[UP]
[1][TOP] >UniRef100_A8J6R1 Predicted protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J6R1_CHLRE Length = 562 Score = 73.9 bits (180), Expect = 5e-12 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = +3 Query: 78 KEAGGGEALGGLGGRTGKLSWGRAMRRTVARWYLDKTAAAVAY 206 KE G A GLGGRTGKLSWGRAMRRTVARWYLDKTAAAVAY Sbjct: 127 KEVG---AAAGLGGRTGKLSWGRAMRRTVARWYLDKTAAAVAY 166 [2][TOP] >UniRef100_C1E6Z7 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E6Z7_9CHLO Length = 246 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/47 (61%), Positives = 30/47 (63%), Gaps = 2/47 (4%) Frame = -3 Query: 154 RMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRP--PPRPPRPP 20 RM P P PP PPS PP+ PPRPPRPPRP PPRPPRPP Sbjct: 157 RMIPPSPPTPPSPPTPPSPPSPPSPPSPPRPPRPPRPPRPPRPPRPP 203 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PPS PP PPRPPRPPR PPRPPRPP Sbjct: 167 PSPPTPPSPPSPPSPPSPPRPPRPPRPPRPPR-PPRPPRPP 206 [3][TOP] >UniRef100_B7Z562 cDNA FLJ59041 n=1 Tax=Homo sapiens RepID=B7Z562_HUMAN Length = 218 Score = 63.5 bits (153), Expect = 7e-09 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P +PPRP +PP LPPPRPP+PP PPPRPP+PP Sbjct: 36 PPKPPRPLPPNPPRPPLPPPRPPKPPLPPPRPPKPP 71 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PPR P P P PP PPRPP PPPRPP+PP Sbjct: 26 PPLPPRKPPRPPKPPRPLPPNPPRPPLPPPRPPKPP 61 [4][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/48 (52%), Positives = 29/48 (60%) Frame = -3 Query: 163 TVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 T+ P + P+ PP PP PPP +PPP PP PP PPP PPRPP Sbjct: 358 TLTTSTSPVPTTPLPPPPPPLPPPPPRPVPPPAPPPPPPPPPPPPRPP 405 [5][TOP] >UniRef100_Q01AC1 Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01AC1_OSTTA Length = 872 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 121 RPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RPP PP SPPP S PPP PP PP PPP PP PP Sbjct: 560 RPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPP 593 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP PPP PP PP PPP P PP Sbjct: 571 PPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPP 603 [6][TOP] >UniRef100_B6INW7 R body protein, putative n=1 Tax=Rhodospirillum centenum SW RepID=B6INW7_RHOCS Length = 157 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDG 14 P PP PP+ PPP PPP PP PP PPP PP PP G Sbjct: 118 PAPPPAPPAPPPPPPPAPPPAPPAPPPPPPPPPPPPPG 155 [7][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/52 (53%), Positives = 29/52 (55%) Frame = -3 Query: 175 YQRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 +Q V R A P P PP PP SPPP S PPP PP PP P P PP PP Sbjct: 164 HQCCPVTRGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 215 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP P PPP PP PP Sbjct: 206 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP P PPP PP PP Sbjct: 211 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 246 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP PPP P PP Sbjct: 185 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 220 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 251 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 256 [8][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 58.9 bits (141), Expect(2) = 9e-08 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP P PPP PPRPP Sbjct: 286 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPP 321 Score = 20.8 bits (42), Expect(2) = 9e-08 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PPRPP P S P Sbjct: 281 PPRPPPPPPPSPP 293 Score = 58.9 bits (141), Expect(2) = 1e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PPRPP SPPP S PPP PP P PPP PP PP Sbjct: 346 PPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 381 Score = 20.4 bits (41), Expect(2) = 1e-07 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 204 TPPRPPSCPGTSGPR 160 +PP PPS P PR Sbjct: 337 SPPPPPSPPPPPPPR 351 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P RPP PP SPPP S PPP PP P PPP PP PP Sbjct: 281 PPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 316 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPP---RPPPRPPRPP 20 P PPRPP SPPP S PPP PP PP PPP PPRPP Sbjct: 382 PPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPP 420 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PPRPP SPPP S PPP PP PP PP PP PP Sbjct: 314 PPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPP 349 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PPRPP P P PP PP Sbjct: 299 PPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPP 331 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP + PPP S PPP PPRPP P P PP PP Sbjct: 328 PSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPP 363 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 232 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 264 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 237 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 269 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPP---RPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP PPRPP Sbjct: 354 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPP 389 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 242 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 274 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP P PP Sbjct: 247 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 279 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 294 PPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPP 326 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP S PPP PP P PPP PP PP Sbjct: 341 PPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPP 376 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP P PP Sbjct: 359 PPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 391 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP S PPP PP P PPP PP PP Sbjct: 377 PPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPP 412 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP P PP Sbjct: 390 PPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 422 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP P PPP S PPP PPRPP P P PP PP Sbjct: 364 PPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPP 399 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP P PPP S PPP PPRPP P P PP PP Sbjct: 395 PPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPP 430 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP P P PP PPRPPP PP P Sbjct: 257 PPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSP 292 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP PPPRPP PP P P PP PP Sbjct: 265 PPSPPPPPPPSPPPP--PPPRPPPPPPPSPPPPSPP 298 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPP--RPPRPPPRPPRPP 20 P S P P PPS PPP PPP PP PP PPPRPP PP Sbjct: 246 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPP 288 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP P PPP S PPP PPRPP PPP P PP Sbjct: 260 PPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPP 295 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/37 (62%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRP-PPRPPRPP 20 P PP PP PPP S PPP PP PP P PP PP PP Sbjct: 309 PPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPP 345 [9][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP+ PPPA PPP PP PP PPP PP PP Sbjct: 647 PPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPP 682 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP+ +PPPA PPP PP P PPP PP PP Sbjct: 653 PPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPP 688 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -3 Query: 148 ARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 A P P PP PP A PPP + PPP PP PP PPP PP PP Sbjct: 619 APPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPP-PPPAPPPPP 660 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/50 (54%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 148 ARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRP-PPRPPRPPDGAAGA 2 A P + P PP PP PPPA PPP PP PP P PP PP PP A A Sbjct: 614 APPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPA 663 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/41 (53%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P P PP+ +PPPA PPP PP PP PPP P PP Sbjct: 604 PPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPP 644 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP+ PPPA PPP P PP PPP PP PP Sbjct: 644 PPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPP 676 [10][TOP] >UniRef100_Q5VR02 Hydroxyproline-rich glycoprotein-like n=1 Tax=Oryza sativa Japonica Group RepID=Q5VR02_ORYSJ Length = 1026 Score = 57.4 bits (137), Expect(2) = 1e-07 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LS P PP PP+ SPP A LPPP P PP PPP PP PP Sbjct: 539 PALSPPAPPPPPPAPSPP-APLPPPPAPSPPAPPPPPPPPP 578 Score = 21.6 bits (44), Expect(2) = 1e-07 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 204 TPPRPPSCPGTSGP 163 +PP PPS P S P Sbjct: 519 SPPAPPSPPAPSPP 532 [11][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P PP PP PPP PPP PP PP PPP PP PP G G Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGG 83 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P PP PP PPP PPP PP PP PPP PP PP G Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGG 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P PP PP PPP PPP PP PP PPP PP PP G Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGG 81 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P PP PP PPP PPP PP PP PPP PP PP G Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 80 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [12][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -3 Query: 130 LPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 LP RPP PP PPP PPP PP PP PPP PP PP Sbjct: 23 LPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P L P PP PP PPP PPP PP PP PPP PP PP Sbjct: 20 PHLLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RP P PP PP PPP PPP PP PP PPP PP PP Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P+ P PP PP PPP PPP PP PP PPP PP PP Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 100 [13][TOP] >UniRef100_Q5I2R0 Minus agglutinin n=1 Tax=Chlamydomonas incerta RepID=Q5I2R0_CHLIN Length = 4027 Score = 55.1 bits (131), Expect(2) = 2e-07 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 PP+PP PP ASLPPP P+PP+P PRPP P Sbjct: 700 PPQPPPLPPPVASLPPPPSPKPPKPSPRPPSP 731 Score = 23.5 bits (49), Expect(2) = 2e-07 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 Query: 201 