[UP]
[1][TOP] >UniRef100_A8IZS5 Glycine-rich RNA-binding protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8IZS5_CHLRE Length = 165 Score = 69.7 bits (169), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGGYGGGRGGGGYGGGGSGGYGGGGYG Sbjct: 119 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 146 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG G GGYGGGG GG GGGGYG G Sbjct: 128 GGGGYGGG-GSGGYGGGGYGGNGGGGYGAGGGG 159 [2][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/67 (46%), Positives = 35/67 (52%), Gaps = 5/67 (7%) Frame = -1 Query: 370 CTRPKTQH-----QADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*P 206 CT KT H QA + +P+ P PPPP PP PPPP PPPP PPP P Sbjct: 16 CTNAKTLHDTIKRQAGCAAPCPAVCAPACQPICCVPAPPPPPPPPPPPPPPPPPPPPPPP 75 Query: 205 PPPTHKQ 185 PPP +Q Sbjct: 76 PPPPPQQ 82 [3][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFR 167 P PPPP PP PPPP PPPP PPP PPPP H+ MS R Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRR 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 [4][TOP] >UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XP48_SORBI Length = 109 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG GGYGGGG G G Sbjct: 41 GGGGYGGGGGGGGYGGGGGGGYGGGGGGGRGGG 73 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG GG GGGG G G Sbjct: 50 GGGGYGGG-GGGGYGGGGGGGRGGGGGGFGGGG 81 [5][TOP] >UniRef100_A3PA60 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9301 RepID=A3PA60_PROM0 Length = 217 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG--GSGGYGGGGYGEANTGSADS 308 GGGGYGGG GGGYGGG G GGYGGGGYG G +S Sbjct: 118 GGGGYGGGNSGGGYGGGGYGGGGYGGGGYGGGGYGGGNS 156 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 6/38 (15%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGG------SGGYGGGGYGEANTG 296 GGGYGGG GGGYGGGG GGYGGGGYG N+G Sbjct: 91 GGGYGGGNSGGGYGGGGYGGGNSGGGYGGGGYGGGNSG 128 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 6/39 (15%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGG------SGGYGGGGYGEANTG 296 GGGGYGGG GGGYGGGG GGYGGGGYG G Sbjct: 104 GGGGYGGGNSGGGYGGGGYGGGNSGGGYGGGGYGGGGYG 142 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 12/44 (27%) Frame = +3 Query: 201 GGGYGG----------GRGGGGYGGG--GSGGYGGGGYGEANTG 296 GGGYGG G GGGGYGGG G GGYGGGGYG N+G Sbjct: 114 GGGYGGGGYGGGNSGGGYGGGGYGGGGYGGGGYGGGGYGGGNSG 157 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +3 Query: 198 GGGGYGGGR-GGGGYGGGG-SGGYGGGGYGEANTGSADS 308 GGGGYGGG GGGGYGGGG GG GGGYG N+ S S Sbjct: 132 GGGGYGGGGYGGGGYGGGGYGGGNSGGGYGGGNSESNSS 170 [6][TOP] >UniRef100_Q6ASX7 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ASX7_ORYSJ Length = 162 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 8/41 (19%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY--------GGGGYGEANTG 296 GGGGYGGGRGGGGYGGGG GGY GGGGYG G Sbjct: 99 GGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGG 139 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGG--GGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GG GG GGGG GG GGGGYG G Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGG 126 [7][TOP] >UniRef100_O22384 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22384_ORYSA Length = 162 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 8/41 (19%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY--------GGGGYGEANTG 296 GGGGYGGGRGGGGYGGGG GGY GGGGYG G Sbjct: 99 GGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGG 139 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGG--GGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GG GG GGGG GG GGGGYG G Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGG 126 [8][TOP] >UniRef100_A2XDP2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XDP2_ORYSI Length = 820 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/69 (44%), Positives = 37/69 (53%), Gaps = 7/69 (10%) Frame = -1 Query: 367 TRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPR-------PPP* 209 T P+T+ T +K+ S PV S PPPP PP PPPP PPPP+ PPP Sbjct: 318 TPPRTRFSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPP 377 Query: 208 PPPPTHKQN 182 PPPP+ N Sbjct: 378 PPPPSVPSN 386 [9][TOP] >UniRef100_Q10Q99 Formin-like protein 8 n=1 Tax=Oryza sativa Japonica Group RepID=FH8_ORYSJ Length = 892 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/69 (44%), Positives = 37/69 (53%), Gaps = 7/69 (10%) Frame = -1 Query: 367 TRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPR-------PPP* 209 T P+T+ T +K+ S PV S PPPP PP PPPP PPPP+ PPP Sbjct: 318 TPPRTRFSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPP 377 Query: 208 PPPPTHKQN 182 PPPP+ N Sbjct: 378 PPPPSVPSN 386 [10][TOP] >UniRef100_B9Q6L7 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii VEG RepID=B9Q6L7_TOXGO Length = 510 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = +3 Query: 198 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG G GGYGGGG+GGYGGGGYG N G Sbjct: 317 GGGGYGGGGYGGGNGGYGGGGNGGYGGGGYGGGNGG 352 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/47 (61%), Positives = 30/47 (63%), Gaps = 5/47 (10%) Frame = +3 Query: 198 GGGGYGGGR--GGGGYGGGGS---GGYGGGGYGEANTGSADSCNARF 323 GGGGYGGG GGGGYGGGG GGYGGGGYG N G N + Sbjct: 295 GGGGYGGGGYGGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGY 341 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 6/45 (13%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG---GSGGY-GGGGYGEA--NTGSADSCN 314 GGGGYGG GGGGYGGG GSGGY GGGGY A + G D+ N Sbjct: 363 GGGGYGGYGGGGGYGGGGGFGSGGYGGGGGYSPAGPHHGGMDTAN 407 [11][TOP] >UniRef100_B9PW07 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii GT1 RepID=B9PW07_TOXGO Length = 508 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = +3 Query: 198 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG G GGYGGGG+GGYGGGGYG N G Sbjct: 315 GGGGYGGGGYGGGNGGYGGGGNGGYGGGGYGGGNGG 350 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARF 323 GGGGYGGG G GG GG G GGYGGGGYG N G N + Sbjct: 298 GGGGYGGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGY 339 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 6/45 (13%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG---GSGGY-GGGGYGEA--NTGSADSCN 314 GGGGYGG GGGGYGGG GSGGY GGGGY A + G D+ N Sbjct: 361 GGGGYGGYGGGGGYGGGGGFGSGGYGGGGGYSPAGPHHGGMDTAN 405 [12][TOP] >UniRef100_B6KME4 RRM domain-containing protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KME4_TOXGO Length = 513 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = +3 Query: 198 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG G GGYGGGG+GGYGGGGYG N G Sbjct: 319 GGGGYGGGGYGGGNGGYGGGGNGGYGGGGYGGGNGG 354 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/46 (63%), Positives = 30/46 (65%), Gaps = 4/46 (8%) Frame = +3 Query: 198 GGGGYGGGR-GGGGYGGGGS---GGYGGGGYGEANTGSADSCNARF 323 GGGGYGGG GGGGYGGGG GGYGGGGYG N G N + Sbjct: 298 GGGGYGGGGYGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGY 343 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 6/45 (13%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG---GSGGY-GGGGYGEA--NTGSADSCN 314 GGGGYGG GGGGYGGG GSGGY GGGGY A + GS D+ N Sbjct: 366 GGGGYGGYGGGGGYGGGGGFGSGGYGGGGGYSPAGPHHGSMDTAN 410 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGG G GGYGGGG GGYGGGG G G Sbjct: 344 GGGGYGG--GNGGYGGGGGGGYGGGGGGYGGYG 374 [13][TOP] >UniRef100_A6RXS7 Putative uncharacterized protein n=1 Tax=Botryotinia fuckeliana B05.10 RepID=A6RXS7_BOTFB Length = 197 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 329 GGGG+GGGRGGGGYGG G GGYGGGG G D+ N+ Y Sbjct: 97 GGGGFGGGRGGGGYGGRGGGGYGGGGGGYGGGRGYDNNNSGGGY 140 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/34 (70%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY-GGGGYGEANTG 296 GGGGY GG GGGGY GGG GGY GGGGY +G Sbjct: 154 GGGGYNGGGGGGGYSGGGGGGYSGGGGYDRNQSG 187 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGG-GYGEANTGSADS 308 GGGGYGG RGGGGYGGGG GGYGGG GY N+G S Sbjct: 106 GGGGYGG-RGGGGYGGGG-GGYGGGRGYDNNNSGGGYS 141 [14][TOP] >UniRef100_B8AP37 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AP37_ORYSI Length = 139 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYG--GGGYGEANTGS 299 GGGGYGGGRGGGGYGGGG GGYG GGYG + G+ Sbjct: 101 GGGGYGGGRGGGGYGGGGGGGYGRREGGYGGDSGGN 136 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGG--GGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GG GG GGGG GG GGGGYG G Sbjct: 94 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGG 128 [15][TOP] >UniRef100_C0SUH3 Ecdysone receptor B1 isoform n=1 Tax=Apis mellifera RepID=C0SUH3_APIME Length = 557 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 320 GGGG GGG GGGG GGGG GG GGGG G G +D C+AR Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGCDAR 163 [16][TOP] >UniRef100_C0SUE0 Ecdysone receptor A isoform n=1 Tax=Apis mellifera RepID=C0SUE0_APIME Length = 629 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 320 GGGG GGG GGGG GGGG GG GGGG G G +D C+AR Sbjct: 195 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGCDAR 235 [17][TOP] >UniRef100_B4IZJ4 GH14508 n=1 Tax=Drosophila grimshawi RepID=B4IZJ4_DROGR Length = 272 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 3/36 (8%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGG---GYGEANTG 296 GGGGYGGG GGGGYGGGG GGYGGG GYG G Sbjct: 72 GGGGYGGGGGGGGYGGGGGGGYGGGGDSGYGGGGGG 107 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSA 302 GGGGYGGG GGGGYGGGG GYGGGG G G + Sbjct: 81 GGGGYGGG-GGGGYGGGGDSGYGGGGGGGYGGGDS 114 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADS 308 GGGGYGGG GGGGYGGGG G GGG G + GS S Sbjct: 152 GGGGYGGGGGGGGYGGGGGYGGGGGSAGWSAGGSGSS 188 [18][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -1 Query: 307 ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 +SA P A P PPPP PP PPPP PPPP PPP PPPP K Sbjct: 53 QSAAPAQARPTPPPPPPPPPPPPPPPPPPPPP-PPPPAAK 91 [19][TOP] >UniRef100_A1TWH4 RNP-1-like RNA-binding protein n=1 Tax=Acidovorax citrulli AAC00-1 RepID=A1TWH4_ACIAC Length = 176 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 6/41 (14%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY------GGGGYGEANTGSA 302 GGGGYGGGR GGGYGGGG GGY GGGGYG G + Sbjct: 97 GGGGYGGGRSGGGYGGGGGGGYGGGRGDGGGGYGGGRGGDS 137 [20][TOP] >UniRef100_B9R282 'Cold-shock' DNA-binding domain protein n=1 Tax=Labrenzia alexandrii DFL-11 RepID=B9R282_9RHOB Length = 307 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSAD 305 GGGG GGGR GGGYGGGG GGYGGGG E G D Sbjct: 130 GGGGGGGGRDGGGYGGGGRGGYGGGGSREGGYGGGD 165 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSAD 305 G GG GGGR GGGYGGGG GGYGGGG E G D Sbjct: 90 GYGGGGGGRDGGGYGGGGRGGYGGGGGREGGYGGGD 125 [21][TOP] >UniRef100_Q8LPA7 Cold shock protein-1 n=1 Tax=Triticum aestivum RepID=Q8LPA7_WHEAT Length = 229 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSC 311 GGGGYGGG GGGGYGGGG GGYGGGG G G C Sbjct: 96 GGGGYGGGGGGGGYGGGG-GGYGGGGGGYGGGGGGRGC 132 [22][TOP] >UniRef100_Q10FE7 Os03g0670700 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10FE7_ORYSJ Length = 196 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/48 (60%), Positives = 32/48 (66%), Gaps = 3/48 (6%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYG--GGGYG-EANTGSADSCNARFDYW 332 GGGGYGGGRGGGGYGGGG GGYG GGY A T + + D+W Sbjct: 99 GGGGYGGGRGGGGYGGGGGGGYGRREGGYAVAAATAATPAGTGGTDWW 146 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 2/37 (5%) Frame = +3 Query: 198 GGGGYGGGRGG--GGYGGGGSGGYGGGGYGEANTGSA 302 GGGGYGGG GG GG GGGG GG GGGGYG G A Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGYA 128 [23][TOP] >UniRef100_C4XVF6 MIP10548p (Fragment) n=1 Tax=Drosophila melanogaster RepID=C4XVF6_DROME Length = 162 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/53 (56%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Frame = +3 Query: 141 CASALQRVFR--NADMFCLCVGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANT 293 C AL + NA + L GGGG GGG GGGYGGG GGYGGGGYG +T Sbjct: 19 CLLALTAILATANAGLLSLLKGGGGGGGGGYGGGYGGGYGGGYGGGGYGGEST 71 [24][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/60 (46%), Positives = 32/60 (53%), Gaps = 8/60 (13%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK--------QNMSAFRNTRCKALAQHCLEH 125 P PPPP PP PPPP PPPP PPP PPPPT + Q++ R R + C H Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTQEDLAGGNAPQHLRTRRRRRSRGRRSRCETH 62 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMS 176 P PPPP PP PPPP PPPP PPP PPPP +++++ Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTQEDLA 36 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/74 (37%), Positives = 36/74 (48%), Gaps = 17/74 (22%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP-----------------THKQNMSAFRNTRCK 152 P PPPP PP PPPP PPPP PPP PPPP T ++ S R +RC+ Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTQEDLAGGNAPQHLRTRRRRRSRGRRSRCE 60 Query: 151 ALAQHCLEHALGSL 110 Q + + ++ Sbjct: 61 THTQRARSYPVDNV 74 [25][TOP] >UniRef100_Q9XUW5 Protein F58E10.3a, confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=Q9XUW5_CAEEL Length = 561 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGY GGRGGG YGGGG GGYGGGGYG G Sbjct: 32 GGGGYSGGRGGG-YGGGGGGGYGGGGYGGGGRG 63 [26][TOP] >UniRef100_Q9VNN3 CG15597 n=1 Tax=Drosophila melanogaster RepID=Q9VNN3_DROME Length = 171 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +3 Query: 171 NADMFCLCVGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANT 293 NA + L GGGG GGG GGGYGGG GGYGGGGYG +T Sbjct: 40 NAGLLSLLKGGGGGGGGGYGGGYGGGYGGGYGGGGYGGEST 80 [27][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = -1 Query: 319 RALQESAEPVLASP*PPPP*P-PLPPPP*PPPPRPPP*PPPPTHKQNMSA 173 +A +A +A+P PPPP P P PPPP PPPP PPP PPPP H N+++ Sbjct: 2787 QAAAAAAISAVATPPPPPPPPTPPPPPPPPPPPPPPPPPPPPQHSINVTS 2836 [28][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -1 Query: 289 LASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +ASP PPPP PP PPPP PPPP PPP PPPP Sbjct: 220 VASPSPPPPPPPPPPPPPPPPPSPPPPPPPP 250 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -1 Query: 301 AEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 221 ASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPS 261 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/72 (40%), Positives = 33/72 (45%) Frame = -1 Query: 412 TNTRGIGKKTFAATCTRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*P 233 T G G TF + P + R + + P