED: similar to hemojuvelin isoform a isoform 1 n=1 Tax=Canis lupus familiaris RepID=UPI00005A3429 Length = 469 Score = 55.5 bits (132), Expect = 2e-06 Identities = 38/105 (36%), Positives = 43/105 (40%) Frame = +2 Query: 137 PGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKF 316 PG PTL T L++ HA + SS+ S P AL G Sbjct: 4 PGWSPHGSPPTLSTLTLLLLLCGHAHSQCKILRCNAEYVSSTLSLRGGGSPGALRGGGGG 63 Query: 317 GLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDG 451 G GG GG GG RGGGGGGGG GG+GG G G Sbjct: 64 G------------GGGGGGGGGGRRGGGGGGGGAGGAGGAGGAGG 96 [170][TOP] >UniRef100_UPI0001B7C13A Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C13A Length = 4226 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 1482 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 1524 [171][TOP] >UniRef100_UPI0001B7C139 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C139 Length = 4330 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 1478 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 1520 [172][TOP] >UniRef100_UPI0001B7C138 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C138 Length = 4129 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 1478 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 1520 [173][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2294 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [174][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2324 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [175][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2294 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [176][TOP] >UniRef100_UPI00005A5D40 PREDICTED: similar to Wiskott-Aldrich syndrome protein (WASp) n=1 Tax=Canis lupus familiaris RepID=UPI00005A5D40 Length = 503 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPP----RLPPLPPNPPKLGTS 346 PP G PP+PPPPPPPPPPP P+PP PP LG S Sbjct: 384 PPPGAGGPPVPPPPPPPPPPPPPSSEEGPVPPPPPALGPS 423 [177][TOP] >UniRef100_UPI0000ECBAD6 inverted formin 2 isoform 1 n=1 Tax=Gallus gallus RepID=UPI0000ECBAD6 Length = 1049 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/93 (35%), Positives = 38/93 (40%), Gaps = 12/93 (12%) Frame = -2 Query: 504 SFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP------------LPPNPP 361 S S L + +S S PP+ P P PPPPPPPPPPP LP LPP PP Sbjct: 405 SSSQLSACFTSPQTSNPPPNAAPALPPPPPPPPPPPPPPLPSGPAAMPPTASVNLPPAPP 464 Query: 360 KLGTSTKADRADDNPNLPSLPSAEGWFTLTPLP 262 G +P P G + P P Sbjct: 465 LPGIPPPPPPLPGMAVIPPPPPLPGMAVIPPPP 497 [178][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 310 PP P PP PPPPPPPPPPP PP PP P K+ D N L Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDPKSAAKDINAEL 91 [179][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 310 PP P PP PPPPPPPPPPP PP PP P K+ D N L Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDPKSAAKDINAEL 91 [180][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 444 GCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 G P PP PPPPPPPPPPP PP PP PP Sbjct: 211 GAPVPPPPPPPPPPPPPPPPPPPPPPPP 238 [181][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/54 (46%), Positives = 28/54 (51%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 295 +PP P P PPP PPPPPPP PP PPNPP + P+ P PS Sbjct: 790 SPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPS 843 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 295 PP P PP PPPPP PPPPP PP PP+P + A PN P P+ Sbjct: 816 PPPNPPTPPSPPPPPSPPPPPSSPP-PPSPSPPPSPPPAPSPPPPPNPPPAPT 867 [182][TOP] >UniRef100_Q00X46 Chromosome 13 contig 1, DNA sequence n=1 Tax=Ostreococcus tauri RepID=Q00X46_OSTTA Length = 1990 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 310 PPS P PP P PPPP PPPP PP P PP AD+ PNL Sbjct: 819 PPSPSPSPPPPSPPPPSPPPPSPPPPSPFPPPAPPPPSPPPADECPNL 866 [183][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/56 (46%), Positives = 29/56 (51%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 289 +PP P PP PPPPPPP PPP PP PP PP +P P LP A+ Sbjct: 248 SPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPP------PPPPPSPSPPPPELPPAQ 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/55 (47%), Positives = 29/55 (52%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 289 PPS P PP PPPPPPPPPPP P PP P T A + P P P ++ Sbjct: 264 PPSPPPPPPPPPPPPPPPPPPSPSPPPPELPPAQPVTPARKRPPPPAPPPPPRSD 318 [184][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 PP P PP PPPPPPPPPPP PP PP P KL Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVKL 77 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 NP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 NPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 [185][TOP] >UniRef100_Q5CHW4 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis RepID=Q5CHW4_CRYHO Length = 1042 Score = 55.5 bits (132), Expect = 2e-06 Identities = 41/107 (38%), Positives = 53/107 (49%), Gaps = 8/107 (7%) Frame = +2 Query: 209 ASQPSSSNHAEQ---QECSSSGSGVSVNQPSALGRLGKFGLSSALSAFVLVPNFGGFG-- 373 +S PSS+ A + ++ GS S + PS G LG G SA S+ G G Sbjct: 361 SSTPSSTGSAPTGAGKVSTTGGSSSSPSAPSGTGSLGGIG-GSATSSGAGGSGSGAGGSS 419 Query: 374 ---GNGGNRGGGGGGGGGGGSGGQGQPDGGLPLPLYELAEESSDEKE 505 G GG RGGGGGGGGGGG +G+ DG EE S++K+ Sbjct: 420 GGRGGGGRRGGGGGGGGGGGRRRRGRGDG---------KEEGSEDKD 457 [186][TOP] >UniRef100_Q581D1 Flagellum-adhesion glycoprotein, putative n=1 Tax=Trypanosoma brucei RepID=Q581D1_9TRYP Length = 590 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/59 (54%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = -2 Query: 486 SSASS*SGSGNP-PSGCPCPPLPPPPPPPPPPPRLP-PLPPNPPKLGTSTKADRADDNP 316 S + S S S +P PS P PP PPPPPPPPPPP P P PP+PP+ T+ A RA P Sbjct: 354 SPSPSPSASPSPSPSVQPPPPPPPPPPPPPPPPITPNPDPPSPPR-PTAVAAFRASSFP 411 [187][TOP] >UniRef100_Q581C6 Flagellum-adhesion glycoprotein, putative n=1 Tax=Trypanosoma brucei RepID=Q581C6_9TRYP Length = 590 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/59 (54%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = -2 Query: 486 SSASS*SGSGNP-PSGCPCPPLPPPPPPPPPPPRLP-PLPPNPPKLGTSTKADRADDNP 316 S + S S S +P PS P PP PPPPPPPPPPP P P PP+PP+ T+ A RA P Sbjct: 354 SPSPSPSASPSPSPSVQPPPPPPPPPPPPPPPPITPNPDPPSPPR-PTAVAAFRASSFP 411 [188][TOP] >UniRef100_C3ZSY2 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3ZSY2_BRAFL Length = 2637 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = -2 Query: 453 PPSGCPCPPLPPPP---PPPPPPPRLPPLPPNPPKLGTST 343 P SG P PP PPPP PPPPPPP PP PP P L TST Sbjct: 711 PGSGGPPPPPPPPPGGGPPPPPPPGAPPPPPGAPLLHTST 750 [189][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 340 PP P PP PPPPPPPPPPP PP PP P +L S + Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRR 48 [190][TOP] >UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA Length = 688 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/69 (40%), Positives = 33/69 (47%), Gaps = 5/69 (7%) Frame = -2 Query: 453 PPSGCPCPPLPPPP-----PPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 289 PP+ P PP PPPP PPPPPPP+ P PP PP + K P P P+A Sbjct: 207 PPAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPPTPPPTTPPPPTAP 266 Query: 288 GWFTLTPLP 262 P+P Sbjct: 267 PPPPSVPIP 275 [191][TOP] >UniRef100_B4MPK7 GK21581 n=1 Tax=Drosophila willistoni RepID=B4MPK7_DROWI Length = 106 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGG 454 GG GG GG GGGGGGGGGGGSGGQG GG Sbjct: 12 GGQGGKGGGGGGGGGGGGGGGSGGQGGKGGG 42 [192][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPP-PPPPRLPPLPPNPP 361 PPS P PP PPPPPPP PPPP PPLPP PP Sbjct: 265 PPSLPPQPPPPPPPPPPLPPPPPPPPLPPQPP 296 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPP PPPPPPP LPP PP PP Sbjct: 269 PPQPPPPPPPPPPLPPPPPPPPLPPQPPPPP 299 [193][TOP] >UniRef100_Q9QYX7-2 Isoform 2 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-2 Length = 4833 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2294 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [194][TOP] >UniRef100_Q9QYX7-3 Isoform 3 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-3 Length = 4981 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2324 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [195][TOP] >UniRef100_Q9QYX7-4 Isoform 4 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-4 Length = 5177 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2324 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [196][TOP] >UniRef100_Q9QYX7 Protein piccolo n=1 Tax=Mus musculus RepID=PCLO_MOUSE Length = 5038 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPP-LPPNPP 361 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2294 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [197][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 55.5 bits (132), Expect = 2e-06 Identities = 35/92 (38%), Positives = 40/92 (43%), Gaps = 3/92 (3%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPP--PPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE-GW 283 PP P PP PP PPP PPPPP P PP+PP S A P P+LP + G Sbjct: 156 PPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPPPPPALPYPQCGI 215 Query: 282 FTLTPLPLLEHSCCSAWLLLEG*DAWARTTSA 187 + CCS W W TT+A Sbjct: 216 KKGGGKCIKTGECCSIW-------GWCGTTNA 240 [198][TOP] >UniRef100_UPI000194C8B0 PREDICTED: dishevelled associated activator of morphogenesis 1 isoform 3 n=1 Tax=Taeniopygia guttata RepID=UPI000194C8B0 Length = 1074 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/47 (61%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -2 Query: 483 SASS*SGSGNPPSGCPCPPLP---PPPPPPPPPPRLPPLPPNPPKLG 352 S S GS PP P PPLP PPPPPPPPPP PP PP PP LG Sbjct: 547 SPSPTPGSLLPPP--PPPPLPGVCPPPPPPPPPPGGPPPPPGPPPLG 591 [199][TOP] >UniRef100_UPI000194C8AF PREDICTED: dishevelled associated activator of morphogenesis 1 isoform 2 n=1 Tax=Taeniopygia guttata RepID=UPI000194C8AF Length = 1064 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/47 (61%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -2 Query: 483 SASS*SGSGNPPSGCPCPPLP---PPPPPPPPPPRLPPLPPNPPKLG 352 S S GS PP P PPLP PPPPPPPPPP PP PP PP LG Sbjct: 538 SPSPTPGSLLPPP--PPPPLPGVCPPPPPPPPPPGGPPPPPGPPPLG 582 [200][TOP] >UniRef100_UPI000194C8AE PREDICTED: dishevelled associated activator of morphogenesis 1 isoform 1 n=1 Tax=Taeniopygia guttata RepID=UPI000194C8AE Length = 1084 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/47 (61%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -2 Query: 483 SASS*SGSGNPPSGCPCPPLP---PPPPPPPPPPRLPPLPPNPPKLG 352 S S GS PP P PPLP PPPPPPPPPP PP PP PP LG Sbjct: 547 SPSPTPGSLLPPP--PPPPLPGVCPPPPPPPPPPGGPPPPPGPPPLG 591 [201][TOP] >UniRef100_UPI00017F09BE PREDICTED: similar to KIAA1902 protein, partial n=1 Tax=Sus scrofa RepID=UPI00017F09BE Length = 734 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/52 (51%), Positives = 30/52 (57%) Frame = -2 Query: 447 SGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 292 +G PP+PPPPPPPPPPP PP PP PP G + A P P PSA Sbjct: 253 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAADTVPAPPLPP-PPPPSA 303 [202][TOP] >UniRef100_UPI000176023F PREDICTED: similar to protein kinase beta like (3E511) n=1 Tax=Danio rerio RepID=UPI000176023F Length = 639 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = -2 Query: 489 DSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 ++ SS S SG P P PP PPP PPPPPPP PP PP PP Sbjct: 335 EARTSSDSASGPSPGTAP-PPAPPPQPPPPPPPPPPPPPPPPP 376 [203][TOP] >UniRef100_UPI0000F2B170 PREDICTED: similar to hCG2004723, n=1 Tax=Monodelphis domestica RepID=UPI0000F2B170 Length = 803 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/55 (47%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = -2 Query: 459 GNPPSGCPCP----PLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 307 G+PP P P PPPPPPPPPP PP PP PP L + + DD+ LP Sbjct: 629 GDPPHPEPSKELNLPPAPPPPPPPPPPPPPPPPPLPPHLSSHLRTPEKDDDQPLP 683 [204][TOP] >UniRef100_UPI0000F2AE0C PREDICTED: similar to hCG1781691 n=1 Tax=Monodelphis domestica RepID=UPI0000F2AE0C Length = 358 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -2 Query: 462 SGNPPSGCPC--PPLPPPPPPPPPPPRLPPLPPNPPK 358 SG P P PP PPPPPPPPPPP PP PP PPK Sbjct: 4 SGQEPCSNPSTQPPQPPPPPPPPPPPPPPPPPPPPPK 40 [205][TOP] >UniRef100_UPI0000E1F764 PREDICTED: formin-like 2 isoform 6 n=1 Tax=Pan troglodytes RepID=UPI0000E1F764 Length = 1032 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -2 Query: 468 SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 340 +G PP P PP PPPPPPPPPPP PPLP + G S K Sbjct: 513 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETGPSVK 555 [206][TOP] >UniRef100_UPI0000DA2269 PREDICTED: similar to Formin-1 isoform IV (Limb deformity protein) n=1 Tax=Rattus norvegicus RepID=UPI0000DA2269 Length = 1085 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = -2 Query: 438 PCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL-PSLPSAEGWFT 277 P PP PPPPPPPPPPP L P PP G S+ + + P + PS P ++T Sbjct: 648 PAPPTPPPPPPPPPPPGLAPPPPPGLSFGLSSSSSQCPRKPAIEPSCPMKPLYWT 702 [207][TOP] >UniRef100_UPI0000DA1CBA PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA1CBA Length = 200 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGG 454 GG GG+GG GGGGGGGGGGG GG+G DGG Sbjct: 91 GGGGGDGGGGGGGGGGGGGGGDGGRGGGDGG 121 [208][TOP] >UniRef100_UPI00004296C7 SET binding protein 1 n=2 Tax=Mus musculus RepID=UPI00004296C7 Length = 1582 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 32/57 (56%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTLTPLP 262 PPLPPPPPPP PPP PP PP PP L + + + P P+ P+ T PLP Sbjct: 1509 PPLPPPPPPPLPPP--PPPPPPPPPLPKTARGGKRKHRPQPPAQPAQP---TPQPLP 1560 [209][TOP] >UniRef100_UPI000024DCC5 zinc finger homeodomain 4 n=1 Tax=Mus musculus RepID=UPI000024DCC5 Length = 3581 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSL 301 PP PPPPPPPPPPP PP PP PP + + D P PS+ Sbjct: 2009 PPTPPPPPPPPPPPPPPPPPPPPPSAPQQVQLPVSLDLPLFPSI 2052 [210][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA 328 +PP P PP PPPP PPP PP PP PP PP L T DRA Sbjct: 1251 SPPPPTPPPPAPPPPTPPPSPP--PPTPPPPPPLAPFTCEDRA 1291 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/65 (46%), Positives = 30/65 (46%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 274 PPS P PP P PPPP PPPP PP PP P T NP PS P Sbjct: 773 PPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP-------- 824 Query: 273 TPLPL 259 PLPL Sbjct: 825 PPLPL 829 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/65 (46%), Positives = 30/65 (46%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 274 PPS P PP P PPPP PPPP PP PP P T NP PS P Sbjct: 864 PPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP-------- 915 Query: 273 TPLPL 259 PLPL Sbjct: 916 PPLPL 920 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/65 (46%), Positives = 30/65 (46%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 274 PPS P PP P PPPP PPPP PP PP P T NP PS P Sbjct: 1042 PPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP-------- 1093 Query: 273 TPLPL 259 PLPL Sbjct: 1094 PPLPL 1098 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 PPS P PP P PPPP PPPP PP PP P T NP PS P Sbjct: 1133 PPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 1184 Score = 53.5 bits (127), Expect = 8e-06 Identities = 27/65 (41%), Positives = 28/65 (43%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFT 277 +PP P PP PPPP PPP PP PP P PP P LP PS Sbjct: 1139 SPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLP 1198 Query: 276 LTPLP 262 PLP Sbjct: 1199 PPPLP 1203 [211][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S P P PP PPPPPPPPPPP PP PP PP Sbjct: 54 SAAPAQARPTPPPPPPPPPPPPPPPPPPPPPPPP 87 [212][TOP] >UniRef100_Q7XHB6 Transposon protein, putative, CACTA, En/Spm sub-class n=2 Tax=Oryza sativa RepID=Q7XHB6_ORYSJ Length = 773 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/66 (42%), Positives = 31/66 (46%), Gaps = 19/66 (28%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPP---------PPPPPRLPPLPPNPPKLGT----------STKADR 331 PP P PP PPPPPP PPPPP PP PP PPK + +TK D+ Sbjct: 432 PPPPAPSPPAPPPPPPPPAPSPPAPPPPPPPPPPCPPAPPKTRSRQAPPPASTRATKKDK 491 Query: 330 ADDNPN 313 D N Sbjct: 492 VDTTKN 497 [213][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPP PPPPPPR PP PP PP Sbjct: 435 PPPPPPPPPPPPPPTPPPPPPRPPPPPPPPP 465 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/45 (53%), Positives = 26/45 (57%) Frame = -2 Query: 495 SLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +L S + S PP P PP PPPPP PPPPP PP PP PP Sbjct: 420 NLQRSETEIFASTPPPPPPPPPPPPPPPPTPPPPPPRPPPPPPPP 464 [214][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/53 (47%), Positives = 27/53 (50%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 +PP P PP PPPPPPP PPP PP PP PP + P PS P Sbjct: 417 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 469 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +PP P PP PPPPPPP PPP PP PP PP Sbjct: 262 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +PP P PP PPPPPPP PPP PP PP PP Sbjct: 319 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +PP P PP PPPPPPP PPP PP PP PP Sbjct: 363 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +PP P PP PPPPPPP PPP PP PP PP Sbjct: 477 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 508 [215][TOP] >UniRef100_B9SMV7 Vegetative cell wall protein gp1, putative n=1 Tax=Ricinus communis RepID=B9SMV7_RICCO Length = 479 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 +PP CP PP PPPP PPPP P PPL P+PP Sbjct: 200 SPPPPCPPPPSPPPPSPPPPSPPPPPLVPSPP 231 [216][TOP] >UniRef100_B9HE50 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HE50_POPTR Length = 604 Score = 55.1 bits (131), Expect = 3e-06 Identities = 30/68 (44%), Positives = 35/68 (51%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 274 PP P PP PP PPPPPPPP P PP PPK+G + P +P ++G L Sbjct: 352 PPGRTPAPP-PPRPPPPPPPPVAAPRPPVPPKVGRA------------PPVPPSKG--KL 396 Query: 273 TPLPLLEH 250 P PL H Sbjct: 397 KPSPLGPH 404 [217][TOP] >UniRef100_A9TWI4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWI4_PHYPA Length = 818 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PP P PP PPPP PPPPPP PP PP+PP Sbjct: 487 PPPSPPPPPSPPPPSPPPPPPSPPPPPPSPP 517 [218][TOP] >UniRef100_Q7Q751 AGAP005505-PA n=1 Tax=Anopheles gambiae RepID=Q7Q751_ANOGA Length = 511 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 356 NFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDGG 454 NFGGF G GG GGGGGGGGGGG GG G GG Sbjct: 222 NFGGFVGGGGGGGGGGGGGGGGGGGGGGGGAGG 254 [219][TOP] >UniRef100_Q5CKJ5 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis RepID=Q5CKJ5_CRYHO Length = 996 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/55 (52%), Positives = 33/55 (60%), Gaps = 6/55 (10%) Frame = -2 Query: 456 NPPSGCPCPPLPPPPPPPPPPPRLPP----LPPNP--PKLGTSTKADRADDNPNL 310 +PP P PP PPPPPPPPPPP LPP LPP P P G S +D ++P L Sbjct: 408 SPP---PPPPPPPPPPPPPPPPPLPPSQHLLPPPPPLPLSGDSKVSDMQKEDPTL 459 [220][TOP] >UniRef100_C4QFT9 Diaphanous, putative n=1 Tax=Schistosoma mansoni