PPRPPSCPGTSGPRCDAW 148 PPRPP P + G AW Sbjct: 668 PPRPPLPPTSPGKWAGAW 685 [14][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 55.1 bits (131), Expect(2) = 2e-07 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 278 PPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPP 313 Score = 23.5 bits (49), Expect(2) = 2e-07 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -1 Query: 201 PPRPPSCPGTSGPRC 157 PP PP CP P C Sbjct: 247 PPPPPPCPPPCPPPC 261 Score = 54.7 bits (130), Expect(2) = 1e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 290 PPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPP 330 Score = 21.2 bits (43), Expect(2) = 1e-06 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PP PP CP P Sbjct: 240 PPAPPPCPPPPPP 252 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/36 (58%), Positives = 21/36 (58%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP P PPP PP PP Sbjct: 237 PCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPP 272 [15][TOP] >UniRef100_Q6IMV8 Transposase n=1 Tax=Oryza sativa Indica Group RepID=Q6IMV8_ORYSI Length = 361 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/41 (65%), Positives = 28/41 (68%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S PV PPRPP+ S PPAS PPP P PP PPP PP PP Sbjct: 84 PAPSPPVPPPRPPAPS-PPASQPPPPAPSPPAPPPPPPPPP 123 [16][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/46 (54%), Positives = 27/46 (58%) Frame = -3 Query: 157 RRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 R +A P P PP PP PPP+ PPP PP PP PPP PP PP Sbjct: 218 RPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 [17][TOP] >UniRef100_A4RWC6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RWC6_OSTLU Length = 4003 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP+ PPP PP PP PPP PP PP Sbjct: 1549 PSPPPSPPPPSPPPSPPPPPPPPSPPPPPPSPPPPP 1584 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAA 8 P PP PPS PPP S PPP PP PP PP PP PP A Sbjct: 1564 PPPPPPPPSPPPPPPS-PPPPPPSPPPSPPSPPPPPPAKA 1602 [18][TOP] >UniRef100_B4JNX2 GH24906 n=1 Tax=Drosophila grimshawi RepID=B4JNX2_DROGR Length = 281 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -3 Query: 148 ARPQLSLPV-RPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 ARP + P RPP+PP+ P P PPP PPRPP PPP PP P Sbjct: 76 ARPPVEEPAPRPPKPPAPPPRPPPPPPPPPPRPPAPPPAPPAP 118 [19][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP+S PPP PP PP PPP PP PP Sbjct: 1 PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPP 36 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP S PPP PP P PPP PP PP Sbjct: 54 PSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPP 89 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Frame = -3 Query: 142 PQLSLPVRPPRPP-----SASPPPASLPPPRPPRPPRPPPRPPRP 23 P LS P PP PP S PPP S PPP PP PP PPP PP P Sbjct: 124 PPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPP 168 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRP-PPRPPRPP 20 PP PPS PPP S PPP PP PP P PP PP PP Sbjct: 19 PPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P L P PP PS+ PPP PPP P PP PPP PP PP Sbjct: 99 PPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPP 139 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRP--PRPPRPPPRPPRPP 20 PP PPS PPP S PPP P P PP PPP PP PP Sbjct: 50 PPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPP 84 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/46 (52%), Positives = 25/46 (54%), Gaps = 5/46 (10%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPP-----RPPPRPPRPP 20 P LP PP PP + PPP PPP PP PP PPP PP PP Sbjct: 106 PPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPP 151 [20][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGA 11 P PP PP PPP PPP PP PP PPP PP PP GA Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGA 964 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAGA 2 P PP PP PPP PPP PP PP PPP PP PP GA Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGA 964 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 [21][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LP PP PP SPPP S PPP PP PP P P PP PP Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPP 250 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDG 14 P PP PP SPPP S PPP PP PP PPP P P G Sbjct: 228 PPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPTG 265 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 2711 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2745 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP PP PPP PP P Sbjct: 2687 PSPPPSPPPPSPPPPSPPPPSPP-PPSPPPSPPPP 2720 [22][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LP PP PP SPPP S PPP PP PP PPP PP PP Sbjct: 218 PPSPLPPSPPPPPPPSPPP-SPPPPPPPPPPSPPPSPPPPP 257 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP+ PPP PP PP PPP PP PP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P PP PP PPP PPP PP PP PPP PP PP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP S PPP PP PP PPP PP PP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP PPP PP PP PPP PP PP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP + PPP PPP PP PP PPP PP PP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 232 PSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP+ PPP PP PP PPP PP PP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP + PPP PPP PP PP PPP PP PP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P PP PP + PP PPP PP PP PPP PP PP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPP 274 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS P P PPP PP PP PPP PP PP Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P PP PP PPP PPP P PP PPP PP PP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 [23][TOP] >UniRef100_A9TWI4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWI4_PHYPA Length = 818 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/43 (58%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPP--RPPRPPRPPPRPPRPP 20 P+ +LP PP PP SPPP PPP PP PP PPP PP PP Sbjct: 475 PECTLPPPPPSPPPPSPPPPPSPPPPSPPPPPPSPPPPPPSPP 517 Score = 53.9 bits (128), Expect(2) = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PPS PPP S PPP PP PP P P PP P Sbjct: 500 PSPPPPPPSPPPPPPSPPPPSPPPPPSPSPPPPAP 534 Score = 20.4 bits (41), Expect(2) = 3e-06 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 204 TPPRPPSCPGTSGP 163 +PP PPS P S P Sbjct: 490 SPPPPPSPPPPSPP 503 [24][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/48 (54%), Positives = 27/48 (56%) Frame = -3 Query: 163 TVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 T RR A + P PP PP PPP PPP PP PP PPP PP PP Sbjct: 65 TSRRPAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/52 (46%), Positives = 26/52 (50%) Frame = -3 Query: 181 SRYQRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPR 26 ++ R M P P PP PP PPP PPP PP PP PPP PPR Sbjct: 63 AKTSRRPAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 114 [25][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP + PPP S PPP PP PP PPP PP PP Sbjct: 150 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPP 185 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP PPP PP PP PPP PP PP Sbjct: 157 PPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 192 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP PPP PP PP PPP PP PP Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 198 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP + PPP PPP PP PP PPP PP PP Sbjct: 164 PSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 199 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PPS PPP PPP PP PP PPP PP PP Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP PPP PP P PPP PP PP Sbjct: 135 PPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPP 170 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP + PPP S PPP PP PP PP PP PP Sbjct: 136 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPP 171 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP PPP P PP PPP PP PP Sbjct: 143 PPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPP 178 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP PPP PP P PPP PP PP Sbjct: 149 PPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPP 184 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/37 (59%), Positives = 22/37 (59%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P PP PP PPP PPP PP PP PPP PP P D Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVD 204 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PPS PPP PPP P PP PPP PP PP Sbjct: 132 PPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPP 164 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PPS PPP+ PPP P PP PPP PP PP Sbjct: 154 PPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPP 186 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P PP P PPP PPP PP PP PPP PP PP Sbjct: 162 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 202 [26][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PV PP PP +PPP PPP PP PP PPP PP PP Sbjct: 127 PVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPP 162 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAGA 2 P + LP PP PP PPP LPPP PP PP P P PP PP A A Sbjct: 189 PPMCLP--PPPPPPPPPPPCPLPPPPPPCPPPPAPCPPPPPPPACPA 233 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/41 (53%), Positives = 22/41 (53%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PP PPP PP PP PP PPP PP PP Sbjct: 115 PPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPP 155 [27][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 133 SLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 SLP PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP PPP PPP PP PP PPP PPRP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [28][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PV PP PP PPP PPP PP PP PPP PP PP Sbjct: 94 PVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/41 (65%), Positives = 27/41 (65%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P RPP PPS SPP PP PPRPPR PPRPPR P A G Sbjct: 348 PPRPP-PPSPSPPKPPPPPSPPPRPPRRPPRPPRRPPTAPG 387 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 108 PPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP + PPP PPP PP PP PPP PP PP Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPP 136 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPP-PRPPRPPRPPPRPPRPP 20 P +PP PPS SPPP PP P PP PP PPP PP PP Sbjct: 76 PPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPP 112 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = -3 Query: 118 