P PPPP PP P PP P Sbjct: 194 TGVTGPGGPTFPTPVSAPPPPFR-------DRPVASPSPPPPPPPPPPPPPPPPPSPPPP 246 Query: 232 PPPRPPP*PPPP 197 PPP PPP PPPP Sbjct: 247 PPPPPPPPPPPP 258 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQN 182 P PPPP PP PPPP PPPP PPP P PP N Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPN 268 [29][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 P PPPP PP PPPP PPPP PPP PPP THK Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPSTHK 533 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMS 176 P PPPP PP PPPP PPPP PPP PPPP+ ++MS Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMS 536 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -1 Query: 289 LASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 L+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 486 LSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 487 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 [30][TOP] >UniRef100_C5CSB2 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CSB2_VARPS Length = 181 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG GGYGGGG G + G Sbjct: 97 GGGGYGGG-GGGGYGGGGGGGYGGGGGGRSGGG 128 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGGYGGG GGGYGGGG GGYGGGG G Sbjct: 90 GGGGYGGG--GGGYGGGGGGGYGGGGGG 115 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/39 (66%), Positives = 27/39 (69%), Gaps = 6/39 (15%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGG------GGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGG GG GGYGGGG G + G Sbjct: 105 GGGGYGGG-GGGGYGGGGGGRSGGGGGYGGGGGGRSGGG 142 [31][TOP] >UniRef100_A7EC48 Glycine-rich RNA-binding protein n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7EC48_SCLS1 Length = 193 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGG+GGGRGGGGYGG G GGYGGGG G Sbjct: 96 GGGGFGGGRGGGGYGGRGGGGYGGGGGG 123 [32][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/58 (48%), Positives = 34/58 (58%) Frame = -1 Query: 370 CTRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 C +P Q + S+ +L + P + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 397 CCKPLPQFYSQ----SQPSLPFAPLPQIQPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/65 (40%), Positives = 35/65 (53%) Frame = -1 Query: 346 QADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFR 167 Q D +Q + + + +S PPPP PP PPPP PPPP PPP P PP + + + Sbjct: 122 QIDPSQYIEMMANQMQQQTQSSQTPPPPPPPPPPPPPPPPPPPPPPPKPPKTQHVLKKVQ 181 Query: 166 NTRCK 152 N + K Sbjct: 182 NLKPK 186 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPP 197 PPPP PP PPPP PPPP PPP PPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/40 (60%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PP---PPTHKQNMSAF 170 P PPPP PP PPPP PPPP PPP PP PP ++S+F Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPLLPPPPPPSISSF 464 [33][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 EP P PPPP PP PPPP PPPP PPP PPPP Sbjct: 850 EPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 883 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -1 Query: 310 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +E P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 849 EEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = -1 Query: 310 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 + + P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 850 EPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 935 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -1 Query: 307 ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 E A V P PPP PP PPPP PPPP PPP PPPP Sbjct: 842 EPAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPP 878 [34][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -1 Query: 313 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 L S P P PP P PPLPPPP PPPP PPP PPPP Sbjct: 220 LPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPP 258 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPPPS 708 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PPLPP P PPPP PPP PPPP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P+ SP PPPP PP PPPP PPPP PPP PPP Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTH 191 P PP P PP PPPP PPPP PPP PPPP H Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPPPH 703 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P SP PP P PP PPPP PPPP PPP PPPP Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPP Sbjct: 684 PPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 [35][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 E +L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 67 EVILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 [36][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMS 176 P PPPP PP PPPP PPPP PPP PPPP NMS Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMS 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 [37][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/50 (50%), Positives = 29/50 (58%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFRNTRCKALAQHCL 131 P PPPP PP PPPP PPPP PPP PPPP + F K ++C+ Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLCCFGRKSRKLSIKYCV 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 [38][TOP] >UniRef100_Q7VEJ9 RNA-binding protein, RRM domain n=1 Tax=Prochlorococcus marinus RepID=Q7VEJ9_PROMA Length = 252 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGGYGGG G GGYGGGG GGYGGGG G Sbjct: 112 GGGGYGGGGGQGGYGGGGQGGYGGGGQG 139 [39][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY---GGGGYGEANTGSAD 305 GGGGYGGG GGGGYGGGG GGY GGGGYG G D Sbjct: 134 GGGGYGGG-GGGGYGGGGGGGYGGGGGGGYGGGGGGGGD 171 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGGYGGG GGGGYGGGG GGYGGGG G Sbjct: 126 GGGGYGGG-GGGGYGGGGGGGYGGGGGG 152 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGGYGGG GGGYGGGG GGYGGGG G Sbjct: 119 GGGGYGGG--GGGYGGGGGGGYGGGGGG 144 [40][TOP] >UniRef100_B6SP74 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6SP74_MAIZE Length = 156 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 4/37 (10%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG----GSGGYGGGGYGEANTG 296 GGGGYGGGRGGGGYGGG G GGYGGGG G G Sbjct: 93 GGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGGYGGGG 129 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGYGGGG G GGGGYG N G Sbjct: 114 GGGGYGGG--GGGYGGGGGYGGGGGGYGGGNRG 144 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 3/36 (8%) Frame = +3 Query: 198 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG G GGGGYG G Sbjct: 102 GGGGYGGGGRRDGGGGYGGGGGGYGGGGGYGGGGGG 137 [41][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P + +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 133 PPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 165 [42][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P L P PP P PPLPPPP PPPP PPP PPPP Sbjct: 1600 SPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPP 1635 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PP P PPLPPPP PPPP PPP PPPP Sbjct: 921 PPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPP 953 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PP P PPLPPPP PPPP PPP PPPP Sbjct: 1188 PPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPP 1220 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PP P PPLPPPP PPPP PPP PPPP Sbjct: 387 PPPPSPPPPLPPPPIPPPPSPPPPPPPP 414 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 S P L P PP P PPLPPPP PPPP PPP PPP+ Sbjct: 822 SPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPS 858 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 S P L P PP P PPLPPPP PPPP PPP PPP+ Sbjct: 1000 SPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPS 1036 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 S P L P PP P PPLPPPP PPPP PPP PPP+ Sbjct: 1091 SPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPS 1127 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P L P PP P PPLPPPP PPPP PPP PPP Sbjct: 913 SPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPP 948 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 PP P PP PPPP PPPP PPP PPPPT Sbjct: 1249 PPSPPPPTPPPPAPPPPTPPPSPPPPT 1275 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 SP PP P PPLPPPP PPPP PPP PPP Sbjct: 704 SPPPPSPPPPLPPPPLPPPPLPPPSPPP 731 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P SP PP P PPLPPPP PPPP PPP PPP Sbjct: 830 PPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 861 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P SP PP P PPLPPPP PPPP PPP PPP Sbjct: 1008 PPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 1039 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P SP PP P PPLPPPP PPPP PPP PPP Sbjct: 1099 PPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 1130 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -1 Query: 295 PVLASP*PPP-P*PPLPPPP*PPPPRPPP*PPP 200 PV P PPP P PPLPPPP PPPP PPP PPP Sbjct: 939 PVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP 971 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -1 Query: 295 PVLASP*PPP-P*PPLPPPP*PPPPRPPP*PPP 200 PV P PPP P PPLPPPP PPPP PPP PPP Sbjct: 1206 PVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP 1238 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P PPPP PP PPPP PPPP PPP PPP Sbjct: 1726 PLPPPPSPPSPPPPSPPPPSPPPSPPP 1752 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 PV P PPP PPLPPPP PPP PPP PPPPT Sbjct: 2122 PVPPPPTPPPSPPPLPPPP-TPPPSPPPLPPPPT 2154 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -1 Query: 316 ALQESAEPVLASP*PPPP*PP--LPPPP*PPPPRPPP*PPPP 197 +L S P P PPPP PP LPPPP PPPP PPP PPP Sbjct: 363 SLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPLPPPPIPPP 404 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = -1 Query: 313 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 L S P+ P PPPP PP PPP PPPP PPP PPP Sbjct: 2111 LPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPP 2148 [43][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 ASP PPPP PP PPPP PPPP PPP PPPP Sbjct: 304 ASPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 [44][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 ASP PPPP PP PPPP PPPP PPP PPPP Sbjct: 466 ASPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -1 Query: 319 RALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 R A P P PPPP PP PPPP PPPP PPP PP T Sbjct: 460 RTYAHDASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVET 501 [45][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 ASP PPPP PP PPPP PPPP PPP PPPP Sbjct: 257 ASPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 P PPPP PP PPPP PPPP PPP PPPP ++ Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPAYE 291 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 [46][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMS 176 P PPPP PP PPPP PPPP PPP PPPP H +S Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPHITKIS 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAF 170 P PPPP PP PPPP PPPP PPP PPP K ++ F Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPHITKISLPFF 67 [47][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 SA P + PPPP PPLPPPP PPPP PPP PPPP Sbjct: 460 SAIPHAGASLPPPPPPPLPPPPPPPPPPPPPPPPPP 495 [48][TOP] >UniRef100_UPI0001BB00BC single-strand binding protein n=1 Tax=Haliangium ochraceum DSM 14365 RepID=UPI0001BB00BC Length = 186 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = +3 Query: 198 GGGGYGGG-RGGGGYGGGGSGGYGGGGYGEANTGSAD 305 GGGGYGGG GGGGYGGGG GG GGGGYG G D Sbjct: 146 GGGGYGGGGSGGGGYGGGGPGGGGGGGYGGGGGGPDD 182 [49][TOP] >UniRef100_C1UQA5 Single-stranded DNA-binding protein n=1 Tax=Haliangium ochraceum DSM 14365 RepID=C1UQA5_9DELT Length = 155 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = +3 Query: 198 GGGGYGGG-RGGGGYGGGGSGGYGGGGYGEANTGSAD 305 GGGGYGGG GGGGYGGGG GG GGGGYG G D Sbjct: 115 GGGGYGGGGSGGGGYGGGGPGGGGGGGYGGGGGGPDD 151 [50][TOP] >UniRef100_A2QC74 ATP-dependent RNA helicase dbp2 n=1 Tax=Aspergillus niger CBS 513.88 RepID=DBP2_ASPNC Length = 565 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGG--GSGGYGGGGYGEANTGS 299 GGGYGGG GGGGYGGG G GGYGGGGYG G+ Sbjct: 35 GGGYGGGGGGGGYGGGGYGGGGYGGGGYGGRGGGA 69 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 4/37 (10%) Frame = +3 Query: 198 GGGGYGGGRG---GGGYGGGGSGG-YGGGGYGEANTG 296 GGGGYG G G GGGYGGGG GG YGGGGYG G Sbjct: 22 GGGGYGNGNGYSNGGGYGGGGGGGGYGGGGYGGGGYG 58 [51][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQN 182 P SP PPPP PP PPPP PPPP PPP PPPP +N Sbjct: 169 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRN 206 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 159 SPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/45 (55%), Positives = 28/45 (62%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFRNTRCKAL 146 P PPPP PP PPPP PPPP PPP PPPP + +A KA+ Sbjct: 172 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNARLKIALKAI 216 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFRNTRCK 152 P P PPP PP PPPP PPPP PPP PPPP RN R K Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNARLK 210 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PP PPPP+ Sbjct: 131 PPPPPPSPPPPPPPSPPPPPSPPPPPPPS 159 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPP PPP PPPP Sbjct: 136 PSPPPPPPPSPPPPPSPPPPPPPSPPPP 163 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPP-PP*PPPPRPPP*PPPP 197 S P + P PPPP PP PP PP PPPP PPP PPPP Sbjct: 145 SPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPP 181 [52][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/49 (57%), Positives = 30/49 (61%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFRNTRCKALAQ 140 A P PPPP PP PPPP PPPP PPP PPPP A +C AL+Q Sbjct: 230 APPAPPPPPPPPPPPPPPPPPPPPPPPPPPEETTPPLA---QQCSALSQ 275 [53][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 S+ P SP P PP PP+PPPP PPPP PPP PPPP+ Sbjct: 229 SSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPS 265 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPP 197 PPPP PP PPPP PPPP PPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P + P PPPP PP PPPP P PP PPP PPPP Sbjct: 244 PPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P+ P PPPP PP PPPP PPP PPP PPPP Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PP P PP PPPP PPPP PPP PPPP Sbjct: 234 SPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPP 269 [54][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PPLPPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNM 179 P PPPP PP PPPP PPPP PPP PPPP N+ Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 72 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQN 182 P PPPP PP PPPP PPPP PPP PPPP N Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 [55][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 325 SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +++ + E P+ +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 NEKMVIELPPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -1 Query: 301 AEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 P PPPP PP PPPP PPPP PPP PPPP Q Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQ 110 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = -1 Query: 313 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 L + P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 58 LPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNM 179 P PPPP PP PPPP PPPP PP PPPP ++N+ Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENL 113 [56][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PPLPPPP PPPP PPP PPPP Sbjct: 1215 PPPPPPPPPLPPPPPPPPPLPPPPPPPP 1242 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = -1 Query: 295 PVLASP*PP--PP*PPLPPPP*PPPPRPPP*PPPP 197 PV A P PP PP PPLPPPP PPPP PPP PPPP Sbjct: 1198 PVPAGPPPPLTPPPPPLPPPPPPPPPLPPPPPPPP 1232 [57][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/45 (53%), Positives = 29/45 (64%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFRNTRCKAL 146 P PPPP PP PPPP PPPP PPP PPPP ++++ + AL Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPSSATATAL 122 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 P PPPP PP PPPP PPPP PPP PPPP Q Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 107 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 [58][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/56 (48%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = -1 Query: 358 KTQHQADVTQ*SKRA--LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 K + +A+ K A E ++P + + PPPP PP PPPP PPPP PPP PPPP Sbjct: 1004 KAEQKAEAEAAEKEADVKDEVSKPAVTAVPPPPPPPPPPPPPPPPPPPPPPPPPPP 1059 [59][TOP] >UniRef100_C4J6D2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4J6D2_MAIZE Length = 149 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/38 (73%), Positives = 28/38 (73%), Gaps = 5/38 (13%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG----GSGGY-GGGGYGEANTG 296 GGGGYGGGRGGGGYGGG G GGY GGGGYG G Sbjct: 93 GGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYGGGGGG 130 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 3/36 (8%) Frame = +3 Query: 198 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG G GGGGYG N G Sbjct: 102 GGGGYGGGGRRDGGGGYGGGGGYGGGGGGYGGGNRG 137 [60][TOP] >UniRef100_B1X5L4 RNA-binding protein RbpD n=1 Tax=Paulinella chromatophora RepID=B1X5L4_PAUCH Length = 132 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 3/31 (9%) Frame = +3 Query: 198 GGGGYGGGRGGGG-YGGGGSGGY--GGGGYG 281 GGGGYGGGRGGGG YGGGG GGY GGGGYG Sbjct: 96 GGGGYGGGRGGGGGYGGGGGGGYGSGGGGYG 126 [61][TOP] >UniRef100_A8NA58 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NA58_COPC7 Length = 653 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGG GGG GGGGYGG G GGYGGGGYG G Sbjct: 604 GGGGGGGGYGGGGYGGYGGGGYGGGGYGGGPRG 636 [62][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 E ++ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 ERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = -1 Query: 322 KRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +R + P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 ERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 PCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPPRP P PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPPP 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP P PPPP PPPP PPP PPPP Sbjct: 58 PPPPPPPRPCPPPPPPPPPPPPPPPPPP 85 [63][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -1 Query: 313 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 LQ+S P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 LQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/45 (57%), Positives = 27/45 (60%) Frame = -1 Query: 331 Q*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 Q S+ A P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 QQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 P PPPP PP PPPP PPPP PPP PPPP Q Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 [64][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/68 (44%), Positives = 38/68 (55%), Gaps = 3/68 (4%) Frame = -1 Query: 361 PKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT---H 191 P T + + S+ + Q+S +S PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 470 PPTPPDEESKKNSECSSQDSTRGGPSSTPPPPPPPPPPPPPPPPPPPPPPPPPPPSVTLS 529 Query: 190 KQNMSAFR 167 Q M+ R Sbjct: 530 SQKMAGLR 537 [65][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P + +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 113 PPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 +P PPPP PP PPPP PPPP PPP PPPPT Sbjct: 119 APPPPPPPPPPPPPPPPPPPPPPPPPPPPT 148 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P+ PPPP PP PPPP PPPP PPP PPPP Sbjct: 114 PIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPP 146 [66][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P + +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 113 PPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 [67][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PHLLPPRPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFR 167 P PPPP PP PPPP PPPP PPP PP P +N+ R Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIPLR 109 [68][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PPPP PP PPPP PPPP PPP PPPP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPP 285 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPPS 296 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P SP PPPP PP PPPP PP P PPP PPPP Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PPPP PP PP P PPPP PPP PPPP Sbjct: 257 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PPPP PP PPP PPPP PPP PPPP Sbjct: 259 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 [69][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAF 170 P PPPP PP PPPP PPPP PPP PPPP Q A+ Sbjct: 70 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAW 106 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPP 93 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPS 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P L P PPPP PP PPPP PPPP PPP PPP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPP 92 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = -1 Query: 310 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 + + P P PPPP PP PPPP PPPP PPP P PP Sbjct: 54 ENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPP 91 [70][TOP] >UniRef100_B7QTD0 Single-stranded DNA-binding protein n=1 Tax=Ruegeria sp. R11 RepID=B7QTD0_9RHOB Length = 177 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG+GGG YGGG GGYGGGGY N G Sbjct: 124 GGGGYGGGQGGG-YGGGQGGGYGGGGYDSGNQG 155 [71][TOP] >UniRef100_A6G1X8 Single-stranded DNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G1X8_9DELT Length = 198 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG YGGGG G G Sbjct: 130 GGGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYG 162 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 4/37 (10%) Frame = +3 Query: 198 GGGGYGGGRGGGGYG-GGGSGGYGGGG---YGEANTG 296 GGGGY GG GGGGYG GGG GGYGGGG YG +G Sbjct: 121 GGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSG 157 [72][TOP] >UniRef100_Q40426 RNA-binding glycine-rich protein-1a n=1 Tax=Nicotiana sylvestris RepID=Q40426_NICSY Length = 156 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 4/38 (10%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGG----GGYGEANTGS 299 GGGGYGGGR GGYGGGG GGYGG GGYG + G+ Sbjct: 116 GGGGYGGGRREGGYGGGGGGGYGGGRREGGYGGGSEGN 153 [73][TOP] >UniRef100_O70133-2 Isoform 2 of ATP-dependent RNA helicase A n=1 Tax=Mus musculus RepID=O70133-2 Length = 1381 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +3 Query: 195 VGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 329 VGGGGYGGG GGGGYGGG SGGYGGGGYG S + R +Y Sbjct: 1274 VGGGGYGGG-GGGGYGGG-SGGYGGGGYGGGEGYSISPNSYRGNY 1316 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 296 GGGG+GGGRGGGG G GGSGG+ GGGGYG G Sbjct: 1244 GGGGFGGGRGGGGGGFGGSGGFGNGGGGYGVGGGG 1278 [74][TOP] >UniRef100_O70133 ATP-dependent RNA helicase A n=2 Tax=Mus musculus RepID=DHX9_MOUSE Length = 1380 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +3 Query: 195 VGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDY 329 VGGGGYGGG GGGGYGGG SGGYGGGGYG S + R +Y Sbjct: 1273 VGGGGYGGG-GGGGYGGG-SGGYGGGGYGGGEGYSISPNSYRGNY 1315 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 296 GGGG+GGGRGGGG G GGSGG+ GGGGYG G Sbjct: 1243 GGGGFGGGRGGGGGGFGGSGGFGNGGGGYGVGGGG 1277 [75][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PPPP PP PPPP PPPP PPP PPPP Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -1 Query: 325 SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S Q P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 350 SANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 376 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPPPP 397 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 377 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPP 400 [76][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PPP PPPPT Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPT 1440 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1436 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1408 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1437 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +A P P PPPP PP PPPP PPPP PPP P PP Sbjct: 1407 TAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P PPPP PP PPPP PPPP PPP PPP Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPP PPP PPPP Sbjct: 1425 PPPPPPPPPPPPPPPTPPPAPPPPPPPP 1452 [77][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A+P PPPP PP PPPP PPPP PPP PPPP Sbjct: 214 AAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 243 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A P PPPP PP PPPP PPPP PPP PPPP Sbjct: 215 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 [78][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPPPTH 191 SP PPPP PP PPPP PPPP PPP PPPP + Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 SP PPP PP PPPP PPPP PPP PPPP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P P PPPP PP PPPP PPPP PPP PPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 [79][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 EP P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 EPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -1 Query: 307 ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 E P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 EPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFRN 164 P PPPP PP PPPP PPPP PPP PPPP + + A N Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILPAPAN 55 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 P PPPP PP PPPP PPPP PPP PPPP Q Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 [80][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PPP PPPPT Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPPPT 116 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -1 Query: 292 VLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 V+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 75 VIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -1 Query: 292 VLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 ++ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 74 IVIPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 [81][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -1 Query: 310 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +E+ P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 RETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 P PPPP PP PPPP PPPP PPP PPPP +Q Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQ 68 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -1 Query: 325 SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S R P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 STRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 P PPPP PP PPPP PPPP PPP PPPP Q Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQ 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 PV ++ PPP PP PPPP PPPP PPP PPPP Sbjct: 9 PVASTRETPPPPPPPPPPPPPPPPPPPPPPPPP 41 [82][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAF 170 P PPPP PP PPPP PPPP PPP PPPP +N + Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVY 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSA 173 P PPPP PP PPPP PPPP PPP PPP ++ + A Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQA 41 [83][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -1 Query: 325 SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S+R P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 SRRPAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = -1 Query: 316 ALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A+ + P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 AMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 P PPPP PP PPPP PPPP PPP PPPP ++ Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRR 116 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 [84][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -1 Query: 319 RALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 R L P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 RLLHSLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 P PPPP PP PPPP PPPP PPP PPPP + Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [85][TOP] >UniRef100_UPI000042D0EA hypothetical protein CNBF3470 n=1 Tax=Cryptococcus neoformans var. neoformans B-3501A RepID=UPI000042D0EA Length = 559 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 3/30 (10%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGG---SGGYGGGGYG 281 GGGYGGG GGGGYGGGG GGYGGGGYG Sbjct: 