RepID=C4QFT9_SCHMA Length = 1068 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/49 (51%), Positives = 29/49 (59%) Frame = -2 Query: 495 SLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGT 349 SL SS G PP PP PPPPPPPPPPP + +PP PP +G+ Sbjct: 485 SLSSSIPPPPGIPPPPPMEGVPPPPPPPPPPPPPPPMGGIPPPPPPMGS 533 [221][TOP] >UniRef100_B7QNG2 Glycine-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QNG2_IXOSC Length = 138 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/51 (54%), Positives = 29/51 (56%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLPLPLYELAEESSDEKEKQQ 514 GG GG GG GGGGGGGGGGG GG G P LP P A S +QQ Sbjct: 23 GGGGGGGGGGGGGGGGGGGGGGGGGGAPWCDLPQPGDTAAWPSKTSSAEQQ 73 [222][TOP] >UniRef100_A9URR1 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9URR1_MONBE Length = 363 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/49 (53%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = -2 Query: 453 PPSGCPCPPLPPPP-----PPPPPPPRLPPLPPNPPKLGTSTKADRADD 322 PPSG PP PPPP PPPPPPP P PP PP T+T DD Sbjct: 202 PPSGAAPPPPPPPPAGGPPPPPPPPPAGAPPPPAPPPAATATPTLAVDD 250 [223][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S P +G PP PPPPPPPPPPP PP PP PP Sbjct: 831 SAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPP 864 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/47 (51%), Positives = 25/47 (53%) Frame = -2 Query: 438 PCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 P PP PPPPPPPPPPP PP PP PP + P LP P Sbjct: 841 PPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 887 [224][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S P +G PP PPPPPPPPPPP PP PP PP Sbjct: 909 SAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/47 (51%), Positives = 25/47 (53%) Frame = -2 Query: 438 PCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 P PP PPPPPPPPPPP PP PP PP + P LP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 [225][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -2 Query: 462 SGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 S P +G PP PPPPPPPPPPP PP PP PP Sbjct: 909 SAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/47 (51%), Positives = 25/47 (53%) Frame = -2 Query: 438 PCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 298 P PP PPPPPPPPPPP PP PP PP + P LP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 [226][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 55.1 bits (131), Expect = 3e-06 Identities = 35/94 (37%), Positives = 41/94 (43%) Frame = -2 Query: 444 GCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTLTPL 265 G P PP PPPPPPPPPPP PP PP PP T + P PS T + + Sbjct: 142 GEPAPPPPPPPPPPPPPPPPPPPPPPPPPT-TLEPPPPPPTSSEPPPPPSTSATPTSSAV 200 Query: 264 PLLEHSCCSAWLLLEG*DAWARTTSAVRAVRSVG 163 P A L G A R T++ +VG Sbjct: 201 PSSSVVPSEASSTLSGSGASLRPTASATPSPAVG 234 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/62 (41%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = -2 Query: 465 GSGNPPSGCPCPPLPPPPPPPPPPPRLPPL----PPNPPKLGTSTKADRADDNPNLPSLP 298 G PP P PP PPPPPPPPPPP PP PP PP P ++P Sbjct: 142 GEPAPPPPPPPPPPPPPPPPPPPPPPPPPTTLEPPPPPPTSSEPPPPPSTSATPTSSAVP 201 Query: 297 SA 292 S+ Sbjct: 202 SS 203 [227][TOP] >UniRef100_Q9Z180 SET-binding protein n=1 Tax=Mus musculus RepID=SETBP_MOUSE Length = 1535 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 32/57 (56%) Frame = -2 Query: 432 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTLTPLP 262 PPLPPPPPPP PPP PP PP PP L + + + P P+ P+ T PLP Sbjct: 1462 PPLPPPPPPPLPPP--PPPPPPPPPLPKTARGGKRKHRPQPPAQPAQP---TPQPLP 1513 [228][TOP] >UniRef100_Q8R4U1 Myb-related transcription factor, partner of profilin n=1 Tax=Mus musculus RepID=MYPOP_MOUSE Length = 393 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 444 GCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 