PPRPPSASPPPASLPPP--RPPRPPRPPPRPPRPP 20 PPRPP SPPP PPP PPRPP P P PP+PP Sbjct: 328 PPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPP 362 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 82 PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPP 122 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 5/38 (13%) Frame = -3 Query: 118 PPRPPSASP-----PPASLPPPRPPRPPRPPPRPPRPP 20 PPRPP SP PP S PP+PP PP PPPRPPR P Sbjct: 338 PPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPPRRP 375 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = -3 Query: 142 PQLSLPVRP-PRPPSASPPPASLPPP--RPPRPPRPPPRPPRPP 20 P+ S P P PRPP +PPP PPP PPRPP P P PPRPP Sbjct: 299 PKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPP 342 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P PP PPS PPP PPP P PP PPP PP PP+ Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPN 138 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP PPP PP PP PPP PP PP Sbjct: 114 PPPPPPPPPPSPPPP--PPPPPPPPPNPPPPPPPPP 147 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/41 (53%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P +P PP PP PPP+ PPP PP PP P P PP PP Sbjct: 91 PPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPP 131 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP PPP PP PP PPP PP PP Sbjct: 100 PPPPPPPPPPSPPPP--PPPPPPPPPSPPPPPPPPP 133 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/36 (58%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP + PPP PPP PP PP PPP PP P Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSP 150 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP PPP + PPPRPP P PPP PP P Sbjct: 235 PFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPP 269 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPP--RPPRPPPRPPRPP 20 PPRPP SP P PPP PP RPP P P PPRPP Sbjct: 318 PPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPP 352 [29][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RP P PP PPS PPP+ PPP PP PP PPP P PP Sbjct: 516 RPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 557 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/45 (53%), Positives = 26/45 (57%) Frame = -3 Query: 154 RMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 R + P P PP PPS PPP+ PPP PP PP PPP P PP Sbjct: 519 RPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 563 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP+ PPP PP PP PPP P PP Sbjct: 534 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 569 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP+ PPP PP PP PPP P PP Sbjct: 540 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 575 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP+ PPP PP PP PPP P PP Sbjct: 546 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 581 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP+ PPP P PP PPPR PRPP Sbjct: 564 PPSPPPPPSPPPPPSPPPPPSPRHPPSPPPR-PRPP 598 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/41 (56%), Positives = 24/41 (58%), Gaps = 5/41 (12%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPP-----RPPRPP 20 P PP PPS PPP+ PPP PP PP PPP PP PP Sbjct: 552 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPP 592 [30][TOP] >UniRef100_A8HYC3 Hydroxyproline-rich glycoprotein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HYC3_CHLRE Length = 612 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPPRPP PP Sbjct: 523 PPSPPPPSPPPPSPPPPAPPPPSPPPPRPPPPP 555 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRP--PRPPDGAA 8 PP PP +PPP S PPPRPP PPR PP+P P PPD A Sbjct: 533 PPSPPPPAPPPPSPPPPRPPPPPRLPPKPPSPMPPDWPA 571 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 510 PPLPPSPPPPSPPPPSPPPPSPPPPSPPPPAPPPP 544 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPR--PPRPPRPPPRPPRPP 20 P L PP PP SPPP S PPP PP PP P P PPRPP Sbjct: 510 PPLPPSPPPPSPPPPSPPPPSPPPPSPPPPAPPPPSPPPPRPP 552 [31][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P+ +P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/52 (46%), Positives = 28/52 (53%) Frame = -3 Query: 175 YQRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 Y + +A ++ P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 YPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 51 PPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPP 86 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 66 PCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP PPP PPP PP PP PPP PPRP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 57 PPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP PPP PPP PP PP PPP PPRP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 104 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGA 11 P PP PP PPP PPP PP PP PPPRP PP A Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPA 111 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPPRP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPP 70 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PPRP P PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PPRP PPP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPP 77 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPPRP PP PPP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPP 80 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PPRP PPP PPP PP PP PPP PP PP Sbjct: 60 PPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P RP PP PPP PPP PP PP PPP PP PP Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP PPP PPP PP PP PPP PP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/51 (47%), Positives = 25/51 (49%) Frame = -3 Query: 175 YQRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 Y R+ P P PP PP PPP PPP PP PP PPP PP P Sbjct: 14 YTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 [32][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LP PP PPS PPP S PPP PP PP PPP PP PP Sbjct: 216 PPPPLPPSPP-PPSPPPPPPSPPPPLPPPPPPPPPPPPPPP 255 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP PPP PP PP PPP PP PP Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LP PP PP PPP PPP PP PP PPP PP PP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P L P PP PP PPP PPP PP PP PPP PP PP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P PP PP PPP PPP PP PP PPP PP PP Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP LPP PP PP PPP PP PP Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -3 Query: 133 SLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 S P P PP SPPP PPP PP PP PPP PP PP Sbjct: 223 SPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 21/35 (60%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP PPP PPP PP PP PPP PP P Sbjct: 673 PPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 [33][TOP] >UniRef100_C5YV28 Putative uncharacterized protein Sb09g027730 n=1 Tax=Sorghum bicolor RepID=C5YV28_SORBI Length = 408 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPP-PRPPRPPRPPPRPPRPP 20 P + P PP PP+A+PPP+ PP PRPP P RPPPRPP PP Sbjct: 7 PSPAAPPAPP-PPAAAPPPSPAPPWPRPPPPLRPPPRPPPPP 47 [34][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P L P PP PP PPP PPP PP PP PPP PP PP+ Sbjct: 29 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LP PP PP PPP PPP PP PP PPP PP PP Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = -3 Query: 154 RMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 R+ P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 RVDPPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 23 PPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 [35][TOP] >UniRef100_Q1EPA3 Protein kinase family protein n=1 Tax=Musa acuminata RepID=Q1EPA3_MUSAC Length = 648 Score = 56.2 bits (134), Expect(2) = 5e-07 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -3 Query: 142 PQLSLPVR--PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGA 11 P LS P PPRPPSASPPPA+ PPP PP PP P PP A Sbjct: 86 PALSPPPASTPPRPPSASPPPAAAPPPPPPSATPPPTNSPPPPPSA 131 Score = 20.8 bits (42), Expect(2) = 5e-07 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PP PPS P S P Sbjct: 40 PPTPPSPPPASPP 52 [36][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP P P PP PP Sbjct: 415 PPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPP 450 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 PP PP SPPP S PPP PP PP PPP PP P Sbjct: 131 PPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPP 162 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 231 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 263 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 285 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 317 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 341 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 373 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 387 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 419 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP P PP Sbjct: 397 PPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPP 429 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP PP PP Sbjct: 290 PPSPPPPSPPPPSPPPPSPP-PPSPPPPPPSPP 321 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP PP PP Sbjct: 346 PPSPPPPSPPPPSPPPPSPP-PPSPPPPPPSPP 377 Score = 54.3 bits (129), Expect(2) = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 433 PPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 467 Score = 20.4 bits (41), Expect(2) = 3e-06 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 204 TPPRPPSCPGTSGP 163 +PP PPS P S P Sbjct: 414 SPPPPPSPPPPSPP 427 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP P SPPP S PPP PP P PPP PP PP Sbjct: 113 PTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 153 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRP-PRPPPRPPRPP 20 PP PP SPPP S PPP PP P P PPP PP PP Sbjct: 126 PPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPP 159 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 158 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 192 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRP-PRPPPRPPRPP 20 PP PP SPPP S PPP PP P P PPP PP PP Sbjct: 236 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPP 269 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPP-PRPPRPP 20 PP PP SPPP S PPP PP PP PP P PP PP Sbjct: 241 PPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPP 274 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 262 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 296 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 318 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 352 