32 GGGYGGGGGGGGYGGGGGGYGGGYGGGGYG 61 [86][TOP] >UniRef100_Q31DH1 RNA-binding region RNP-1 n=1 Tax=Prochlorococcus marinus str. MIT 9312 RepID=Q31DH1_PROM9 Length = 222 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGYGGGG G GGGGYG N G Sbjct: 100 GGGGYGGGNNGGGYGGGGGG--GGGGYGGGNNG 130 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 10/43 (23%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSG----------GYGGGGYGEANTG 296 GGGGYGGG GGGYGGGG G G GGGGYG N G Sbjct: 120 GGGGYGGGNNGGGYGGGGGGYGGGNNGGGYGGGGGGYGGGNNG 162 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 4/35 (11%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYG----GGGYGEAN 290 GGGGYGGG GGGYGGGG GGYG GGGYG N Sbjct: 136 GGGGYGGGNNGGGYGGGG-GGYGGGNNGGGYGGGN 169 [87][TOP] >UniRef100_A4CWS8 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 7805 RepID=A4CWS8_SYNPV Length = 197 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGGYGGG GGGGYGGGG GGYGGGG G Sbjct: 89 GGGGYGGG-GGGGYGGGGGGGYGGGGGG 115 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 296 GGGGYGGG GGGGYGGGG GGY GGGGY + G Sbjct: 97 GGGGYGGG-GGGGYGGGGGGGYRGGGGGYNDGGGG 130 [88][TOP] >UniRef100_Q41810 Glycine-rich protein n=1 Tax=Zea mays RepID=Q41810_MAIZE Length = 155 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/33 (81%), Positives = 27/33 (81%), Gaps = 5/33 (15%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG----GSGGY-GGGGYG 281 GGGGYGGGRGGGGYGGG G GGY GGGGYG Sbjct: 93 GGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYG 125 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 9/42 (21%) Frame = +3 Query: 198 GGGGYGGGR---------GGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG G GGGGYG N G Sbjct: 102 GGGGYGGGGRRDGGGGYGGGGGYGGGGGYGGGGGGYGGGNRG 143 [89][TOP] >UniRef100_C0PNT1 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PNT1_MAIZE Length = 94 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/33 (81%), Positives = 27/33 (81%), Gaps = 5/33 (15%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG----GSGGY-GGGGYG 281 GGGGYGGGRGGGGYGGG G GGY GGGGYG Sbjct: 32 GGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYG 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 9/42 (21%) Frame = +3 Query: 198 GGGGYGGGR---------GGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG G GGGGYG N G Sbjct: 41 GGGGYGGGGRRDGGGGYGGGGGYGGGGGYGGGGGGYGGGNRG 82 [90][TOP] >UniRef100_B6STA5 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6STA5_MAIZE Length = 155 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/33 (81%), Positives = 27/33 (81%), Gaps = 5/33 (15%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG----GSGGY-GGGGYG 281 GGGGYGGGRGGGGYGGG G GGY GGGGYG Sbjct: 93 GGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYG 125 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 9/42 (21%) Frame = +3 Query: 198 GGGGYGGGR---------GGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG G GGGGYG N G Sbjct: 102 GGGGYGGGGRRDGGGGYGGGGGYGGGGGYGGGGGGYGGGNRG 143 [91][TOP] >UniRef100_A1BQW1 Glycine-rich RNA-binding protein (Fragment) n=1 Tax=Nicotiana attenuata RepID=A1BQW1_9SOLA Length = 152 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 4/37 (10%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGG----GGYGEANTG 296 GGGGYGGGR GGYGGGG GGYGG GGYG + G Sbjct: 116 GGGGYGGGRREGGYGGGGGGGYGGGRREGGYGGGSEG 152 [92][TOP] >UniRef100_C0SUI0 Ecdysone receptor B1 isoform (Fragment) n=1 Tax=Anterhynchium flavomarginatum RepID=C0SUI0_9HYME Length = 263 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 320 G G GGG GGGG GGGG GG GGGG G A G +D C+AR Sbjct: 161 GSGGGGGGGGGGGGGGGGGGGGGGGGGGAGGGGSDGCDAR 200 [93][TOP] >UniRef100_A5K6G3 Exoribonuclease, putative n=1 Tax=Plasmodium vivax RepID=A5K6G3_PLAVI Length = 1353 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = +3 Query: 198 GGGGYGGG-RGGGGYGGGGSGGYGGGGYGEANTGS 299 GGGGYGGG GGGGYGGG GGYG GGYG G+ Sbjct: 1084 GGGGYGGGGHGGGGYGGGYGGGYGNGGYGNGGYGN 1118 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/46 (58%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGG--SGGYGGGGYGEANTGSADSCNARFDY 329 G GGYGGG GGGYGGGG SGGYG GGYG G + R +Y Sbjct: 1117 GNGGYGGGGHGGGYGGGGYGSGGYGSGGYGSGGYGGHVGRDHRNNY 1162 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG-GSGGYGGGGYGEANTG 296 GGGG+GGG GGGYGGG G+GGYG GGYG G Sbjct: 1089 GGGGHGGGGYGGGYGGGYGNGGYGNGGYGNGGYG 1122 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 2/36 (5%) Frame = +3 Query: 198 GGGGYG-GGRGGGGYGGGG-SGGYGGGGYGEANTGS 299 G GGYG GG G GGYGGGG GGYGGGGYG GS Sbjct: 1107 GNGGYGNGGYGNGGYGGGGHGGGYGGGGYGSGGYGS 1142 [94][TOP] >UniRef100_Q5KFM6 ATP-dependent RNA helicase DBP2-A n=1 Tax=Filobasidiella neoformans RepID=DBP2_CRYNE Length = 540 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 3/30 (10%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGG---SGGYGGGGYG 281 GGGYGGG GGGGYGGGG GGYGGGGYG Sbjct: 13 GGGYGGGGGGGGYGGGGGGYGGGYGGGGYG 42 [95][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 E L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 EIYLPPPLPPPPPPPRPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPRPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P L P PPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPPP 48 [96][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFRNT 161 P PPPP PP PPPP PPPP PPP PPPP AF T Sbjct: 656 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPDVLAADAFDRT 695 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = -1 Query: 316 ALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A++ P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 645 AVRSVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 [97][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -1 Query: 307 ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 E P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 319 EQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = -1 Query: 313 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +++ P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 318 VEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -1 Query: 310 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 Q P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 320 QPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP P PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPEPPPQPDPP 372 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P PPPP PP PPPP PPPP PPP PPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPEPPP 367 [98][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Frame = -1 Query: 313 LQESAEPVLASP*PPPP*PPLPPPP*PP-----PPRPPP*PPPP 197 LQ S + AS PPPP PP PPPP PP PPRPPP PPPP Sbjct: 421 LQRSETEIFASTPPPPPPPPPPPPPPPPTPPPPPPRPPPPPPPP 464 [99][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 SP PPPP PP PPPP PPPP PPP PPPP Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMS 176 P PPPP PP PPPP PPPP PPP PPPP + S Sbjct: 275 PSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQCS 309 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 SP PPPP PP PPP PPPP PPP PPPP Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P + P PPPP PP PPP PPPP PPP PPPP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PPPP PP PPPP PPPP PP PPPP Sbjct: 248 SPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PPPP PP PPPP P PP PPP PPPP Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPP PP PPPP PPPP PPP PPPP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP P PP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 [100][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 A P PPPP PP PPPP PPPP PPP PPPP K Sbjct: 44 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVK 76 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 E +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 EVTAVNPAPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = -1 Query: 322 KRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 K+ + V +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 KKDWKPEVTAVNPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 + P P PPPP PP PPPP PPPP PPP PPP Sbjct: 40 AVNPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [101][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAF 170 P PPPP PP PPPP PPPP PPP PPPP + AF Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAF 53 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 P PPPP PP PPPP PPPP PPP PPPP K Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPK 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 [102][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -1 Query: 289 LASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 L+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 983 LSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1013 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 P PPPP PP PPPP PPPP PPP PPPP K Sbjct: 987 PPPPPPPPPPPPPPPPPPPPPPPPPPPPGFK 1017 [103][TOP] >UniRef100_UPI0000E4626F PREDICTED: similar to heterogeneous nuclear ribonucleoprotein A2/B1 n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E4626F Length = 360 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/33 (75%), Positives = 27/33 (81%), Gaps = 4/33 (12%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG----GSGGYGGGGYGE 284 GGGGYGGG+GGGGYGGG G GG GGGGYG+ Sbjct: 326 GGGGYGGGQGGGGYGGGNSGYGGGGGGGGGYGK 358 [104][TOP] >UniRef100_Q3B0Y9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. CC9902 RepID=Q3B0Y9_SYNS9 Length = 196 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGG-----SGGYGGGGYGEANTGSADSCNAR 320 GGGGYGGG GGGGYGGGG GG GGGGYG G AR Sbjct: 98 GGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGDRPSGAR 143 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 1/29 (3%) Frame = +3 Query: 198 GGGGYGGGRGGGGYG-GGGSGGYGGGGYG 281 GGGGYGGG GGGGYG GGG GGYGGGG G Sbjct: 89 GGGGYGGGGGGGGYGGGGGGGGYGGGGGG 117 [105][TOP] >UniRef100_B9H173 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H173_POPTR Length = 207 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 5/38 (13%) Frame = +3 Query: 198 GGGGYGGGRGGGGYG-----GGGSGGYGGGGYGEANTG 296 G GG GGGRGGGGYG GGG GGYGGGGYG G Sbjct: 88 GSGGRGGGRGGGGYGGGGGYGGGGGGYGGGGYGGGRRG 125 [106][TOP] >UniRef100_A7PDA4 Chromosome chr17 scaffold_12, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PDA4_VITVI Length = 277 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/39 (71%), Positives = 29/39 (74%), Gaps = 6/39 (15%) Frame = +3 Query: 198 GGGGYGGGRGG---GGYGGGG---SGGYGGGGYGEANTG 296 GGGGYGGG GG GGYGGGG SGGYGGGGYG + G Sbjct: 127 GGGGYGGGGGGYGGGGYGGGGYGGSGGYGGGGYGGGSGG 165 [107][TOP] >UniRef100_A5B074 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B074_VITVI Length = 272 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/39 (71%), Positives = 29/39 (74%), Gaps = 6/39 (15%) Frame = +3 Query: 198 GGGGYGGGRGG---GGYGGGG---SGGYGGGGYGEANTG 296 GGGGYGGG GG GGYGGGG SGGYGGGGYG + G Sbjct: 127 GGGGYGGGGGGYGGGGYGGGGYGGSGGYGGGGYGGGSGG 165 [108][TOP] >UniRef100_C3Y7T8 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3Y7T8_BRAFL Length = 183 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGGY GGRGGG YGGGG GGYGGGGYG Sbjct: 91 GGGGYRGGRGGGRYGGGG-GGYGGGGYG 117 [109][TOP] >UniRef100_B5DJN5 GA28844 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DJN5_DROPS Length = 400 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGYGGG GGGGYGGGG GGYGGGG+G Sbjct: 334 GGGYGGG-GGGGYGGGGGGGYGGGGHG 359 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 8/45 (17%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGG--------GGYGEANTGSADS 308 GGGGYGGG GGGGYGGGG GG+GG GGYG SA S Sbjct: 341 GGGGYGGG-GGGGYGGGGHGGHGGLGGAGGKHGGYGGGAHSSASS 384 [110][TOP] >UniRef100_B4LUJ0 GJ17322 n=1 Tax=Drosophila virilis RepID=B4LUJ0_DROVI Length = 418 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +3 Query: 198 GGGGYGGG-RGGGGYGGGG--SGGYGGGGYGEANTGSADS 308 GGGG+GGG GGGG+GGGG GGYGGGGYG G A S Sbjct: 364 GGGGFGGGGHGGGGHGGGGHGGGGYGGGGYGGGGKGGASS 403 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/34 (67%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGS-GGYGGGGYGEANTG 296 GGGG GGG GGGG+GGG + GG+GGGG+G +TG Sbjct: 130 GGGGLGGGHGGGGFGGGSAGGGHGGGGFGGGSTG 163 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = +3 Query: 198 GGGGYGGG-RGGGGYGGG--GSGGYGGGGYGEANTGSADSCNA 317 GGGG+GGG GGGG+GGG G GGYGGGG G A++ ++ S +A Sbjct: 369 GGGGHGGGGHGGGGHGGGGYGGGGYGGGGKGGASSSASASASA 411 [111][TOP] >UniRef100_Q0UIP7 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0UIP7_PHANO Length = 668 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGY GGG GGYGGGGYG G Sbjct: 261 GGGGYGGG--GGGYSGGGGGGYGGGGYGGGGGG 291 [112][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -1 Query: 292 VLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 V+ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 232 VVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -1 Query: 310 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 Q P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 229 QVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 [113][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A P PPPP PP PPPP PPPP PPP PPPP Sbjct: 231 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -1 Query: 313 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 L E + +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 221 LAECLDAAGFAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 [114][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAF 170 PPPP PP PPPP PPPP PPP PPPPT N + Sbjct: 223 PPPPPPPPPPPPPPPPPPPPPPPPPPTTPCNTGPY 257 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPP 197 PPPP PP PPPP PPPP PPP PPPP Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPP 247 [115][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A P PPPP PP PPPP PPPP PPP PPPP Sbjct: 223 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 252 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 253 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 227 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 [116][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNM 179 P PPPP PP PPPP PPPP PPP PPPP N+ Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 72 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQN 182 P PPPP PP PPPP PPPP PPP PPPP N Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 [117][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/33 (72%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPR--PPP*PPPPTHK 188 P PPPP PP PPPP PPPPR PPP PPPP H+ Sbjct: 1095 PPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHE 1127 [118][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 SPPPSPPPPFPPPPSPPPPPPPLPPPPSPPPPPPPP 72 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P P PPPP PPLPPPP PPPP PPP PPP Sbjct: 45 PFPPPPSPPPPPPPLPPPPSPPPPPPPPPPPP 76 [119][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNM 179 P PPPP PP PPPP PPPP PPP PPPP N+ Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 69 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQN 182 P PPPP PP PPPP PPPP PPP PPPP N Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 [120][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 E +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 EVTAVNPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 P PPPP PP PPPP PPPP PPP PPPP K Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPIK 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +P + + PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 KPEVTAVNPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 + P P PPPP PP PPPP PPPP PPP PPP Sbjct: 40 AVNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [121][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFR 167 P PPPP PP PPPP PPPP PPP PPPP +FR Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFR 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/40 (57%), Positives = 26/40 (65%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFRNT 161 P PPPP PP PPPP PPPP PPP PPP + + + F T Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPQSFRFVLERFSKT 68 [122][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 P PPPP PP PPPP PPPP PPP PPPP Q Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQ 50 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAF 170 P PPPP PP PPPP PPPP PPP PPPP ++ + + Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRY 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 [123][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -1 Query: 289 LASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 L P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 LCCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [124][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/62 (46%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = -1 Query: 376 ATCTRPKTQHQADVTQ*SKRALQ--ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 203 A +P+ Q Q D Q ++ Q E + P PPPP P PPPP PPPP PPP PP Sbjct: 9 AGSAQPQPQPQIDQQQQQQQQQQHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPP 68 Query: 202 PP 197 PP Sbjct: 69 PP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/66 (48%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = -1 Query: 364 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPL--PPPP*PPPPRPPP*PPPPTH 191 RP Q QA T + + P LA P PPPP PP PPPP PPPP P PPPPT Sbjct: 1924 RPPAQAQAPATP-TITSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTP 1982 Query: 190 KQNMSA 173 SA Sbjct: 1983 LMPTSA 1988 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/64 (40%), Positives = 32/64 (50%) Frame = -1 Query: 364 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 +P+ Q Q + Q+ + P PPPP P PPPP PPPP PPP PPPP + Sbjct: 17 QPQIDQQQQQQQQQQHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPE 76 Query: 184 NMSA 173 A Sbjct: 77 PQPA 80 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/52 (48%), Positives = 26/52 (50%) Frame = -1 Query: 352 QHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 QHQ Q + P P PPPP PP PPPP PPPP P P P PP Sbjct: 31 QHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 [125][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/62 (46%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = -1 Query: 376 ATCTRPKTQHQADVTQ*SKRALQ--ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP 203 A +P+ Q Q D Q ++ Q E + P PPPP P PPPP PPPP PPP PP Sbjct: 9 AGSAQPQPQPQIDQQQQQQQQQQHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPP 68 Query: 202 PP 197 PP Sbjct: 69 PP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/66 (48%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = -1 Query: 364 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPL--PPPP*PPPPRPPP*PPPPTH 191 RP Q QA T + + P LA P PPPP PP PPPP PPPP P PPPPT Sbjct: 1827 RPPAQAQAPATP-TITSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTP 1885 Query: 190 KQNMSA 173 SA Sbjct: 1886 LMPTSA 1891 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/64 (40%), Positives = 32/64 (50%) Frame = -1 Query: 364 RPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 +P+ Q Q + Q+ + P PPPP P PPPP PPPP PPP PPPP + Sbjct: 17 QPQIDQQQQQQQQQQHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPE 76 Query: 184 NMSA 173 A Sbjct: 77 PQPA 80 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/52 (48%), Positives = 26/52 (50%) Frame = -1 Query: 352 QHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 QHQ Q + P P PPPP PP PPPP PPPP P P P PP Sbjct: 31 QHQEQKQQQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 [126][TOP] >UniRef100_Q7V9D6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9313 RepID=Q7V9D6_PROMM Length = 199 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 320 GGGGYGGG GG G GG G GGYGGGGYG G AR Sbjct: 112 GGGGYGGGGGGYGGGGYGGGGYGGGGYGGGGGGGDRGSGAR 152 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 6/39 (15%) Frame = +3 Query: 198 GGGGYGGGRGGGGYG------GGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYG GGG GGYGGGGYG G Sbjct: 97 GGGGYGGG-GGGGYGGGGGGYGGGGGGYGGGGYGGGGYG 134 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 2/34 (5%) Frame = +3 Query: 201 GGGYGGGRGGGG--YGGGGSGGYGGGGYGEANTG 296 GGGYGGG GGGG YGGGG GGYGGGG G G Sbjct: 87 GGGYGGGGGGGGGGYGGGGGGGYGGGGGGYGGGG 120 [127][TOP] >UniRef100_B9MIH3 RNP-1 like RNA-binding protein n=1 Tax=Diaphorobacter sp. TPSY RepID=B9MIH3_DIAST Length = 155 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 198 GGGGYGGGR-GGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGGR GGGGYGGGG GGYGGGG G + G Sbjct: 96 GGGGYGGGRSGGGGYGGGG-GGYGGGGGGRSEGG 128 [128][TOP] >UniRef100_C1ZIK1 RRM domain-containing RNA-binding protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZIK1_PLALI Length = 146 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGGYGGG GGGGYGGGG GGYGGGG G Sbjct: 118 GGGGYGGGGGGGGYGGGG-GGYGGGGGG 144 [129][TOP] >UniRef100_Q40427 RNA-binding glycine-rich protein-1b n=1 Tax=Nicotiana sylvestris RepID=Q40427_NICSY Length = 148 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 7/35 (20%) Frame = +3 Query: 198 GGGGYGGGR---GGGGYGG----GGSGGYGGGGYG 281 GGGGYGGGR GGGGYGG GG GGYGGGGYG Sbjct: 109 GGGGYGGGRREGGGGGYGGGRREGGGGGYGGGGYG 143 [130][TOP] >UniRef100_A8JAG8 Argonaute-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JAG8_CHLRE Length = 1037 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGG 275 GGGGYGGG GGGG GGGG GGYGGGG Sbjct: 52 GGGGYGGGGGGGGRGGGGGGGYGGGG 77 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 11/44 (25%) Frame = +3 Query: 198 GGGGYGGG-----------RGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG RGGGGYGGGG GG GGGGYG G Sbjct: 19 GGGGYGGGGGGGRGGGGGDRGGGGYGGGGRGGGGGGGYGGGGGG 62 [131][TOP] >UniRef100_O02049 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans RepID=O02049_CAEEL Length = 259 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 195 VGGGGYGGGR-GGGGYGGGGSGGYGGGGYGEANTG 296 +GGGGYGGG GGGG GGGG GGYGGGGYG G Sbjct: 109 MGGGGYGGGGYGGGGDGGGGYGGYGGGGYGGMGGG 143 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/51 (54%), Positives = 29/51 (56%), Gaps = 12/51 (23%) Frame = +3 Query: 195 VGGGGYGGG-RGGGGYGGGGSGGYG-----------GGGYGEANTGSADSC 311 +GGGGYGGG GGGGYGGGG GGYG GGGYG G C Sbjct: 200 MGGGGYGGGGMGGGGYGGGGDGGYGPSGGYGGGYGPGGGYGMGGGGGGGGC 250 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = +3 Query: 204 GGYGGG-RGGGGYGGGGSGGYGGGGYGEANTG 296 GGYGGG GGGGYGGGG GGYGGGG+G G Sbjct: 163 GGYGGGGMGGGGYGGGGDGGYGGGGFGGGGMG 194 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 8/42 (19%) Frame = +3 Query: 195 VGGGGYGGGR----GGGGYGGGGSGGY----GGGGYGEANTG 296 +GGGGYGGG GGGG+GGGG GGY GGGGYG G Sbjct: 170 MGGGGYGGGGDGGYGGGGFGGGGMGGYGGGMGGGGYGGGGMG 211 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/30 (80%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG--GSGGYGGGGYG 281 G GGYGGG GGGGYGGG G GGYGGGG G Sbjct: 192 GMGGYGGGMGGGGYGGGGMGGGGYGGGGDG 221 [132][TOP] >UniRef100_B7Q1P5 Collagen-like repeats containing protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q1P5_IXOSC Length = 103 Score = 57.0 bits (136), Expect = 6e-07 Identities = 33/82 (40%), Positives = 42/82 (51%) Frame = +3 Query: 51 QTTCAPKDHLESDASV*RFTRLPRACSKQCCASALQRVFRNADMFCLCVGGGGYGGGRGG 230 Q + K HL A+ + T++ +C A ++ + D L GGGG GGG GG Sbjct: 2 QKSSTIKTHLIIYATKPKRTKINLGILTECSLMAPSQMHKVDDHDILAGGGGGGGGGGGG 61 Query: 231 GGYGGGGSGGYGGGGYGEANTG 296 GG GGGG GG GGGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGG 83 [133][TOP] >UniRef100_B4I4D3 GM10561 n=1 Tax=Drosophila sechellia RepID=B4I4D3_DROSE Length = 168 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/53 (56%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Frame = +3 Query: 141 CASALQRVFR--NADMFCLCVGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANT 293 C AL + NA + L GGGG GGG GGG YGGG GGYGGGGYG +T Sbjct: 6 CLLALAAILATANAGLLSLLKGGGGGGGGYGGG-YGGGYGGGYGGGGYGGEST 57 [134][TOP] >UniRef100_A7SMB3 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SMB3_NEMVE Length = 218 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = +3 Query: 198 GGGGYGGGR-GGGGYGGG--GSGGYGGGGYGEANTGSADS 308 GGGGYGGG GGGGYGGG G GGYGGGGYG G S Sbjct: 136 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGS 175 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 6/39 (15%) Frame = +3 Query: 198 GGGGYGGGR---GGGGYGG---GGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGG GG GGYGGGGYG +G Sbjct: 156 GGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSG 194 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = +3 Query: 198 GGGGYG-GGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYG GG GGGGYGGGG GG GGGGYG + G Sbjct: 146 GGGGYGGGGHGGGGYGGGGYGG-GGGGYGGSGYG 178 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 3/36 (8%) Frame = +3 Query: 198 GGGGYGG-GRGGGGYGGG--GSGGYGGGGYGEANTG 296 GGGGY G GRGGGGYGGG G GGYGGGG+G G Sbjct: 126 GGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYG 161 [135][TOP] >UniRef100_C9SP10 ATP-dependent RNA helicase DBP2 n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9SP10_9PEZI Length = 577 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 5/41 (12%) Frame = +3 Query: 198 GGGGYGGGRGG-----GGYGGGGSGGYGGGGYGEANTGSAD 305 GGGGYGGG GG GGYGGGG GGYGGGG G G D Sbjct: 6 GGGGYGGGGGGYGGGGGGYGGGGGGGYGGGGRGGYGGGRND 46 [136][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 295 PPPPPPPPPCPPPPPPPPPPPPPCPPPP 322 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 259 PPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPP 291 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P P PPPP PP PPPP PPPP PPP PPP Sbjct: 255 PPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPP 286 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 281 PPCPPPCPPPP-PPCPPPPPPPPPCPPPPPPPP 312 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P PPPP PP PPPP PPPP PPP PPP Sbjct: 309 PPPPPPPPPCPPPPPPPPPCPPPCPPP 335 [137][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [138][TOP] >UniRef100_UPI0000D9B773 PREDICTED: similar to CG5514-PB, isoform B n=1 Tax=Macaca mulatta RepID=UPI0000D9B773 Length = 283 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/71 (40%), Positives = 38/71 (53%), Gaps = 16/71 (22%) Frame = -1 Query: 325 SKRALQESAEPVLAS------P*PPPP*PPLPPPP*PPPPRPPP*PP----------PPT 194 S++ L +P+L+ P PPPP PP PPPP PPPP PPP PP PP Sbjct: 16 SRQFLPRLPQPLLSQSWPSPPPPPPPPPPPSPPPPPPPPPSPPPLPPWGPPPSPPPSPPL 75 Query: 193 HKQNMSAFRNT 161 H Q + ++R + Sbjct: 76 HVQGLLSWRRS 86 [139][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 501 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PPPP P PPPP PPPP PPP PPPP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PPPP PP P PP PPPP PPP PPPP Sbjct: 485 SPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PP P PPP PPPP Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPP PP PPPP PPPP PPP PPPP Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 [140][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 94 PPPPPPPPPSPPPPSPPPPSPPPPPPPP 121 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPP PPP PPPPT Sbjct: 107 PSPPPPSPPPPPPPPPPPSPPPPSPPPPT 135 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP P PP PPPP PPP PPPP+ Sbjct: 102 PSPPPPSPPPPSPPPPPPPPPPPSPPPPS 130 [141][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 257 PSPPPPPPPSPPPPPPPPPPPPPPPPPPS 285 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = -1 Query: 295 PVLASP*PP---PP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PP PP PP PPPP PPPP PPP PPPP Sbjct: 244 PAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPP 279 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P+ SP PPPP P PPPP PPPP PPP PP P+ Sbjct: 254 PLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPS 287 [142][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -1 Query: 289 LASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 + P PPPP PP PPPP PPPP PPP PPPP Sbjct: 265 ITGPGPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -1 Query: 310 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 QE P P PPPP PP PPPP PPPP PPP PPP Sbjct: 263 QEITGPGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 [143][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 P PPPP PP PPPP PPPPRPPP PPPP K Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPP-PPPPIKK 382 [144][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +P A PPPP PP PPPP PPPP PPP PPPP Sbjct: 345 QPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 P +P PPPP PP PPPP PPPP PPP PPP + K Sbjct: 347 PAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPASTK 382 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAF 170 A P PPPP PP PPPP PPPP PPP PP T +F Sbjct: 351 APPPPPPPPPPPPPPPPPPPPPPPPPPPASTKPPQALSF 389 [145][TOP] >UniRef100_C5Z4J0 Putative uncharacterized protein Sb10g021810 n=1 Tax=Sorghum bicolor RepID=C5Z4J0_SORBI Length = 199 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/55 (54%), Positives = 30/55 (54%), Gaps = 10/55 (18%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGS----GGYGGGGYGEANTGS------ADSCNARFDYW 332 GGGGYGGG GGGYGGGG GGYGGGG G G A S DYW Sbjct: 38 GGGGYGGGGSGGGYGGGGGGGGYGGYGGGGGGSGYGGGGGGYTPAYSGTGTCDYW 92 [146][TOP] >UniRef100_B7Q3U9 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U9_IXOSC Length = 280 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/30 (76%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG--GSGGYGGGGYG 281 GGGGYGGG GGGG+GGG G GG+GGGG+G Sbjct: 21 GGGGYGGGHGGGGFGGGGFGGGGFGGGGFG 50 [147][TOP] >UniRef100_B4NET8 GK25701 n=1 Tax=Drosophila willistoni RepID=B4NET8_DROWI Length = 211 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGG GG GGGYGGGG GGYGGGGYG Sbjct: 22 GGGGGGGWSSGGGYGGGGGGGYGGGGYG 49 [148][TOP] >UniRef100_P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein n=2 Tax=Zea mays RepID=GRPA_MAIZE Length = 157 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGG-GSGGY-GGGGYGEANTG 296 GGGGYGGGRGGGGYGGG GGY GGGGYG G Sbjct: 92 GGGGYGGGRGGGGYGGGRRDGGYGGGGGYGGRREG 126 [149][TOP] >UniRef100_Q6CIV2 ATP-dependent RNA helicase DBP2 n=1 Tax=Kluyveromyces lactis RepID=DBP2_KLULA Length = 554 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GG G+GGGRGG G+GG G GGYGGGGYG G Sbjct: 509 GGRGFGGGRGGRGFGGRGDGGYGGGGYGGGRGG 541 [150][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQN 182 +PV A P PPPP PP PPPP PPPP PPP PP + +N Sbjct: 330 KPVSAPPPPPPPRPPPPPPPPPPPPPPPPPPPALKNVEN 368 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNM 179 PPPP PP PPPP PPPP PPP PPPP +N+ Sbjct: 335 PPPPPPPRPPPPPPPPPPPPPPPPPPPALKNV 366 [151][TOP] >UniRef100_B4U926 Putative uncharacterized protein n=1 Tax=Hydrogenobaculum sp. Y04AAS1 RepID=B4U926_HYDS0 Length = 231 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 A P PPPP PP PPPP PPPP PP PPPP K Sbjct: 66 APPPPPPPPPPPPPPPPPPPPETPPPPPPPVSK 98 [152][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +P PPPP PP PPPP PPPP PPP PPPP Sbjct: 212 APVPPPPPPPPPPPPPPPPPPPPPPPPPP 240 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQ 185 P PPPP PP PPPP PPPP PPP PP P +Q Sbjct: 215 PPPPPPPPPPPPPPPPPPPPPPPPPPAPVCQQ 246 [153][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPS 124 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPP 128 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPPP 142 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PPLPP P PPPP PPP PPPP Sbjct: 72 PPPPPPQPPLPPSPSPPPPPPPPVPPPP 99 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PPPP P PPPP PPPP PPP PPPP Sbjct: 82 PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPP 114 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPP 197 PPPP PP PPPP PPPP PPP PPPP Sbjct: 112 PPPPPPPPPPPPSPPPPPPPPPPPPP 137 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PPPP PP PPPP P PP PPP PPPP Sbjct: 86 SPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPP 121 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPP PP PPPP PPPP PPP PPPP Sbjct: 119 PPPPPSPPPPPPPPPPPPPNPPPPPPPP 146 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPP PP PPPP PPPP PPP PPPP Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPP 132 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 S P P PPPP PP PPPP PPPP PP PPPP Sbjct: 110 SPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145 [154][TOP] >UniRef100_B4ND74 GK24962 n=1 Tax=Drosophila willistoni RepID=B4ND74_DROWI Length = 282 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -1 Query: 310 QESAEP-VLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +ES P +A P PPPP PP PPPP PPPP PPP PP P Sbjct: 71 EESKLPETIAPPAPPPPPPPTPPPPPPPPPPPPPTPPTP 109 [155][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 SA P + PPPP PP PPPP PPPP PPP PPPP Sbjct: 831 SAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPP 866 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 AS PPPP PP PPPP PPPP PPP PPPP Sbjct: 838 ASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 867 [156][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 SA P + PPPP PP PPPP PPPP PPP PPPP Sbjct: 909 SAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 AS PPPP PP PPPP PPPP PPP PPPP Sbjct: 916 ASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 [157][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 SA P + PPPP PP PPPP PPPP PPP PPPP Sbjct: 909 SAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 AS PPPP PP PPPP PPPP PPP PPPP Sbjct: 916 ASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 [158][TOP] >UniRef100_C5CY78 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CY78_VARPS Length = 137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGG GGGG GGYGGGG G + G Sbjct: 91 GGGGYGGGGGGGYGGGGGGGGYGGGGGGRSGGG 123 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSG-GYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG G GGGGYG G Sbjct: 99 GGGGYGGGGGGGGYGGGGGGRSGGGGGYGGGGGG 132 [159][TOP] >UniRef100_A9B9L1 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9211 RepID=A9B9L1_PROM4 Length = 245 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 G GGYGGG G GGYGGGG GGYGGGG G Sbjct: 134 GQGGYGGGGGQGGYGGGGQGGYGGGGQG 161 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 G GGYGGG G GGYGGGG GGYGGGGYG Sbjct: 143 GQGGYGGG-GQGGYGGGGQGGYGGGGYG 169 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 4/37 (10%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGG----GGYGEANTG 296 G GGYGGG G GGYGGGG GGYGG GGYG G Sbjct: 117 GQGGYGGGGGQGGYGGGGQGGYGGGGGQGGYGGGGQG 153 [160][TOP] >UniRef100_A2BZB6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. NATL1A RepID=A2BZB6_PROM1 Length = 250 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGG GGG GGGGYGGGG GGYGGGG G Sbjct: 90 GGGGGGGYGGGGYGGGGQGGYGGGGQG 116 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSAD 305 G GGYGGG G GGYGGGG GGYGGGGYG G AD Sbjct: 162 GQGGYGGG-GQGGYGGGGQGGYGGGGYG--GGGQAD 194 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGGYGGG G GGYGGGG GGYGGGG G Sbjct: 98 GGGGYGGG-GQGGYGGGGQGGYGGGGQG 124 [161][TOP] >UniRef100_B6AXZ3 Single-stranded DNA-binding protein n=1 Tax=Rhodobacterales bacterium HTCC2083 RepID=B6AXZ3_9RHOB Length = 174 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGY--GGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGY G GG GGYGGG YG N G Sbjct: 123 GGGGYGGGNQGGGYDSGQGGGGGYGGGSYGGGNQG 157 [162][TOP] >UniRef100_O04070 SGRP-1 protein n=1 Tax=Solanum commersonii RepID=O04070_SOLCO Length = 162 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 9/37 (24%) Frame = +3 Query: 198 GGGGYGGGR----GGGGYGGG-----GSGGYGGGGYG 281 GGGGYGGGR GGGGYGGG G GGYGGGGYG Sbjct: 121 GGGGYGGGRREGGGGGGYGGGRREGGGGGGYGGGGYG 157 [163][TOP] >UniRef100_C4J159 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4J159_MAIZE Length = 261 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGS 299 GGGGYGGG GGGYGGG SGGYGGGG G+ GS Sbjct: 128 GGGGYGGGGYGGGYGGG-SGGYGGGGSGDYGGGS 160 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 4/32 (12%) Frame = +3 Query: 198 GGGGYGGGRGGG--GYGGGGSGGYGG--GGYG 281 GGGGYGGG GGG GYGGGGSG YGG GGYG Sbjct: 133 GGGGYGGGYGGGSGGYGGGGSGDYGGGSGGYG 164 [164][TOP] >UniRef100_B9MU37 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MU37_POPTR Length = 372 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWVT 338 GGGG GGG GGGG GGGG GG GGGG G +++ N + W T Sbjct: 208 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGNAGSNAVNVKPSNWKT 254 [165][TOP] >UniRef100_B7PDK3 Cuticular protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDK3_IXOSC Length = 166 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GG G GGGR GGGYGGG GGYGGGGYG G Sbjct: 110 GGAGAGGGRFGGGYGGGHHGGYGGGGYGGGRGG 142 [166][TOP] >UniRef100_B4NC76 GK25807 n=1 Tax=Drosophila willistoni RepID=B4NC76_DROWI Length = 234 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGG +GGG GGGGYGGGGSGG+GGG +G G Sbjct: 120 GGGKHGGGGGGGGYGGGGSGGFGGGKHGGGGGG 152 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGG--YGGGGSGGYGGGGYGEANTG 296 GGGGYGG GGGG +GGGG GGYGGGG G+ G Sbjct: 199 GGGGYGGNGGGGGGKHGGGGGGGYGGGGGGKHGGG 233 [167][TOP] >UniRef100_B4JQZ8 GH13089 n=1 Tax=Drosophila grimshawi RepID=B4JQZ8_DROGR Length = 545 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +3 Query: 198 GGGGYGGGRGGGGYG-GGGSGGYGGGGYGEANTGSADSCN 314 GGGG+GGG GGGGYG GGG GGYGGG G +G +++ N Sbjct: 118 GGGGFGGGGGGGGYGGGGGGGGYGGGAGGGRFSGGSNNYN 157 [168][TOP] >UniRef100_Q99069 Glycine-rich RNA-binding protein 1 (Fragment) n=1 Tax=Sorghum bicolor RepID=GRP1_SORBI Length = 142 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 3/39 (7%) Frame = +3 Query: 198 GGGGYGGGR---GGGGYGGGGSGGYGGGGYGEANTGSAD 305 GGGGYGGGR GGGGYGGGG GGYGGG G G++D Sbjct: 100 GGGGYGGGRGGYGGGGYGGGG-GGYGGGSRGGGGYGNSD 137 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/50 (56%), Positives = 28/50 (56%), Gaps = 17/50 (34%) Frame = +3 Query: 198 GGGGYGGGRGGGG-----------YGGGGSG------GYGGGGYGEANTG 296 GGGGYGGGRGGGG YGGGG G GYGGGGYG G Sbjct: 73 GGGGYGGGRGGGGGYGRRDGGGGGYGGGGGGYGGGRGGYGGGGYGGGGGG 122 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 5/45 (11%) Frame = +3 Query: 198 GGGGYGGGRGG-----GGYGGGGSGGYGGGGYGEANTGSADSCNA 317 GGGGYGGG GG GGYGGGG GG GGGGYG + G N+ Sbjct: 93 GGGGYGGGGGGYGGGRGGYGGGGYGG-GGGGYGGGSRGGGGYGNS 136 [169][TOP] >UniRef100_B4JH84 GH19524 n=1 Tax=Drosophila grimshawi RepID=B4JH84_DROGR Length = 189 Score = 49.7 bits (117), Expect(2) = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%), Gaps = 5/33 (15%) Frame = +3 Query: 198 GGGGYGGGRGGG---GYGGGGSGGYGG--GGYG 281 GGGG+GGG GGG GYGGG GGYGG GGYG Sbjct: 96 GGGGFGGGYGGGFGGGYGGGLGGGYGGGYGGYG 128 Score = 26.2 bits (56), Expect(2) = 1e-06 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 1 GYGGGGYGEPCECPVPSKPPVRPRIISSP 87 G GGGG+G P PV PV P+ I P Sbjct: 34 GGGGGGFGYPVAYPVAQPVPV-PQPIPVP 61 [170][TOP] >UniRef100_UPI000155C36A PREDICTED: hypothetical protein, partial n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C36A Length = 1287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPP----PRPPP*PPPPTH 191 P+ P PPP PPLPPPP PPP P PPP PPPPTH Sbjct: 47 PMPPPPPPPPGFPPLPPPPPPPPQPGFPMPPPLPPPPTH 85 [171][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P L P PPPP PP PPPP PPPP PPP PPP Sbjct: 1472 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1503 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPP 1500 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 1502 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1476 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 1503 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P+ P PPPP PP PPPP PPPP PPP PP P Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 1505 [172][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P SP PP P PP PPPP PPPP PPP PPPP+ Sbjct: 234 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPS 267 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P SP PP P PP PPPP PPPP PPP PPPP+ Sbjct: 239 PPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPS 272 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPP Sbjct: 429 PSPPPPSPPSPPPPSPPPPSPPPPSPPP 456 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PP---PPTH 191 P SP PP P PP PPPP PPPP PPP PP PP+H Sbjct: 494 PPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSHPPSH 531 [173][TOP] >UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis RepID=B9S5R2_RICCO Length = 210 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -1 Query: 304 SAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 SA ++ P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 SAAFLIVQPPPPPP-PPSPPPPSPPPPSPPPPPPPP 68 [174][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 100 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 127 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -1 Query: 289 LASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 L P PPPP PP PPPP PPPP PPP PPP Sbjct: 98 LQPPPPPPPPPPPPPPPPPPPPPPPPPPPP 127 [175][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [176][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [177][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 [178][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [179][TOP] >UniRef100_B4LCA6 GJ12883 n=1 Tax=Drosophila virilis RepID=B4LCA6_DROVI Length = 421 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/45 (53%), Positives = 28/45 (62%) Frame = -1 Query: 310 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMS 176 Q+ + L PPP P LPPPP PPPP PPP PPPP+ K+ S Sbjct: 376 QQQQQQQLPKGKAPPPPPTLPPPPPPPPPPPPPPPPPPSRKRGRS 420 [180][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/34 (70%), Positives = 25/34 (73%), Gaps = 2/34 (5%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PP--PPRPPP*PPPPTHKQ 185 P PPPP PPLPPPP PP PP+PPP PPPP Q Sbjct: 273 PPPPPPPPPLPPPPPPPPLPPQPPPPPPPPLQPQ 306 [181][TOP] >UniRef100_Q121M2 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Polaromonas sp. JS666 RepID=Q121M2_POLSJ Length = 151 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 204 GGYGGGRGGGGYG-GGGSGGYGGGGYGEANTGSAD 305 GG+GGG GGGGYG GGG GGYGGGG G + G +D Sbjct: 90 GGFGGGSGGGGYGGGGGGGGYGGGGGGRSGGGGSD 124 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 8/45 (17%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGG--------YGEANTGSADS 308 GGGGYGGG GGGGYGGGG G GGGG YG +G S Sbjct: 97 GGGGYGGGGGGGGYGGGGGGRSGGGGSDGGFRSPYGGGGSGGGRS 141 [182][TOP] >UniRef100_O24601 Glycine-rich RNA binding protein 1 n=1 Tax=Pelargonium x hortorum RepID=O24601_PELHO Length = 166 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGG----GYGEANTGSADSCNARFDYW 332 GGGGYGGG GGGYGGG GGYGGG GYG++ GS S ++ W Sbjct: 118 GGGGYGGG--GGGYGGGNGGGYGGGREQRGYGDSGGGSRYSRDSDGGNW 164 [183][TOP] >UniRef100_A9SDN8 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SDN8_PHYPA Length = 1271 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 320 GGGG GGG GGGG GGGG GG GGGG G + GS D R Sbjct: 149 