355 G P PLPPPPPPPPPPP P LPP+ PK+ Sbjct: 294 GTPADPLPPPPPPPPPPPPKPVLPPSAPKV 323 [229][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 54.7 bits (130), Expect = 4e-06 Identities = 34/77 (44%), Positives = 38/77 (49%), Gaps = 9/77 (11%) Frame = -2 Query: 501 FSSLDSSASS*SGSG--------NPPSGCPCPPLPPPPPPPPPP-PRLPPLPPNPPKLGT 349 FSS S++ S S G PPS P PP PPPPPPPPP P+ P PP PP Sbjct: 673 FSSSSSTSRSSSSHGVPPPHPPPPPPSLAPKPPSAPPPPPPPPPAPKPPGAPPPPPPPPP 732 Query: 348 STKADRADDNPNLPSLP 298 +TK A P P P Sbjct: 733 TTKPLGAHPPPPPPPPP 749 [230][TOP] >UniRef100_UPI0001796833 PREDICTED: similar to Vasodilator-stimulated phosphoprotein (VASP) n=1 Tax=Equus caballus RepID=UPI0001796833 Length = 441 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/61 (44%), Positives = 33/61 (54%) Frame = -2 Query: 468 SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 289 S +G PP+ P PPPPP PPPPP PP P PP G++ P P LP+A+ Sbjct: 218 SNAGGPPT--PLAGGPPPPPGPPPPPGPPPPPGLPPSGGSTAGHGAGGGPPPAPPLPTAQ 275 Query: 288 G 286 G Sbjct: 276 G 276 [231][TOP] >UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI000155382B Length = 492 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGG 454 GG GG+GG RGGGGGGGGGGG GG G GG Sbjct: 220 GGGGGDGGGRGGGGGGGGGGGGGGDGGGGGG 250 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGG 454 GG GG GG RGGGGGGGGGGG GG G GG Sbjct: 201 GGGGGGGGGRGGGGGGGGGGGGGGDGGGRGG 231 [232][TOP] >UniRef100_UPI0000F2E472 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2E472 Length = 551 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPP 361 PPS P PPPPPPPPPPP + PLPP PP Sbjct: 417 PPSPAAPSPPPPPPPPPPPPPHMSPLPPPPP 447 [233][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 F SSLD SA PP P PP PPPPPPPPPPP PP P P Sbjct: 2332 FRSSSLDISAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 2373 [234][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 F SSLD SA PP P PP PPPPPPPPPPP PP P P Sbjct: 1270 FRSSSLDISAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 1311 [235][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 F SSLD SA PP P PP PPPPPPPPPPP PP P P Sbjct: 2332 FRSSSLDISAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 2373 [236][TOP] >UniRef100_UPI0000E2427E PREDICTED: guanine nucleotide binding protein, alpha activating polypeptide O n=1 Tax=Pan troglodytes RepID=UPI0000E2427E Length = 537 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/56 (46%), Positives = 29/56 (51%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 286 PP+ P P PPPPPPPPPPP PP PP PP + P LP P + G Sbjct: 113 PPNSLPPHPAPPPPPPPPPPP--PPPPPPPPAAAAA--------GPTLPPTPPSVG 158 [237][TOP] >UniRef100_UPI0000E12BCF Os07g0596300 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E12BCF Length = 754 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 8/41 (19%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPP--------PRLPPLPPNPPKL 355 P SG PCPP PPPPPPPPPP PP PP PP L Sbjct: 71 PSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLL 111 [238][TOP] >UniRef100_UPI0000DA45DC PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA45DC Length = 92 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/46 (58%), Positives = 27/46 (58%) Frame = +2 Query: 317 GLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDGG 454 GL S LS GG GG GG GGGGGGGGGGG GG G GG Sbjct: 16 GLESELSDSTACGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61 [239][TOP] >UniRef100_UPI0000DA3D7B PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3D7B Length = 211 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGG 454 GG GG GG GGGGGGGGGGG GG G+ DGG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGRGDGG 171 [240][TOP] >UniRef100_UPI0000DA32FB PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA32FB