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 374 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 408 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P P PPS PPP+ PPP PP PP P P PP PP Sbjct: 135 PPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPP 175 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 153 PSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 187 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 257 PSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 291 Score = 52.8 bits (125), Expect(2) = 7e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 PP PP SPPP S PPP PP P PPP PP P Sbjct: 441 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 472 Score = 20.4 bits (41), Expect(2) = 7e-06 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PP PPS P S P Sbjct: 433 PPSPPSPPPPSPP 445 [37][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P + P PP PP PPP PPP PP PP PPP PP PP Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P PP PP PPP PPP PP PP PPP PP PP+ Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPE 364 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/37 (59%), Positives = 22/37 (59%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P PP PP PPP PPP PP PP PPP PP PD Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPD 370 [38][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP S PPP PP PP PPP PP PP Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPP 524 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP PPP PP PP PPP PP PP Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/38 (57%), Positives = 23/38 (60%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDG 14 P PP P PPP+ PPP PP PP PPP PP PP G Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPG 535 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP PPP PP PP PPP PP P Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP PPP PP PP PPP PP PP Sbjct: 494 PPPPPPPPPPSPPPP--PPPSPPPPPPPPPPPPPPP 527 [39][TOP] >UniRef100_Q7XSN2 OSJNBb0028M18.5 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XSN2_ORYSJ Length = 927 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASP--PPASLPPPRPPRPPRPPPRPPRPP 20 P S PV PPRPP+ SP PP P P PP PP PPP PP PP Sbjct: 452 PAQSPPVPPPRPPAQSPPAPPPPPPAPSPPAPPLPPPPPPPPP 494 [40][TOP] >UniRef100_Q01MU7 OSIGBa0102O13.9 protein n=1 Tax=Oryza sativa RepID=Q01MU7_ORYSA Length = 902 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASP--PPASLPPPRPPRPPRPPPRPPRPP 20 P S PV PPRPP+ SP PP P P PP PP PPP PP PP Sbjct: 428 PAQSPPVPPPRPPAQSPPAPPPPPPAPSPPAPPLPPPPPPPPP 470 [41][TOP] >UniRef100_Q7XME8 OSJNBa0061G20.11 protein n=2 Tax=Oryza sativa RepID=Q7XME8_ORYSJ Length = 540 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASP--PPASLPPPRPPRPPRPPPRPPRPP 20 P S PV PPRPP+ SP PP P P PP PP PPP PP PP Sbjct: 156 PAPSPPVPPPRPPAPSPPAPPPPPPAPSPPAPPAPPPPPPPPP 198 [42][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP PPP PPP PP PP PPPRPP PP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPTPPPPPPRPPSPP 452 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP PPP PPP PP PP PPP PPRPP Sbjct: 419 PPPPPPPPPPPP--PPPPPPPPPTPPPPPPRPP 449 [43][TOP] >UniRef100_A8IGC9 Fibrocystin-L-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8IGC9_CHLRE Length = 4806 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P RPP PP A P P S PPP PP PP PPP+PP PP Sbjct: 4730 PPSPKPPRPPSPPPAPPVPPS-PPPSPPVPPGPPPKPPSPP 4769 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRP--PSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LP RPP P PS PP PPP PP PP PPP PP PP Sbjct: 4717 PPSPLPPRPPSPTPPSPKPPRPPSPPPAPPVPPSPPPSPPVPP 4759 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 5/39 (12%) Frame = -3 Query: 121 RPPRPPSASPP----PASLPP-PRPPRPPRPPPRPPRPP 20 RPP PPS SPP P+ PP PRPP PP PPP+PP PP Sbjct: 4572 RPPAPPSPSPPSPRPPSPNPPSPRPPAPPSPPPKPPVPP 4610 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 4/46 (8%) Frame = -3 Query: 145 RPQLSLPVRP----PRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RP +P P P PPS PP S P PRPPRP P PRPPRPP Sbjct: 4468 RPPSPVPPSPVPPSPAPPSPRPPLPSPPAPRPPRPLPPSPRPPRPP 4513 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = -3 Query: 145 RPQLSLPV--RPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGA 11 RP LP RPPRPPS PP S P PRPP PP P P PRPP A Sbjct: 4498 RPPRPLPPSPRPPRPPS--PPSPSPPSPRPPAPPSPSPPSPRPPSPA 4542 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -3 Query: 115 PRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PPS PP PPP+PP PP PPP+PP PP Sbjct: 4589 PNPPSPRPPAPPSPPPKPPVPPSPPPKPPVPP 4620 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PP P P S PPP+PP PP PPP PP PP Sbjct: 4591 PPSPRPPAPPSPPPKPPVPPS-PPPKPPVPPSPPPAPPMPP 4630 [44][TOP] >UniRef100_Q6SSE8 Minus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE8_CHLRE Length = 3889 Score = 55.8 bits (133), Expect(2) = 6e-07 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = -3 Query: 133 SLPVRPPRPPSASPPPASLPPPRPPRPPRPPPR--PPRPP 20 S P RPP PP + PPP PPPRP PPRPPPR PP PP Sbjct: 718 SPPPRPP-PPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPP 756 Score = 20.8 bits (42), Expect(2) = 6e-07 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -1 Query: 201 PPRPPSCPGTSGPRCDAW 148 PPRPP P G AW Sbjct: 671 PPRPPLPPTWPGKWEGAW 688 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGA 11 P+ P +P PP SPPP P P PP PP PPP PP PP A Sbjct: 726 PKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPA 769 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/40 (57%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRP---PRPPRPPPRPPRPPD 17 P + P PP SPPP PPPRP P PP PPP PP PP+ Sbjct: 725 PPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPN 764 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LP P PP PPP S PPP+P PPRP P PPRPP Sbjct: 708 PSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSP-PPRPP 747 [45][TOP] >UniRef100_A0N015 Vegetative cell wall protein n=1 Tax=Chlamydomonas incerta RepID=A0N015_CHLIN Length = 613 Score = 56.2 bits (134), Expect(2) = 7e-07 Identities = 24/46 (52%), Positives = 25/46 (54%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P+ P P PPS PP S PPP PP PP PPP P PP A G Sbjct: 315 PRPPFPANTPMPPSPPSPPPSPPPPTPPSPPSPPPPSPVPPSPAPG 360 Score = 20.4 bits (41), Expect(2) = 7e-07 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 204 TPPRPPSCPGTSGPR 160 +PP PPS P PR Sbjct: 302 SPPPPPSPPPPPPPR 316 [46][TOP] >UniRef100_A8NN84 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NN84_COPC7 Length = 550 Score = 55.1 bits (131), Expect(2) = 7e-07 Identities = 30/65 (46%), Positives = 32/65 (49%), Gaps = 19/65 (29%) Frame = -3 Query: 145 RPQLSLPVRPPRPPS-------------ASPPPASLPPPRPPRPPR------PPPRPPRP 23 RP LS P PPRPP ++PPP PPP PP PP PPP PP P Sbjct: 352 RPALSNPAPPPRPPVPTRAVAEEDTTSVSTPPPPPPPPPPPPGPPAATGGAPPPPPPPPP 411 Query: 22 PDGAA 8 P GAA Sbjct: 412 PGGAA 416 Score = 21.6 bits (44), Expect(2) = 7e-07 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 Query: 204 TPPRPPSCPGTSGP 163 TPP PP P S P Sbjct: 345 TPPPPPRRPALSNP 358 Score = 52.4 bits (124), Expect(2) = 3e-06 Identities = 33/66 (50%), Positives = 36/66 (54%), Gaps = 19/66 (28%) Frame = -3 Query: 148 ARPQLSLPVRPPRPP----SASPPPA---------SLPPPRPPR-----PPRPPPRPPRP 23 +RPQ P +PPRPP SAS PPA S PPP PPR P PPP P RP Sbjct: 278 SRPQTLEPPQPPRPPARPSSASKPPAPPRPVSSVASAPPPAPPRRPAVSSPNPPPPPSRP 337 Query: 22 -PDGAA 8 P+GAA Sbjct: 338 QPNGAA 343 Score = 22.3 bits (46), Expect(2) = 3e-06 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 207 GTPPRPPSCPGTSGP 163 G PP PPS P T P Sbjct: 271 GRPPAPPSRPQTLEP 285 [47][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP S PPP PP PP PPP PP PP Sbjct: 364 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP PPP PP PP PPP PP PP Sbjct: 369 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP PPP PP PP PPP PP PP Sbjct: 371 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 356 PCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 391 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP+ PPP PP PP PPP PP PP Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 400 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP + PPP PPP PP PP PPP PP PP Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 394 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 363 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 398 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/41 (53%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P + P +P PP PPP PPP PP PP PPP PP PP Sbjct: 348 PPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 388 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 148 ARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 A P P PP PP PPP PPP P PP PPP PP PP Sbjct: 351 ANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 393 [48][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PQ+ + PP PP PPP PPP PP PP PPP PP PP Sbjct: 228 PQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P + V PP PP PPP PPP PP PP PPP PP PP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -3 Query: 139 QLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 Q+ P PP PP PPP PPP PP PP PPP PP PP Sbjct: 231 QVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPP 284 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 [49][TOP] >UniRef100_B7CI24 Endo/excinuclease domain protein n=1 Tax=Burkholderia pseudomallei 576 RepID=B7CI24_BURPS Length = 314 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 7/68 (10%) Frame = -3 Query: 202 ATAAAVLSRYQRATVRRMA-----RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRP-- 44 AT AA S+ R + A P+ P +PP+PP PP PP+PP+PP+P Sbjct: 173 ATEAAKTSKTVRLSKAPKAPKAPKAPKAPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPK 232 Query: 43 PPRPPRPP 20 PP+PP+PP Sbjct: 233 PPKPPKPP 240 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/43 (48%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRP--PPRPPRPP 20 P+ P +PP+PP PP PP+PP+PP+P PP+PP+PP Sbjct: 204 PKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPP 246 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/43 (48%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRP--PPRPPRPP 20 P+ P +PP+PP PP PP+PP+PP+P PP+PP+PP Sbjct: 210 PKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPP 252 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P+ P +PP+PP PP PP+PP+PP+ PP+PP+PP Sbjct: 216 PKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPK-PPKPPKPP 255 [50][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS SPPP+ PPP PP PP PPP P PP Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPP 241 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P PP PPS PPP PPP PP PP PPP P PP Sbjct: 213 PSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 253 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PPS PPP+ PPP PP PP PPP PP PP Sbjct: 212 PPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPP 247 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/36 (58%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP+ PPP PP PP PPP P PP Sbjct: 224 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/37 (62%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPR-PPPRPPRPP 20 P PP PPS PPP PPP PP PP PPP PP PP Sbjct: 230 PPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPP 266 [51][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP P P PP PP Sbjct: 234 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 269 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP P P PP PP Sbjct: 239 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 274 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP P P PP PP Sbjct: 286 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 321 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP P P PP PP Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 326 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP P PPP PP PP Sbjct: 304 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 339 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP P PPP PP PP Sbjct: 343 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP P PPP PP PP Sbjct: 348 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 383 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP P PPP PP PP Sbjct: 457 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 492 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP P PPP PP PP Sbjct: 462 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 497 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP P PPP PP PP Sbjct: 506 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 541 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP P P PP PP Sbjct: 252 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 287 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP PPP P PP Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 292 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP P P PP PP Sbjct: 309 PPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 344 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 209 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 214 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 246 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 251 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 256 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 400 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 432 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 405 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 437 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP P PPP PP PP Sbjct: 514 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 546 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 519 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 551 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 524 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 556 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP P PP Sbjct: 317 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 349 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 388 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP P PP Sbjct: 361 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 393 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 410 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 442 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP P PP Sbjct: 415 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 447 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP P P PP PP Sbjct: 470 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 502 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP P PP Sbjct: 475 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 507 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 387 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 392 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 426 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 501 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 535 [52][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LP PP PP + PPP S PP P PP PPP PP PP Sbjct: 2135 PPAPLPPPPPSPPPSPPPPPSPPPSPPAPPPHPPPEPPAPP 2175 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -3 Query: 142 PQLSLPVRPPRPPSAS-PPPASLPPPRPPRPPRPPPRPPRPP 20 P S P PP PP A PPP PPP PP PP PPP PP PP Sbjct: 2123 PPPSPPPPPPSPPPAPLPPPPPSPPPSPPPPPSPPPSPPAPP 2164 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/49 (55%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -3 Query: 142 PQLSLPVRPPR--PPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAGA 2 P LP PP PP+ SP P PPP PP P PPP PP PP GAA A Sbjct: 2058 PPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQA 2106 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPP-PRPPRPPRPPPRPPRPP 20 P PP PPS PPP S PP P PP PP PPP PP PP Sbjct: 2118 PPSPPPPPSPPPPPPSPPPAPLPPPPPSPPPSPPPPP 2154 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRP-PRPPPRPPRPP 20 P L P P PP SPPP S PPP PP P P PPP PP PP Sbjct: 2030 PPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPP 2071 [53][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -3 Query: 130 LPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 LP PP PP PPP PPP PP PP PPP PP PP Sbjct: 58 LPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/52 (46%), Positives = 26/52 (50%) Frame = -3 Query: 175 YQRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 + V + P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 46 FNEKMVIELPPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 [54][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 136 LSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 LS P PP PP PPP PPP PP PP PPP PP PP Sbjct: 486 LSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 [55][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/49 (51%), Positives = 26/49 (53%) Frame = -3 Query: 166 ATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 A+ R P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 ASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PVASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 [56][TOP] >UniRef100_Q6CH67 YALI0A11869p n=1 Tax=Yarrowia lipolytica RepID=Q6CH67_YARLI Length = 1260 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = +3 Query: 6 PAAPSGGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTGKLSWGR 146 P P RGGRGGGRGGRGG+GGG G G GG GG GK + R Sbjct: 527 PTGPLSDRGGRGGGRGGRGGKGGGDGGGRGGRGGGNGGGGGKGGFSR 573 [57][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -3 Query: 130 LPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 LP PP PP PPP PPP PP PP PPP PP PP Sbjct: 62 LPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P L P PP PP PPP PPP PP P PPP PP PP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 [58][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -3 Query: 121 RPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RPP+PP+A PP PPP PP PP PPP PP PP Sbjct: 342 RPPQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPP 375 [59][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PQ+ P+ PP PP PPP PPP PP PP PP PP PP Sbjct: 418 PQIQPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPLLPPPPP 458 [60][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1935 PPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPP 1970 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP+ +PPP PPP PP PP PPP PP P Sbjct: 1941 PPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPPSAP 1976 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = -3 Query: 133 SLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 S P PP PP PPP PPP P PP PPP PP PP Sbjct: 1927 SSPETPPPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPP 1964 [61][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 151 MARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 + PQ P PP PPS PPP PPP PP PP PPP P PP Sbjct: 200 VVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP+ PPP PP PP PPP PP PP Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRP-PRPPRPPPRPPRPP 20 P S P PP PP SPPP PPP P P PP PPP PP PP Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 254 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS PPP PPP PP PP PPP P PP Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP PPP+ PPP PP PP PPP PP P Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 [62][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = -3 Query: 127 PVRPPRPPSASPPPAS-LPPPRPPRPPRPPPRPPRPP 20 P PP PPSAS PP+S P PRPP PP PPP PP PP Sbjct: 219 PSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPP 255 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P+ PP PP PPP PPP PP PP PPP PP P Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 [63][TOP] >UniRef100_Q015H7 Chromosome 07 contig 1, DNA sequence n=1 Tax=Ostreococcus tauri RepID=Q015H7_OSTTA Length = 499 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RP P RPPRPP A PP PPR PRPP P PRPP PP Sbjct: 274 RPSPPSPPRPPRPPPAPRPPR---PPRAPRPPPPSPRPPPPP 312 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 5/46 (10%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASP-----PPASLPPPRPPRPPRPPPRPPRPP 20 P PV PPRP SP PP + PPRPPR PRPPP PRPP Sbjct: 264 PYPPYPVAPPRPSPPSPPRPPRPPPAPRPPRPPRAPRPPPPSPRPP 309 [64][TOP] >UniRef100_A9TH32 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TH32_PHYPA Length = 192 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/46 (58%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +3 Query: 9 AAPSGGRGGRGGGRGGRGG-RGGGKEAGGGEALGGLGGRTGKLSWG 143 + P GGRGGRGGGRGGRGG RGGG+ GG GG G G+ G Sbjct: 140 STPGGGRGGRGGGRGGRGGARGGGRGGFGGRGGGGFRGARGRSGGG 185 [65][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 54.3 bits (129), Expect(2) = 1e-06 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = -3 Query: 130 LPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAGA 2 L PP PP PPPA PP PP PP+PP PP PP GA Sbjct: 737 LGAHPPPPPPPPPPPAPKPPGAPPPPPKPPSAPPPPPPKPPGA 779 Score = 21.6 bits (44), Expect(2) = 1e-06 