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGESEGSEDEVTER 189 [184][TOP] >UniRef100_Q9XY11 Cold-inducible RNA-binding protein n=1 Tax=Ciona intestinalis RepID=Q9XY11_CIOIN Length = 158 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSA 302 GGG GGG GGGGYGGGG GGYGGGG G G + Sbjct: 88 GGGRGGGGYGGGGYGGGGGGGYGGGGGGGGRYGGS 122 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +3 Query: 207 GYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 G GGGRGGGGYGGGG GG GGGGYG G Sbjct: 86 GGGGGRGGGGYGGGGYGGGGGGGYGGGGGG 115 [185][TOP] >UniRef100_B7PKH3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKH3_IXOSC Length = 208 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GG G GGG GGGGYGGGG GGYGGG YG + G Sbjct: 147 GGLGGGGGLGGGGYGGGGLGGYGGGSYGGGSYG 179 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 6/40 (15%) Frame = +3 Query: 195 VGGGGYGGGR----GGGGYGGG--GSGGYGGGGYGEANTG 296 +GGGGYGGG GGG YGGG G GGYGGGGYG G Sbjct: 155 LGGGGYGGGGLGGYGGGSYGGGSYGGGGYGGGGYGGGGHG 194 [186][TOP] >UniRef100_B3NYM7 GG10533 n=1 Tax=Drosophila erecta RepID=B3NYM7_DROER Length = 164 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%), Gaps = 3/34 (8%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGGSGGYG---GGGYGEANT 293 GGGYGGG GGGGYGGG GGYG GGGYG +T Sbjct: 78 GGGYGGGYGGGGYGGGYGGGYGGGYGGGYGGGST 111 [187][TOP] >UniRef100_A7UTZ4 AGAP005965-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UTZ4_ANOGA Length = 113 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 332 GGGG GGG GGGG GGGG GG GGGG+G G R +W Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGGGGGGWGAGRGGKRLHTRFRLRWW 73 [188][TOP] >UniRef100_A7T285 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7T285_NEMVE Length = 278 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 1/29 (3%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGS-GGYGGGGYG 281 GGGGYGGG GGGGY GG S GGYGGGGYG Sbjct: 168 GGGGYGGGYGGGGYRGGYSGGGYGGGGYG 196 [189][TOP] >UniRef100_A4H3P3 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis RepID=A4H3P3_LEIBR Length = 1295 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 332 GGGG GGG GGGG GGGG GG GGGG G G R+ +W Sbjct: 1225 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRWRWW 1269 [190][TOP] >UniRef100_Q05966 Glycine-rich RNA-binding protein 10 n=1 Tax=Brassica napus RepID=GRP10_BRANA Length = 169 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 296 GGG GGGRGGGGYGG G GGY GGGGYG+ G Sbjct: 86 GGGGGGGRGGGGYGGRGGGGYGGGGGGYGDRRGG 119 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYG RGGGGYG GG GG GGGGYG G Sbjct: 109 GGGGYGDRRGGGGYGSGG-GGRGGGGYGSGGGG 140 [191][TOP] >UniRef100_UPI0000DA45C5 PREDICTED: similar to diacylglycerol kinase kappa n=1 Tax=Rattus norvegicus RepID=UPI0000DA45C5 Length = 1390 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = -1 Query: 310 QESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 Q+ +P + PPPP PP PPPP PPPP PPP PPP Sbjct: 119 QDGEQPAESPEPPPPPPPPAPPPPSPPPPSPPPPAPPP 156 [192][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -1 Query: 301 AEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A P P PPPP PP PPPP PPP PPP PPPP Sbjct: 619 APPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPP 653 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -1 Query: 301 AEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 A P A P PPP PP PPPP PPPP PP PPPP Sbjct: 614 APPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPP 648 [193][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PP P PP PPPP PPPP PPP PPPP Sbjct: 2257 PPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPP 2289 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 SP PP P PP PPPP PPPP PPP PPPP+ Sbjct: 2692 SPPPPSPPPPSPPPPSPPPPSPPPSPPPPS 2721 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/31 (77%), Positives = 24/31 (77%), Gaps = 2/31 (6%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPP--RPPP*PPPP 197 SP PPPP PPLPPPP PPPP PPP PPPP Sbjct: 204 SPPPPPPPPPLPPPPPPPPPPSPPPPSPPPP 234 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 SP PP P PP PPPP PPPP PPP PPPP+ Sbjct: 2544 SPPPPLPPPPSPPPPSPPPPSPPPSPPPPS 2573 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P + P PPPP PP P PP PPPP PPP PPPP Sbjct: 227 PPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPP 259 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P PPPP PP PPPP PPPP PPP PPP Sbjct: 224 PSPPPPSPPPPPPPSPPPPSPPPPPPP 250 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -1 Query: 295 PVLASP*PPPP*PPLP-PPP*PPPPRPPP*PPPPT 194 P+ P PPPP PP P PPP PPPP PPP PPPP+ Sbjct: 2548 PLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPS 2582 [194][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 A+P PPPP PP PPPP PPPP PP PPPP K Sbjct: 42 AAPPPPPPPPPPPPPPPPPPPPPPTPPPPPLPK 74 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -1 Query: 313 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 L AE P PPPP PP PPPP PPPP PPP P P T Sbjct: 36 LNNKAEAAPPPPPPPPPPPPPPPPPPPPPPTPPPPPLPKT 75 [195][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 A+P PPPP PP PPPP PPPP PP PPPP K Sbjct: 42 AAPPPPPPPPPPPPPPPPPPPPPPTPPPPPLPK 74 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -1 Query: 313 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 L AE P PPPP PP PPPP PPPP PPP P P T Sbjct: 36 LNNKAEAAPPPPPPPPPPPPPPPPPPPPPPTPPPPPLPKT 75 [196][TOP] >UniRef100_Q948Y7 VMP3 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y7_VOLCA Length = 687 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPP 200 P SP PP P PP PPPP PPPPRPPP PPP Sbjct: 637 PPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPP 668 [197][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = -1 Query: 307 ESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 E E + + PPPP PP PPPP PPPP PPP PPPP Sbjct: 408 ERTESEIFAAAPPPPPPPPPPPPPPPPPPPPPTPPPP 444 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 301 AEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +E A+P PPPP PP PPPP PPPP P P PPPP Sbjct: 412 SEIFAAAPPPPPPPPPPPPPPPPPPPPPTPPPPPP 446 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = -1 Query: 313 LQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 L+ + + A+ PPPP PP PPPP PPPP PP PPPP Sbjct: 407 LERTESEIFAAAPPPPPPPPPPPPPPPPPPPPPTPPPPP 445 [198][TOP] >UniRef100_UPI0001792863 PREDICTED: hypothetical protein n=1 Tax=Acyrthosiphon pisum RepID=UPI0001792863 Length = 840 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY----GGGGYGEANTGSA 302 GGG YGGGRGGGGYG GG GG GGGGYG G + Sbjct: 496 GGGNYGGGRGGGGYGSGGFGGSGGSGGGGGYGSGGFGGS 534 [199][TOP] >UniRef100_UPI000150401A hypothetical protein MGG_07033 n=1 Tax=Magnaporthe grisea 70-15 RepID=UPI000150401A Length = 645 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/44 (61%), Positives = 29/44 (65%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 332 GGGYGGG GGGYGGGG GGYGGGGYG GS + +W Sbjct: 605 GGGYGGG--GGGYGGGG-GGYGGGGYGGGGGGSYGNPGGGQSWW 645 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSA 302 GGGGYGGG GGGYGGGG GG GGG YG G + Sbjct: 611 GGGGYGGG--GGGYGGGGYGGGGGGSYGNPGGGQS 643 [200][TOP] >UniRef100_UPI0000DB7892 PREDICTED: similar to Osiris 16 CG31561-PA n=1 Tax=Apis mellifera RepID=UPI0000DB7892 Length = 796 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGYGGG GGGGYGGGG GGYGGGG G Sbjct: 594 GGGYGGG-GGGGYGGGGGGGYGGGGGG 619 [201][TOP] >UniRef100_UPI0001B7A53E UPI0001B7A53E related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7A53E Length = 1391 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +3 Query: 195 VGGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 VGGGGYGGG G GGY GGGSGGYGGGG G Sbjct: 1281 VGGGGYGGGGGSGGY-GGGSGGYGGGGGG 1308 [202][TOP] >UniRef100_Q7V3Q7 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus subsp. pastoris str. CCMP1986 RepID=Q7V3Q7_PROMP Length = 221 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGGSGGYGGGG 275 GGGYGGG GGGYGGGG GGYGGGG Sbjct: 142 GGGYGGGGNGGGYGGGGRGGYGGGG 166 [203][TOP] >UniRef100_Q46I49 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. NATL2A RepID=Q46I49_PROMT Length = 250 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = +3 Query: 198 GGGGYGGGRGG--GGYGGGGSGGYGGGGYG 281 G GGYGGG+GG GGYGGGG GGYGGGG G Sbjct: 110 GQGGYGGGQGGYGGGYGGGGQGGYGGGGQG 139 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGG--GGYGEANTG 296 GGGGYGGG G GGYGGGG GGYGG GGYG G Sbjct: 87 GGGGYGGG-GQGGYGGGGQGGYGGGQGGYGGGQGG 120 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/31 (77%), Positives = 24/31 (77%), Gaps = 3/31 (9%) Frame = +3 Query: 198 GGGGYGGGRGGGG---YGGGGSGGYGGGGYG 281 G GGYGGG GGGG YGGGG GGYGGGG G Sbjct: 117 GQGGYGGGYGGGGQGGYGGGGQGGYGGGGQG 147 [204][TOP] >UniRef100_Q8LPB1 Glycine-rich RNA-binding protein n=1 Tax=Physcomitrella patens RepID=Q8LPB1_PHYPA Length = 178 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEAN 290 GGGGYGG RGGGGYG GG GG G GG G N Sbjct: 139 GGGGYGGSRGGGGYGSGGGGGGGRGGSGSGN 169 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 6/41 (14%) Frame = +3 Query: 198 GGGGY------GGGRGGGGYGGGGSGGYGGGGYGEANTGSA 302 GGGGY GGG GGGGYGGGG GGYG GG G + S+ Sbjct: 92 GGGGYNNRQGGGGGYGGGGYGGGGGGGYGAGGGGAYGSRSS 132 [205][TOP] >UniRef100_Q75QN8 Cold shock domain protein 3 n=1 Tax=Triticum aestivum RepID=Q75QN8_WHEAT Length = 231 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 5/38 (13%) Frame = +3 Query: 198 GGGGYGGGRGG-----GGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GG GGYGGGG GGYGGGGYG G Sbjct: 98 GGGGYGGGGGGYGGGGGGYGGGG-GGYGGGGYGGGGGG 134 [206][TOP] >UniRef100_C5YSY6 Putative uncharacterized protein Sb08g022740 n=1 Tax=Sorghum bicolor RepID=C5YSY6_SORBI Length = 165 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 5/41 (12%) Frame = +3 Query: 198 GGGGYGGGR-----GGGGYGGGGSGGYGGGGYGEANTGSAD 305 GGGGYGGGR GGGGYGGGG GGYGGG G G++D Sbjct: 121 GGGGYGGGRGGYGGGGGGYGGGG-GGYGGGSRGGGGYGNSD 160 [207][TOP] >UniRef100_B4F7T1 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4F7T1_MAIZE Length = 254 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 6/34 (17%) Frame = +3 Query: 198 GGGGYGGGRGGGGY------GGGGSGGYGGGGYG 281 GGGGYGG GGGGY GGGGSGGYGGG YG Sbjct: 126 GGGGYGGAGGGGGYGGGHYGGGGGSGGYGGGDYG 159 [208][TOP] >UniRef100_B3LVU4 GF18623 n=1 Tax=Drosophila ananassae RepID=B3LVU4_DROAN Length = 164 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSA 302 GGGGYGGG GGG YGGGG GG GGGYG G + Sbjct: 82 GGGGYGGGYGGGSYGGGGYGGGYGGGYGGGYGGGS 116 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = +3 Query: 198 GGGGYGGGR-GGGGYGGG-GSGGYGGGGYG 281 GGGGYGGG GGGGYGGG G G YGGGGYG Sbjct: 72 GGGGYGGGGYGGGGYGGGYGGGSYGGGGYG 101 [209][TOP] >UniRef100_A6RAG1 Predicted protein n=1 Tax=Ajellomyces capsulatus NAm1 RepID=A6RAG1_AJECN Length = 608 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADS 308 GGGG GGG GGGG GGGG GG GG G ++ TGS DS Sbjct: 446 GGGGGGGGGGGGGGGGGGGGGGGGSGGTDSKTGSVDS 482 [210][TOP] >UniRef100_A4RD12 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4RD12_MAGGR Length = 1041 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG---SADSCNAR 320 G GGYGGGRGGGGYGGGG GGY G N G +S N+R Sbjct: 860 GRGGYGGGRGGGGYGGGGRGGYNGNNGNNNNGGHRNGVESYNSR 903 [211][TOP] >UniRef100_P27484 Glycine-rich protein 2 n=1 Tax=Nicotiana sylvestris RepID=GRP2_NICSY Length = 214 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 GGGG GGGRGGGGY GGGSGGYGGGG G Sbjct: 85 GGGGGGGGRGGGGY-GGGSGGYGGGGRG 111 [212][TOP] >UniRef100_A4RHF1 ATP-dependent RNA helicase DED1 n=1 Tax=Magnaporthe grisea RepID=DED1_MAGGR Length = 671 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/44 (61%), Positives = 29/44 (65%) Frame = +3 Query: 201 GGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 332 GGGYGGG GGGYGGGG GGYGGGGYG GS + +W Sbjct: 631 GGGYGGG--GGGYGGGG-GGYGGGGYGGGGGGSYGNPGGGQSWW 671 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSA 302 GGGGYGGG GGGYGGGG GG GGG YG G + Sbjct: 637 GGGGYGGG--GGGYGGGGYGGGGGGSYGNPGGGQS 669 [213][TOP] >UniRef100_C6XK60 OmpA/MotB domain protein n=1 Tax=Hirschia baltica ATCC 49814 RepID=C6XK60_HIRBI Length = 386 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -1 Query: 292 VLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +L +P PPP PP PPPP PPPP PPP PPPP Sbjct: 227 LLGAPAAPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 PPPP PP PPPP PPPP PPP PPP T Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPET 260 [214][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 286 ASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHK 188 A P PPP PP PPPP PPPP PPP PPPP K Sbjct: 240 AEPAAPPPPPPPPPPPPPPPPPPPPPPPPPPAK 272 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = -1 Query: 301 AEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSAFRNTRCKALAQ 140 AEP A P PPPP PP PPPP PPPP PPP P P +Q + F R A+ Sbjct: 240 AEPA-APPPPPPPPPPPPPPPPPPPPPPPPPPAKPAARQFVVYFDFDRSDLTAE 292 [215][TOP] >UniRef100_Q00TD0 Chromosome 17 contig 1, DNA sequence. (Fragment) n=1 Tax=Ostreococcus tauri RepID=Q00TD0_OSTTA Length = 281 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/50 (54%), Positives = 28/50 (56%), Gaps = 9/50 (18%) Frame = -1 Query: 319 RALQESAE---------PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +ALQE A P P PPPP PP PPPP PPPP PPP PPP Sbjct: 99 KALQEEAHASKSFQPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPP 148 [216][TOP] >UniRef100_A8J9H7 Mastigoneme-like flagellar protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J9H7_CHLRE Length = 1987 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PPP PP PPP PPPPRPPP PPPP Sbjct: 1885 PAPPSPNPPPTSPPPSPPPSPPPPRPPPPPPPP 1917 [217][TOP] >UniRef100_A8HYC3 Hydroxyproline-rich glycoprotein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HYC3_CHLRE Length = 612 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 SP PPPP PP PPPP PPPP PPP PPP Sbjct: 505 SPPPPPPLPPSPPPPSPPPPSPPPPSPPP 533 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P+ SP PP P PP PPPP PPPP PPP PPP Sbjct: 511 PLPPSPPPPSPPPPSPPPPSPPPPSPPPPAPPP 543 [218][TOP] >UniRef100_B9QH39 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii VEG RepID=B9QH39_TOXGO Length = 377 Score = 55.1 bits (131), Expect = 2e-06 Identities = 33/101 (32%), Positives = 40/101 (39%), Gaps = 6/101 (5%) Frame = -1 Query: 361 PKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP*PP------P 200 P++ +V A P SP PP P