Length = 236 Score = 54.7 bits (130), Expect = 4e-06 Identities = 31/78 (39%), Positives = 37/78 (47%) Frame = +2 Query: 221 SSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGG 400 + +N A+ + SS GV +G G+ G GG GG GG GGG Sbjct: 51 ADANAAKPMKISSDKGGVGGGVGGGVGGRGRVG--------------GGGGGGGGGGGGG 96 Query: 401 GGGGGGGGSGGQGQPDGG 454 GGGGGGGG GG G GG Sbjct: 97 GGGGGGGGGGGGGGGGGG 114 [241][TOP] >UniRef100_UPI0000D9F166 PREDICTED: similar to guanine nucleotide binding protein, alpha activating polypeptide O n=1 Tax=Macaca mulatta RepID=UPI0000D9F166 Length = 571 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/56 (46%), Positives = 29/56 (51%) Frame = -2 Query: 453 PPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 286 PP+ P P PPPPPPPPPPP PP PP PP + P LP P + G Sbjct: 147 PPNSLPPHPAPPPPPPPPPPP--PPPPPPPPAAAAA--------GPTLPPTPPSVG 192 [242][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/48 (54%), Positives = 28/48 (58%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 F SS+D+SA PP P PP PPPPPPPPPPP PP P P Sbjct: 2335 FRSSSVDASAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 2376 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = -2 Query: 480 ASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPK 358 +SS S PP P PP PPPPPPPPPPP LP PP PK Sbjct: 2337 SSSVDASAQPPPPPPPPPPPPPPPPPPPPPPLP--PPTSPK 2375 [243][TOP] >UniRef100_UPI0001A2D80C UPI0001A2D80C related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D80C Length = 815 Score = 54.7 bits (130), Expect = 4e-06 Identities = 34/73 (46%), Positives = 37/73 (50%) Frame = -2 Query: 489 DSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 310 DSS S+ S P+G P LPPPPPPPPPPP PP PP PP G S + P Sbjct: 263 DSSVSTVSLFPPVPNG-PSAALPPPPPPPPPPP--PPPPPPPPPPGHSIEISAPLPPPPP 319 Query: 309 PSLPSAEGWFTLT 271 P P G T T Sbjct: 320 PCAPPLPGSGTPT 332 [244][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 F SSLD SA PP P PP PPPPPPPPPPP PP P P Sbjct: 2394 FRSSSLDISAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 2435 [245][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -2 Query: 507 FSFSSLDSSASS*SGSGNPPSGCPCPPLPPPPPPPPPPPRLPPLPPNP 364 F SSLD SA PP P PP PPPPPPPPPPP PP P P Sbjct: 2394 FRSSSLDISAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 2435 [246][TOP] >UniRef100_UPI00016E37F5 UPI00016E37F5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F5 Length = 399 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLP 460 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 392 [247][TOP] >UniRef100_UPI00016E37F4 UPI00016E37F4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F4 Length = 421 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLP 460 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 362 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 394 [248][TOP] >UniRef100_UPI00016E37F3 UPI00016E37F3 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F3 Length = 418 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLP 460 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 357 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 389 [249][TOP] >UniRef100_UPI00016E37F2 UPI00016E37F2 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F2 Length = 397 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLP 460 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 336 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 368 [250][TOP] >UniRef100_UPI00016E37F1 UPI00016E37F1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F1 Length = 401 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 362 GGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLP 460 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 339 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 371