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 207 GTPPRPPSCPGTSGP 163 G PP PP P T+ P Sbjct: 722 GAPPPPPPPPPTTKP 736 [66][TOP] >UniRef100_A8P059 Pherophorin-dz1 protein, putative n=1 Tax=Brugia malayi RepID=A8P059_BRUMA Length = 351 Score = 53.1 bits (126), Expect(2) = 1e-06 Identities = 22/42 (52%), Positives = 25/42 (59%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 +P +P PP PP PPP S PP PP PP+P P PP PP Sbjct: 138 KPPPPIPCPPPPPPKPCPPPPSPPPCPPPPPPQPCPPPPLPP 179 Score = 22.7 bits (47), Expect(2) = 1e-06 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PP PP CP S P Sbjct: 116 PPAPPPCPPQSCP 128 [67][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/43 (53%), Positives = 28/43 (65%) Frame = -3 Query: 148 ARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 +RP + + P RPPS+ PP PPP PPRPP PPP P +PP Sbjct: 468 SRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPP 510 [68][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 PP PP PPP PPP PP PP PPP PP PPD Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPD 685 [69][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP PPP P PP Sbjct: 93 PPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPP 128 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/59 (44%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = -3 Query: 190 AVLSRYQRATVRRMARPQLSLP--VRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 AV+ + ++ + +LP V PP PP PPP S PPP PP P PPP PP PP Sbjct: 65 AVIDQIKKGDFKLKPVGDRTLPNKVPPPPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPP 123 [70][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = -3 Query: 154 RMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 R+ P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 RVDPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P PP PP PPP PPP PP PP PPP PP PP+ Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 [71][TOP] >UniRef100_Q58NA5 Plus agglutinin (Fragment) n=1 Tax=Chlamydomonas incerta RepID=Q58NA5_CHLIN Length = 2371 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/47 (61%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = -3 Query: 151 MARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRP--PPRPPRPPD 17 M P LP PPRPPS PP PPPR PRPPRP PP PP PPD Sbjct: 553 MPSPVPPLP-SPPRPPSPQPP-VPRPPPRAPRPPRPPSPPAPPAPPD 597 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/42 (50%), Positives = 24/42 (57%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P +P PP P + PP PPP PP PP PPP PP PP+ Sbjct: 496 PSPPVPPSPPPTPPSPPPTPPAPPPVPPLPPAPPPSPPLPPE 537 [72][TOP] >UniRef100_C1E755 Putative uncharacterized protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E755_9CHLO Length = 336 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/48 (58%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = -3 Query: 157 RRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPR--PPPRPPRPP 20 RR A P+ P PP PP PPP PPPRPP PPR PPP PP PP Sbjct: 39 RRAAPPRQPPPPPPPPPP---PPPQPPPPPRPPPPPRSPPPPPPPLPP 83 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/72 (40%), Positives = 36/72 (50%), Gaps = 10/72 (13%) Frame = -3 Query: 205 YATAAAVLSRYQRATVRRMA----------RPQLSLPVRPPRPPSASPPPASLPPPRPPR 56 +A AA L+R A+ +A +P+ + P R P PP PPP PP PPR Sbjct: 7 HALLAATLARSVAASFDPLAAFRPAELPASQPRRAAPPRQPPPPPPPPPPPPPQPPPPPR 66 Query: 55 PPRPPPRPPRPP 20 PP PP PP PP Sbjct: 67 PPPPPRSPPPPP 78 [73][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = -3 Query: 154 RMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 R+ P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 RVDPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P PP PP PPP PPP PP PP PPP PP PP+ Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 67 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 [74][TOP] >UniRef100_A9RTT7 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RTT7_PHYPA Length = 455 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +3 Query: 12 APSGGR-GGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTG 128 A SGG GGRGGGRGG GGRGGG+ GGG GG GG G Sbjct: 377 ASSGGTPGGRGGGRGGFGGRGGGRGGGGGRGFGGRGGGRG 416 [75][TOP] >UniRef100_B4KPH5 GI18675 n=1 Tax=Drosophila mojavensis RepID=B4KPH5_DROMO Length = 334 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/48 (58%), Positives = 30/48 (62%) Frame = +3 Query: 3 APAAPSGGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTGKLSWGR 146 +P GGRGG GGG GGRGG GGG+ GGG GG GGR G GR Sbjct: 7 SPRGGGGGRGGGGGGFGGRGGGGGGRGGGGGR--GGFGGRGGGGGGGR 52 [76][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/52 (46%), Positives = 29/52 (55%) Frame = -3 Query: 172 QRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 +R +R RP + P PP PP P P+ PPP P PP PPP PP PP+ Sbjct: 289 KRPQIRPSTRPPATPPPSPPPPPPPPPLPSPPPPPPTPPPPPPPPPPPPPPN 340 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/50 (54%), Positives = 28/50 (56%) Frame = -3 Query: 169 RATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 R + R A P S P PP PP SPPP PP PP PP PPP PP PP Sbjct: 294 RPSTRPPATPPPSPPPPPPPPPLPSPPPPPPTPPPPPPPP-PPPPPPNPP 342 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -3 Query: 163 TVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 T R RP P PP P PPP LP P PP P PPP PP PP Sbjct: 288 TKRPQIRPSTRPPATPPPSPPPPPPPPPLPSPPPPPPTPPPPPPPPPP 335 [77][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -3 Query: 139 QLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 Q LP PP PP SPPP S P P PP PP PPP P PP Sbjct: 146 QCKLPSPPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPP 185 [78][TOP] >UniRef100_Q948Y7 VMP3 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y7_VOLCA Length = 687 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 21/32 (65%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 PP PP +PPP S PPP PP P PPP PP P Sbjct: 599 PPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPP 630 Score = 23.5 bits (49), Expect(2) = 1e-06 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 Query: 201 PPRPPSCPGTSGPRCDAW 148 PP PPS P + P AW Sbjct: 548 PPSPPSPPTSPSPPDPAW 565 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRP--PRPPPRPPRPP 20 RP PV P PPS PPP+ PP PPRP PRPPPRPP P Sbjct: 491 RPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRP 534 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP PRPP Sbjct: 619 PPSPPPPSPPPPSPPPPNPP-PPSPPPPSPRPP 650 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = -3 Query: 118 PPRPPSASPPPASLPPP--RPPRPPRPPPRPPRPP 20 PP PP +PPP S PPP RPP PP P P PPRPP Sbjct: 629 PPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPP 663 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/51 (49%), Positives = 26/51 (50%), Gaps = 14/51 (27%) Frame = -3 Query: 133 SLPVRPPRPPSASPPPASLPPPRP--------------PRPPRPPPRPPRP 23 +LP PP PP SPPP PPP P PRPP PPPRPP P Sbjct: 474 TLPSAPPSPPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSP 524 [79][TOP] >UniRef100_A8JBZ3 Metalloproteinase of VMP family n=1 Tax=Chlamydomonas reinhardtii RepID=A8JBZ3_CHLRE Length = 515 Score = 51.2 bits (121), Expect(2) = 2e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSA-SPPPASLPPPRPPRPPRP-PPRPPRPP 20 P LP PP PP SPPP+ LP P PRPP P PP PP PP Sbjct: 454 PPTPLPPLPPSPPPRPSPPPSPLPRPPSPRPPSPSPPSPPPPP 496 Score = 24.3 bits (51), Expect(2) = 2e-06 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 201 PPRPPSCPGTSGPR 160 PP+PPS P S PR Sbjct: 433 PPKPPSPPSPSPPR 446 [80][TOP] >UniRef100_Q3UQ97 Predicted n=1 Tax=Mus musculus RepID=Q3UQ97_MOUSE Length = 254 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PPRPPS +PPP PPPRPP P PP PP PP Sbjct: 36 PPAPPRPPSPAPPPLPPPPPRPPPPLPLPPPPPLPP 71 [81][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP PPP PPP PP PP PPP PP PP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/41 (53%), Positives = 24/41 (58%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P PP PP PPP PPP P PP PPP PP PP ++G Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSG 1458 [82][TOP] >UniRef100_Q41192 NaPRP3 n=1 Tax=Nicotiana alata RepID=Q41192_NICAL Length = 151 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/51 (50%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -3 Query: 169 RATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRP-PRPPRPPPRPPRPP 20 R+ + +P PV+ P PPS SPPP S PPP P P PP P P PP PP Sbjct: 64 RSPPPKREQPSPPPPVKSPPPPSPSPPPPSPPPPSPSPPPPSPSPPPPSPP 114 [83][TOP] >UniRef100_Q2QZM4 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q2QZM4_ORYSJ Length = 661 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRP----PRPPRPPPRPPRPP 20 P S PV PPRPP+ SPP PPP P P PP PPP PP PP Sbjct: 430 PAPSPPVPPPRPPAPSPPAPPPPPPAPSPPAPLPPPPPPCPPAPP 474 [84][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PPS PPP+S PPP P PP PPP P PP Sbjct: 818 PNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPP 858 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P P PP +PPPA PPP P PP PPP PP PP Sbjct: 846 PPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPP 886 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/36 (58%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP+ PPP PP PP PPP P PP Sbjct: 799 PPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPP 834 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PPS PPP+ PPP PP PP PPP PP PP Sbjct: 793 PPLPPSPPPPPSPPPPPPPPSPP-PPPNPPTPP 824 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS+ PPP+ PPP PP P PPP PP PP Sbjct: 829 PPSPPPPPSSPPPPSPSPPPSPPPAPSPPP-PPNPP 863 [85][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = -3 Query: 130 LPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 +P PP PP PPP PPP PP PP PPP PP PP Sbjct: 76 IPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 124 VRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 V PP PP PPP PPP PP PP PPP PP PP Sbjct: 75 VIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 [86][TOP] >UniRef100_A8J9H7 Mastigoneme-like flagellar protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J9H7_CHLRE Length = 1987 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/42 (57%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -3 Query: 142 PQLSLPVRP-PRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P+ P P P PP SPPP+ P P PPRPP PPP PP PP Sbjct: 1880 PRPPSPAPPSPNPPPTSPPPSPPPSPPPPRPPPPPPPPPSPP 1921 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/43 (55%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPP--PASLPPPRPPRPPRPPPRPPRP 23 RP P P PP++ PP P S PPPRPP PP PPP PP P Sbjct: 1881 RPPSPAPPSPNPPPTSPPPSPPPSPPPPRPPPPPPPPPSPPPP 1923 [87][TOP] >UniRef100_A8I011 