PP PPPP PPPP PPP PP P Sbjct: 33 PRSVEDPEVLPEEDEASSSLPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPVEDPLSP 92 Query: 199 PTHKQNMSAFRNTRCKALAQHCLEHALGSLVKRYTEASDSR 77 + ++S T + H G Y A D R Sbjct: 93 ESQTVDLSCLSGTTVRFFGP---SHHFGGFTPLYDPAPDKR 130 [219][TOP] >UniRef100_UPI00016C3DAE RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C3DAE Length = 144 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY-GGGGYGEANTG 296 GGGGYGGG GGGYGGGG GGY GGGGYG G Sbjct: 88 GGGGYGGG--GGGYGGGGGGGYGGGGGYGGGGGG 119 [220][TOP] >UniRef100_UPI000155CA4D PREDICTED: similar to DEAH (Asp-Glu-Ala-His) box polypeptide 9 n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155CA4D Length = 1325 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 5/47 (10%) Frame = +3 Query: 198 GGGGYG--GGRGGGGYGG---GGSGGYGGGGYGEANTGSADSCNARF 323 GGGGYG GG GGGGYGG GG GGYGGG +G N G + F Sbjct: 1240 GGGGYGGGGGYGGGGYGGGGYGGGGGYGGGNFGGGNYGGGNFGGGNF 1286 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = +3 Query: 198 GGGGYGGGR-GGGGYGGGGS---GGYGGGGYGEANTGSADSCNARF 323 GGGGYGGG GGGGYGGGG G +GGG YG N G + F Sbjct: 1246 GGGGYGGGGYGGGGYGGGGGYGGGNFGGGNYGGGNFGGGNFGGGNF 1291 [221][TOP] >UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI000155382B Length = 492 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/49 (53%), Positives = 28/49 (57%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWVTSA 344 GGGG GGG GGGG GGGG GG GGGG G G + WV+ A Sbjct: 408 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGQEPEQTWQGWVSDA 456 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGG GGG GGGG GGGGSGG GGGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGG 94 [222][TOP] >UniRef100_UPI0000025476 DEAH (Asp-Glu-Ala-His) box polypeptide 9 n=1 Tax=Mus musculus RepID=UPI0000025476 Length = 1383 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 296 GGGG+GGGRGGGG G GGSGG+ GGGGYG G Sbjct: 1244 GGGGFGGGRGGGGGGFGGSGGFGSGGGGYGVGGGG 1278 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +3 Query: 195 VGGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 VGGGGYGGG GGGGY GGGSGGYGGGG G Sbjct: 1274 VGGGGYGGG-GGGGY-GGGSGGYGGGGGG 1300 [223][TOP] >UniRef100_UPI00001EDBAC DEAH (Asp-Glu-Ala-His) box polypeptide 9 n=1 Tax=Mus musculus RepID=UPI00001EDBAC Length = 1384 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 296 GGGG+GGGRGGGG G GGSGG+ GGGGYG G Sbjct: 1245 GGGGFGGGRGGGGGGFGGSGGFGSGGGGYGVGGGG 1279 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +3 Query: 195 VGGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 VGGGGYGGG GGGGY GGGSGGYGGGG G Sbjct: 1275 VGGGGYGGG-GGGGY-GGGSGGYGGGGGG 1301 [224][TOP] >UniRef100_B6ID90 DEAH (Asp-Glu-Ala-His) box polypeptide 9 (Fragment) n=2 Tax=root RepID=B6ID90_9ZZZZ Length = 448 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGY--GGGGYGEANTG 296 GGGG+GGGRGGGG G GGSGG+ GGGGYG G Sbjct: 309 GGGGFGGGRGGGGGGFGGSGGFGSGGGGYGVGGGG 343 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +3 Query: 195 VGGGGYGGGRGGGGYGGGGSGGYGGGGYG 281 VGGGGYGGG GGGGY GGGSGGYGGGG G Sbjct: 339 VGGGGYGGG-GGGGY-GGGSGGYGGGGGG 365 [225][TOP] >UniRef100_Q3ANN6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. CC9605 RepID=Q3ANN6_SYNSC Length = 173 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSG--GYGGGGYGEANTGSADS 308 GGGGYGGG GGGGYGGGG G G GGGGYG G S Sbjct: 87 GGGGYGGG-GGGGYGGGGGGYRGGGGGGYGGGGAGDRPS 124 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGS 299 GGGGYGGG GGGY GGG GGYGGGG G+ +G+ Sbjct: 95 GGGGYGGG--GGGYRGGGGGGYGGGGAGDRPSGA 126 [226][TOP] >UniRef100_Q12FV9 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Polaromonas sp. JS666 RepID=Q12FV9_POLSJ Length = 134 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 3/36 (8%) Frame = +3 Query: 198 GGGGYGGG---RGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG G GGGGYG + G Sbjct: 94 GGGGYGGGGDRSGGGGYGGGGGGRSGGGGYGGGSGG 129 [227][TOP] >UniRef100_Q9FUD5 Glycine-rich RNA-binding protein n=1 Tax=Sorghum bicolor RepID=Q9FUD5_SORBI Length = 170 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 9/42 (21%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSG---------GYGGGGYGEANTG 296 GGGGYGG R GGGYGGGG G GYGGGGYG G Sbjct: 99 GGGGYGGRREGGGYGGGGGGYGGRREGGGGYGGGGYGGGGGG 140 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Frame = +3 Query: 198 GGGGYGGGR-GGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGG R GGGGYGGGG GG GGGGYG G Sbjct: 115 GGGGYGGRREGGGGYGGGGYGG-GGGGYGGRREG 147 [228][TOP] >UniRef100_Q6Z9M2 Putative uncharacterized protein P0002F11.29 n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z9M2_ORYSJ Length = 102 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +3 Query: 195 VGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADS 308 VGGGG GGG GGGG GGGGS G GG G G A ADS Sbjct: 19 VGGGGAGGGAGGGGIGGGGSRGGGGVGVGRAGGSGADS 56 [229][TOP] >UniRef100_C1MIF9 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MIF9_9CHLO Length = 432 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 6/34 (17%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGG------GGYG 281 GGGGYGGG GGGGYGGGG GGYGG GGYG Sbjct: 362 GGGGYGGG-GGGGYGGGGGGGYGGGPDRGRGGYG 394 [230][TOP] >UniRef100_C1E5B0 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E5B0_9CHLO Length = 1571 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGS 299 GGGG GGG GGGG GGGG GG GGGG G +N GS Sbjct: 419 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSNGGS 452 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +3 Query: 195 VGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSA 302 VGGGG GGG GGGG GGGG GG GGGG G + G + Sbjct: 417 VGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSNGGS 452 [231][TOP] >UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8HQ72_CHLRE Length = 338 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 4/37 (10%) Frame = +3 Query: 198 GGGGYGGGRGG----GGYGGGGSGGYGGGGYGEANTG 296 GGGG+GGG GG GGYGGGG GGYGGGG G G Sbjct: 94 GGGGFGGGGGGYGGGGGYGGGGGGGYGGGGGGYGGGG 130 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGGYGGG GGGGYGGGG GGYGGGG G G Sbjct: 107 GGGGYGGG-GGGGYGGGG-GGYGGGGGGYGGGG 137 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 5/42 (11%) Frame = +3 Query: 198 GGGGYGGGRGG-----GGYGGGGSGGYGGGGYGEANTGSADS 308 GGGGYGGG GG GGYGGGG GGYGGGG G G S Sbjct: 115 GGGGYGGGGGGYGGGGGGYGGGG-GGYGGGGGGSGGGGGGRS 155 [232][TOP] >UniRef100_Q59E37 CG32547 n=2 Tax=Drosophila melanogaster RepID=Q59E37_DROME Length = 1008 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/48 (56%), Positives = 30/48 (62%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYWVTS 341 GG G GGG GGGG GGGG GGYGGGG G GS + D +VT+ Sbjct: 23 GGAGGGGGGGGGGGGGGGLGGYGGGGSGGDAGGSGEKMKDVPDKYVTA 70 [233][TOP] >UniRef100_B7Q972 Secreted salivary gland peptide, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q972_IXOSC Length = 117 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/47 (55%), Positives = 29/47 (61%) Frame = +3 Query: 156 QRVFRNADMFCLCVGGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 Q++ N + L GGGG GGG GGGG GGGG GG GGGG G G Sbjct: 35 QKIEANKILLKLATGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 [234][TOP] >UniRef100_B7P671 Cement protein, putative n=1 Tax=Ixodes scapularis RepID=B7P671_IXOSC Length = 324 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNARFDYW 332 GGGG GGG GGGG GGGG GG GGGG G G YW Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGXXKEIIYW 179 [235][TOP] >UniRef100_B5KFE3 KRMP-5 n=1 Tax=Pinctada margaritifera RepID=B5KFE3_PINMG Length = 144 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/50 (58%), Positives = 30/50 (60%), Gaps = 9/50 (18%) Frame = +3 Query: 183 FCLCVGGGGYGG-------GRGGGGYGGGG--SGGYGGGGYGEANTGSAD 305 +CL GGGYGG G GGGGYGGGG GGYGGGGYG G D Sbjct: 57 WCLKRYGGGYGGYDYGDGGGYGGGGYGGGGYGGGGYGGGGYGGGYDGGYD 106 [236][TOP] >UniRef100_B3NUR4 GG19208 n=1 Tax=Drosophila erecta RepID=B3NUR4_DROER Length = 329 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = +3 Query: 204 GGYGGGRGGGGYGGG--GSGGYGGGGYGEANTG 296 GGY GG GGGGYGGG G GGYGGGGYG G Sbjct: 84 GGYSGGHGGGGYGGGGYGGGGYGGGGYGGGGYG 116 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 11/44 (25%) Frame = +3 Query: 198 GGGGY---------GGGRGGGGYGGG--GSGGYGGGGYGEANTG 296 GGGGY GGG GGGGYGGG G GGYGGGGYG G Sbjct: 78 GGGGYSGGYSGGHGGGGYGGGGYGGGGYGGGGYGGGGYGGGGGG 121 [237][TOP] >UniRef100_Q875A9 Similar to snoRNP protein gar1 of Schizosaccharomyces pombe n=1 Tax=Podospora anserina RepID=Q875A9_PODAN Length = 199 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGG+GGGRGGGG+GGG GG GG G+G G Sbjct: 150 GGGGFGGGRGGGGFGGGRGGGRGGSGFGGRGGG 182 [238][TOP] >UniRef100_B2VLB0 Predicted CDS Pa_5_5520 n=1 Tax=Podospora anserina RepID=B2VLB0_PODAN Length = 213 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTG 296 GGGG+GGGRGGGG+GGG GG GG G+G G Sbjct: 164 GGGGFGGGRGGGGFGGGRGGGRGGSGFGGRGGG 196 [239][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPP 197 PPPP PP PPPP PPPP PPP PPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPP 485 [240][TOP] >UniRef100_Q9Q5L3 EBNA-2 n=1 Tax=Macacine herpesvirus 4 RepID=Q9Q5L3_9GAMA Length = 605 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = -1 Query: 307 ESAEPVLASP*PPPP*PPLPPPP*P--PPPRPPP*PPPPTHKQNM 179 E + V +P PPPP PPLPPPP P PPP PPP PPP ++++ Sbjct: 56 EGPQTVPGAPPPPPPPPPLPPPPPPPLPPPPPPPVQPPPPERRDV 100 [241][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPPTHKQNMSA 173 P ASP PPPP PP P PP PPPP PPP P PP+ SA Sbjct: 199 PPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSA 239 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/34 (70%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = -1 Query: 295 PVLASP*PPPP*P-PLPPPP*PPPPRPPP*PPPP 197 P ASP PPPP P PPPP PPPP PPP PPPP Sbjct: 190 PSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPP 223 [242][TOP] >UniRef100_A3WBS5 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBS5_9SPHN Length = 378 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPP 197 PPPP PP PPPP PPPP PPP PPPP Sbjct: 232 PPPPPPPPPPPPPPPPPLPPPAPPPP 257 [243][TOP] >UniRef100_A3WBR8 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBR8_9SPHN Length = 378 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -1 Query: 274 PPPP*PPLPPPP*PPPPRPPP*PPPP 197 PPPP PP PPPP PPPP PPP PPPP Sbjct: 231 PPPPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -1 Query: 283 SP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +P PPPP PP PPPP PPPP PPP PP P Sbjct: 230 APPPPPPPPPPPPPPPPPPPPPPPPPPAP 258 [244][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PPPP PP P PP PPPP PPP PPPP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PPPP PP P PP PPPP PPP PPPP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/74 (40%), Positives = 33/74 (44%), Gaps = 2/74 (2%) Frame = -1 Query: 412 TNTRGIGKKTFAATCTRPKTQHQADVTQ*SKRALQESAEPVLASP*PPPP*PPLPP--PP 239 TN G G T CT A + ++ P PPPP PP PP PP Sbjct: 159 TNRGGQGCTTLQQLCTSAGLPAGTCTVATYDAACDCCPQNIVVEPQPPPPPPPPPPPSPP 218 Query: 238 *PPPPRPPP*PPPP 197 PPPP PPP PPPP Sbjct: 219 PPPPPPPPPSPPPP 232 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -1 Query: 298 EPVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 +P P PPPP PP PPPP PPPP PPP PPPP Sbjct: 204 QPPPPPPPPPPPSPPPPPPP-PPPPSPPPPPPPP 236 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP P P PPPP Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P P PPPP PP PPPP PPPP P P PPPP Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PPP PPPP+ Sbjct: 234 PPPPPPSPPPPPPP-PPPPSPPPPPPPPS 261 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP PP PPPP PPPP PPP PPPP Sbjct: 222 PPPPPPSPPPPPPP-PPPPSPPPPPPPP 248 [245][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -1 Query: 295 PVLASP*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P SP PPPP PP P PP PPPP PPP PPPP Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/64 (45%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = -1 Query: 379 AATCTRPKTQHQAD---VTQ*SKRALQESAEPVLASP*PPPP*PPLPPPP*PPPPRPPP* 209 A TCT D ++ SK P SP P PP PP PPPP PPPP P P Sbjct: 181 AGTCTAAMYDTACDCCPTSRASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPP 240 Query: 208 PPPP 197 PPPP Sbjct: 241 PPPP 244 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPP 197 P PPPP P PPPP PPPP PPP PPPP Sbjct: 219 PSPPPPPSPPPPPPPPPPPSPPPPPPPP 246 [246][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 280 P*PPPP*PPLPPPP*PPPPRPPP*PPPPT 194 P PPPP PP PPPP PPPP PPP PPPPT Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPP-PPPPT 171 [247][TOP] >UniRef100_UPI0000F2CB43 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2CB43 Length = 252 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADS 308 GGGG GGG GGGG GGGG GG GGGG G + GS+ S Sbjct: 192 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSS 228 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNA 317 GGGG GGG GGGG GGGG GG GGGG G GS S ++ Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSS 228 [248][TOP] >UniRef100_Q11SF1 RNA binding protein n=1 Tax=Cytophaga hutchinsonii ATCC 33406 RepID=Q11SF1_CYTH3 Length = 143 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = +3 Query: 198 GGGGY-GGGRGGGGYGG--GGSGGYGGGGYGEANTGSADSCNARFD 326 GGGGY GGG GGGGYGG G GGYGGGG GS N+R D Sbjct: 97 GGGGYSGGGNGGGGYGGNRSGGGGYGGGGNSRGFGGSGTGRNSRGD 142 [249][TOP] >UniRef100_D0CMI9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. WH 8109 RepID=D0CMI9_9SYNE Length = 190 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/32 (78%), Positives = 25/32 (78%), Gaps = 4/32 (12%) Frame = +3 Query: 198 GGGGYGGG----RGGGGYGGGGSGGYGGGGYG 281 GGGGYGGG RGGGGYGGGG GG GGGG G Sbjct: 92 GGGGYGGGGGGYRGGGGYGGGGGGGGGGGGGG 123 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCNAR 320 GGGGYGGG GGGG GGGG GGY GGG G G AR Sbjct: 105 GGGGYGGGGGGGG-GGGGGGGYAGGGGGGGYAGGDRPSGAR 144 [250][TOP] >UniRef100_Q69XV3 Os06g0622400 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q69XV3_ORYSJ Length = 321 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSADSCN 314 GGGG GGG GGGG GGGG GG GGGG G G D N Sbjct: 117 GGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDN 155 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 198 GGGGYGGGRGGGGYGGGGSGGYGGGGYGEANTGSAD 305 GGGG GGGRGGGG GGGG GG GGGG G G + Sbjct: 113 GGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGN 148