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8I011_CHLRE Length = 639 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 136 LSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPP 29 L P PPRPPS PPP S PP PP PP PPP PP Sbjct: 309 LPFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPP 344 [88][TOP] >UniRef100_A7XQ02 Latex protein n=1 Tax=Morus alba RepID=A7XQ02_MORAL Length = 415 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P S P PP PP SPPP S PPP PP P PPP PP P Sbjct: 69 PPPSPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 108 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDG 14 PP PP SPPP S PPP PP PP PPP P PP G Sbjct: 87 PPSPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPGG 120 [89][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -3 Query: 136 LSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 L+ P PP PP PPP PPP PP PP PPP PP PP Sbjct: 70 LTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P PP PP PPP PPP PP PP PPP PP PP G Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPG 118 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 R ++ L PP PP PPP PPP PP PP PPP PP PP Sbjct: 65 RIEVILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 [90][TOP] >UniRef100_A4S9A6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S9A6_OSTLU Length = 4076 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 133 SLPVRPPRPPSASPPPASLPPPRPP---RPPRPPPRPPRPPDGAAGA 2 S P PP PPS PPP+ PPP PP PP PPP P PP GA A Sbjct: 83 SPPPSPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPPPGAGAA 129 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = -3 Query: 160 VRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 V R+A P P PP P SPPP S PPP PP PP PPP P PP Sbjct: 2064 VERIASPPPPSP--PPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPP 2108 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 2094 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2128 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP P PP PPP P PP Sbjct: 2078 PSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPP 2113 [91][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAGA 2 P PP PP PPP PPP PP PP PPP PP PP G+ Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGS 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [92][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/45 (53%), Positives = 26/45 (57%) Frame = -3 Query: 154 RMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 + +R S P PP PP PPP PPP PP PP PPP PP PP Sbjct: 37 QQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [93][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = -3 Query: 154 RMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 R+ P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 RVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/37 (59%), Positives = 22/37 (59%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P PP PP PPP PPP PP PP PPP PP P D Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRD 49 [94][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -3 Query: 136 LSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 L+ P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 LTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -3 Query: 133 SLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 SL PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 [95][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PRPPS PP S PPP PP PP PPP PP PP Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPP 279 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 121 RPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RPP PP SP P PPP PP PP PPP PP PP Sbjct: 249 RPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPP 282 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 166 ATVRRMARPQLSLPVRPPRP-PSASPPPASLPPPRPPRPPRPPPRPPRPP 20 A+ R + P P PP P PS PPP PPP PP PP PPP PP PP Sbjct: 237 ASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P S P PP PP PPP PPP PP PP PPP PP P Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP PPP PPP PP PP PPP PP PP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP S PPP PP PP PPP PP P Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 297 [96][TOP] >UniRef100_A1CMR3 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus clavatus RepID=A1CMR3_ASPCL Length = 642 Score = 54.7 bits (130), Expect(2) = 2e-06 Identities = 28/54 (51%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -3 Query: 166 ATVRRMARPQLSLPVRPPRPPSASPPP-ASLPPPRPPRPPR----PPPRPPRPP 20 A R + P + V PP PP PPP AS+PPP PP PP PPPRPP PP Sbjct: 462 AASRPIPPPPAASAVPPPPPPPPPPPPSASIPPPPPPPPPPVSHVPPPRPPPPP 515 Score = 20.4 bits (41), Expect(2) = 2e-06 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -1 Query: 207 GTPPRPPSCPGT 172 G PP PP P T Sbjct: 412 GPPPPPPRSPAT 423 [97][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 53.1 bits (126), Expect(2) = 2e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PP SP P S PP PP PP PPP PP PP Sbjct: 394 PPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPP 434 Score = 21.9 bits (45), Expect(2) = 2e-06 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = -1 Query: 204 TPPRPPSCPGTSGPRCDAWRGPSSACQC 121 +PP P P + P A P C+C Sbjct: 328 SPPPPSPPPPSPAPPSPAPPSPPPPCEC 355 [98][TOP] >UniRef100_UPI0001AED46D putative methyltransferase n=1 Tax=Streptomyces albus J1074 RepID=UPI0001AED46D Length = 234 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/61 (45%), Positives = 32/61 (52%) Frame = -3 Query: 202 ATAAAVLSRYQRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 A AA R+ R R + PVRP PPPA+ PP + PRPPRPP RP RP Sbjct: 105 ARAAGAAIRFHLGDAFRPRRGRPHRPVRPDPRLGVLPPPAAAPPGQLPRPPRPPARPRRP 164 Query: 22 P 20 P Sbjct: 165 P 165 [99][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P PP PP SPPP S PPP PP P PPP PP P Sbjct: 83 PPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSP 123 Score = 53.9 bits (128), Expect(2) = 3e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P + P PP S SPPP S PPP PP PP PPP PP P Sbjct: 190 PSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSP 230 Score = 20.8 bits (42), Expect(2) = 3e-06 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -1 Query: 204 TPPRPPSCPGTSGPRCDAWRGPSSA 130 +PP P P P W+ PS++ Sbjct: 136 SPPPPSISPSPPPPPPPWWQAPSAS 160 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/46 (52%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPP-----PRPPRPPRPPPRPPRPP 20 P L P+ PP PP SPPP+ PP P PP PP P P PP PP Sbjct: 38 PPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPP 83 [100][TOP] >UniRef100_Q6SSE6 Plus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE6_CHLRE Length = 3409 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/42 (52%), Positives = 24/42 (57%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RP P+ P PP PP +PPP PP PP PPP PP PP Sbjct: 480 RPPRPPPLPPSPPPPLLPPSPPVPPPSPPSPPSPPPSPPEPP 521 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LP PP PP + P P S PPP PP PP PPP PP PP Sbjct: 492 PPPLLPPSPPVPPPSPPSPPS-PPPSPPEPPSPPPLPPSPP 531 [101][TOP] >UniRef100_Q5W6I0 Putative uncharacterized protein OSJNBb0115F21.14 n=1 Tax=Oryza sativa Japonica Group RepID=Q5W6I0_ORYSJ Length = 1197 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = -3 Query: 142 PQLSLPVRPPRPPSAS------PPPASLPPPRPPRPPRPPPRPPRPP 20 P S P PPRPP+ S PPPA PP PP PP PPP PP PP Sbjct: 733 PAPSPPAPPPRPPAPSPPAPPPPPPAPSPPAPPPPPPPPPPCPPAPP 779 [102][TOP] >UniRef100_Q7XRW4 OSJNBb0062H02.5 protein n=2 Tax=Oryza sativa RepID=Q7XRW4_ORYSJ Length = 577 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RP P PP PP A PPA PPP PP PP PPP PP PP Sbjct: 255 RPPAPSPPAPPPPPPAPSPPA--PPPPPPPPPPPPPCPPAPP 294 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASP--PPASLPPPRPPRPPRPPPRPPRPP 20 P S PV PRPP+ SP PP P P PP PP PPP PP PP Sbjct: 245 PAPSPPVPSPRPPAPSPPAPPPPPPAPSPPAPPPPPPPPPPPP 287 [103][TOP] >UniRef100_Q01DC8 Plg protein (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01DC8_OSTTA Length = 3738 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDG 14 P P PP PPS PPP+ PP PP PP PPP P PP G Sbjct: 5 PPPPAPPSPPPPPSPPPPPSPAPPSPPPPPPSPPPPSPPPPPG 47 [104][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 151 MARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 M P P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 MEPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/37 (56%), Positives = 23/37 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P PP PP PPP PPP PP PP PPP PP+P + Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSE 48 [105][TOP] >UniRef100_C1EF12 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EF12_9CHLO Length = 588 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/60 (46%), Positives = 32/60 (53%), Gaps = 11/60 (18%) Frame = -3 Query: 166 ATVRRMARPQLSLPVRPP----------RPPSASPPPASLPPPRPPRPPR-PPPRPPRPP 20 A +R++A P + P PP PP SPPP PP PP PPR PPPRPP PP Sbjct: 327 APLRKVANPTPARPSPPPWYVERWSELRNPPPPSPPPTPPTPPTPPDPPRSPPPRPPAPP 386 [106][TOP] >UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis RepID=B9S5R2_RICCO Length = 210 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SPPP S PPP PP PP PPP P PP Sbjct: 43 PPPPPPPSPPPPSPPPPSPPPPPPPPPPSPSPP 75 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP P P PP P Sbjct: 45 PPPPPSPPPPSPPPPSPPPPPPPPPPSPSPPPPTSP 80 [107][TOP] >UniRef100_A8IZG7 Plus agglutinin protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8IZG7_CHLRE Length = 559 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/42 (52%), Positives = 24/42 (57%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RP P+ P PP PP +PPP PP PP PPP PP PP Sbjct: 480 RPPRPPPLPPSPPPPLLPPSPPVPPPSPPSPPSPPPSPPEPP 521 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P LP PP PP + P P S PPP PP PP PPP PP PP Sbjct: 492 PPPLLPPSPPVPPPSPPSPPS-PPPSPPEPPSPPPLPPSPP 531 [108][TOP] >UniRef100_A8HZE9 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HZE9_CHLRE Length = 575 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +3 Query: 123 TGKLSWGRAMRRTVARWYLDKTAAAVAY 206 +G L+WGRAMRRTVARWYLDKTA AVAY Sbjct: 146 SGALTWGRAMRRTVARWYLDKTAGAVAY 173 [109][TOP] >UniRef100_B5G572 Huntingtons disease protein (Fragment) n=1 Tax=Sus scrofa RepID=B5G572_PIG Length = 60 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/54 (44%), Positives = 32/54 (59%) Frame = -3 Query: 184 LSRYQRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 L +Q+ ++ + Q P PP+PP PPP + PPP+PP PP PPP PP P Sbjct: 7 LKSFQQQQQQQQQQQQQQPPPPPPQPPQ--PPPQTQPPPQPPPPPPPPPPPPGP 58 [110][TOP] >UniRef100_Q2QVU2 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q2QVU2_ORYSJ Length = 1008 Score = 54.3 bits (129), Expect(2) = 2e-06 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASP------PPASLPPPRPPRPPRPPPRPPRPP 20 P + P PP PP+ SP PPA PPP PP PP PPP PP PP Sbjct: 535 PAPTPPAPPPPPPAPSPLAPLPPPPAPSPPPPPPPPPPPPPCPPAPP 581 Score = 20.4 bits (41), Expect(2) = 2e-06 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 204 TPPRPPSCPGTSGP 163 +PP PPS P + P Sbjct: 527 SPPAPPSPPAPTPP 540 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P P PP PP A P A LPPP P PP PPP PP PP Sbjct: 534 PPAPTPPAPPPPPPAPSPLAPLPPPPAPSPPPPPPPPPPPP 574 [111][TOP] >UniRef100_Q7XHB6 Transposon protein, putative, CACTA, En/Spm sub-class n=2 Tax=Oryza sativa RepID=Q7XHB6_ORYSJ Length = 773 Score = 53.1 bits (126), Expect(2) = 2e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP PPPA PP PP PP PPP PP PP Sbjct: 439 PPAPPPPPPPPAPSPPAPPPPPPPPPPCPPAPP 471 Score = 21.6 bits (44), Expect(2) = 2e-06 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 204 TPPRPPSCPGTSGP 163 +PP PPS P S P Sbjct: 415 SPPAPPSPPAPSPP 428 [112][TOP] >UniRef100_UPI0000D9F166 PREDICTED: similar to guanine nucleotide binding protein, alpha activating polypeptide O n=1 Tax=Macaca mulatta RepID=UPI0000D9F166 Length = 571 Score = 48.9 bits (115), Expect(2) = 3e-06 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = -3 Query: 109 PPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 PP++ PP + PPP PP PP PPP PP P AAG Sbjct: 147 PPNSLPPHPAPPPPPPPPPPPPPPPPPPPAAAAAG 181 Score = 25.8 bits (55), Expect(2) = 3e-06 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 14/53 (26%) Frame = -1 Query: 201 PPRPPSCPGTSGPRCDAWR--------------GPSSACQCGRPGLLAPHHHR 85 P R PS G RC+ W P A C R AP HR Sbjct: 82 PWRSPSLSGRLTERCELWETATPPPARDLPPGPAPCPALPCARGSAKAPRTHR 134 [113][TOP] >UniRef100_UPI00005A206B PREDICTED: similar to Acrosin precursor n=1 Tax=Canis lupus familiaris RepID=UPI00005A206B Length = 414 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 121 RPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 RPPRPP ASPP P P+PP P PPP PP PP Sbjct: 330 RPPRPPPASPPSQPRPRPKPPAAPPPPPPPPPPP 363 [114][TOP] >UniRef100_Q8S9B5 Matrix metalloproteinase n=1 Tax=Volvox carteri f. nagariensis RepID=Q8S9B5_VOLCA Length = 625 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/45 (55%), Positives = 29/45 (64%), Gaps = 9/45 (20%) Frame = -3 Query: 127 PVRPPRPPSASPPPASL---------PPPRPPRPPRPPPRPPRPP 20 P+ PPRPP++ PPP L PP+ PRPPRPPP PPRPP Sbjct: 563 PLPPPRPPTSPPPPPQLKASKAPRFPTPPQKPRPPRPPP-PPRPP 606 [115][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 133 SLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPP 29 S P PP PP PPP PPP PPRPP PPP PP Sbjct: 431 STPPPPPPPPPPPPPPPPTPPPPPPRPPPPPPPPP 465 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP PPP PP PP PPRPPP PP PP Sbjct: 433 PPPPPPPPPPPPPPPPTPPPPPPRPPPPPPPPP 465 [116][TOP] >UniRef100_Q00YH8 LPA (ISS) n=1 Tax=Ostreococcus tauri RepID=Q00YH8_OSTTA Length = 3708 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = -3 Query: 160 VRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 + R++ P S P PP PP SPPP S PPP PP P PPP PP P Sbjct: 1629 MERISSPPPSPP--PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 1672 [117][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/46 (54%), Positives = 26/46 (56%) Frame = -3 Query: 157 RRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 R +P P PP PPS PPP PPP PP P PPPRPP PP Sbjct: 1075 RPCEKPPPPSPPSPPSPPSPPPPPPPSPPP-PPPPSPPPPRPPPPP 1119 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 5/46 (10%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPA-SLPPPRPPRPPRPPP----RPPRPP 20 P S P PP PPS PPP S PPPRPP PP PPP PP PP Sbjct: 1157 PPPSPPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPP 1202 [118][TOP] >UniRef100_A8JFD4 Glyoxal or galactose oxidase (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8JFD4_CHLRE Length = 898 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 121 RPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 RPP PP SPPP S PPP PP P PPP PP P Sbjct: 257 RPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 289 [119][TOP] >UniRef100_A8J6N7 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J6N7_CHLRE Length = 532 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +3 Query: 108 GLGGRTGKLSWGRAMRRTVARWYLDKTAAAVAY 206 G K WGRAMRRTVARWYLDKTAAAVAY Sbjct: 136 GAAADIAKTDWGRAMRRTVARWYLDKTAAAVAY 168 [120][TOP] >UniRef100_A8J3Q3 Glyoxal or galactose oxidase n=1 Tax=Chlamydomonas reinhardtii RepID=A8J3Q3_CHLRE Length = 691 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP+PP P P PPP+PP PP+PPP+PP PP Sbjct: 72 PPGPPKPPPKPPGPPK-PPPKPPGPPKPPPKPPSPP 106 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/71 (39%), Positives = 35/71 (49%), Gaps = 10/71 (14%) Frame = -3 Query: 202 ATAAAVLSRYQRATVRRMARPQLSLPVRPPR----------PPSASPPPASLPPPRPPRP 53 ATA V++ + AR L+L P PPS PP PPP+PP P Sbjct: 16 ATAVLVIAIFTAMPHSAQARTPLTLADANPYAGRSLLQTSLPPSPKPPGLPKPPPKPPGP 75 Query: 52 PRPPPRPPRPP 20 P+PPP+PP PP Sbjct: 76 PKPPPKPPGPP 86 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/45 (53%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Frame = -3 Query: 139 QLSLPVRP-----PRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 Q SLP P P+PP P P PPP+PP PP+PPP+PP PP Sbjct: 53 QTSLPPSPKPPGLPKPPPKPPGPPK-PPPKPPGPPKPPPKPPGPP 96 [121][TOP] >UniRef100_A4S6G3 Predicted protein (Fragment) n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S6G3_OSTLU Length = 2146 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPP--RPPRPPPRPPRPPD 17 P S P PP PP SPPP S PPP PP PP PPP PP P D Sbjct: 926 PSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPPPPVD 969 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P P PPS SPPP S P P PP PP PPP P PP Sbjct: 904 PSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPP 944 [122][TOP] >UniRef100_Q9GM99 Huntingtin n=1 Tax=Sus scrofa RepID=Q9GM99_PIG Length = 3139 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/51 (47%), Positives = 31/51 (60%) Frame = -3 Query: 172 QRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 Q+ ++ + Q LP PP+PP PPP + PPP+PP PP PPP PP P Sbjct: 22 QQQQQQQQQQQQQQLPPPPPQPPQ--PPPQTQPPPQPPPPPPPPPPPPPGP 70 [123][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/43 (55%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 127 PVRPPRPP--SASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P+ PP PP PPP LPPP PP PP PPP PP PP G Sbjct: 1206 PLTPPPPPLPPPPPPPPPLPPPPPPPPPLPPPPPPPPPPPPVG 1248 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PV PP +PPP LPPP PP PP PPP PP PP Sbjct: 1198 PVPAGPPPPLTPPPPPLPPPPPPPPPLPPPPPPPPP 1233 [124][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 [125][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [126][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [127][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 [128][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 [129][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAA 8 P PP PP PPP PPP PP PP PPP P R P G A Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRA 46 [130][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/36 (58%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP+ P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTP 47 [131][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [132][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP PPP PPP PP PP PPP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [133][TOP] >UniRef100_B4I8G0 GM15587 n=1 Tax=Drosophila sechellia RepID=B4I8G0_DROSE Length = 344 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/46 (58%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = +3 Query: 21 GGRGGRG--GGRGGRGGRGGGKEAGGGEALGGLGGRTGKLSWGRAM 152 GG GGRG GGRGG GGRGGG GGG GG GG TG G+ + Sbjct: 66 GGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGTGGFKGGKTV 111 [134][TOP] >UniRef100_A0D1C0 Chromosome undetermined scaffold_34, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D1C0_PARTE Length = 1131 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/62 (45%), Positives = 32/62 (51%), Gaps = 13/62 (20%) Frame = -3 Query: 148 ARPQLSLPVRPPRPPSASPPPAS---LPPPRPPRP----------PRPPPRPPRPPDGAA 8 A PQ + P PP PP PPP++ +PPP PP P P PPP PP PP G Sbjct: 587 AAPQKAAPPPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKT 646 Query: 7 GA 2 GA Sbjct: 647 GA 648 [135][TOP] >UniRef100_A0BFK7 Chromosome undetermined scaffold_104, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BFK7_PARTE Length = 1152 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/46 (50%), Positives = 27/46 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P+++ P PP PP + PP PPP PRPP PP PP PP AG Sbjct: 625 PKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAG 670 [136][TOP] >UniRef100_Q4PDN5 Putative uncharacterized protein n=1 Tax=Ustilago maydis RepID=Q4PDN5_USTMA Length = 238 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 21 GGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTGK 131 GG GGRGGG GGRGG GGG+ GGG GG GGR G+ Sbjct: 191 GGGGGRGGGGGGRGGGGGGRGGGGGGRGGGGGGRGGR 227 [137][TOP] >UniRef100_P78621 Cytokinesis protein sepA n=1 Tax=Emericella nidulans RepID=SEPA_EMENI Length = 1790 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 28/57 (49%), Positives = 29/57 (50%), Gaps = 9/57 (15%) Frame = -3 Query: 148 ARPQLSLPVRPPRPPSASPPP---ASLPPPRPPRPPRP------PPRPPRPPDGAAG 5 A P LS PP PP PPP A+ PPP PP PP P PP PP PP G G Sbjct: 1025 AHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFG 1081 Score = 22.3 bits (46), Expect(2) = 4e-06 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 201 PPRPPSCPGTSG 166 PP PP+ PG SG Sbjct: 1020 PPPPPAHPGLSG 1031 [138][TOP] >UniRef100_C8V0K5 Cytokinesis protein sepA (Forced expression inhibition of growth A)(Protein FH1/2) [Source:UniProtKB/Swiss-Prot;Acc:P78621] n=1 Tax=Aspergillus nidulans FGSC A4 RepID=C8V0K5_EMENI Length = 1789 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 28/57 (49%), Positives = 29/57 (50%), Gaps = 9/57 (15%) Frame = -3 Query: 148 ARPQLSLPVRPPRPPSASPPP---ASLPPPRPPRPPRP------PPRPPRPPDGAAG 5 A P LS PP PP PPP A+ PPP PP PP P PP PP PP G G Sbjct: 1024 AHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFG 1080 Score = 22.3 bits (46), Expect(2) = 4e-06 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 201 PPRPPSCPGTSG 166 PP PP+ PG SG Sbjct: 1019 PPPPPAHPGLSG 1030 [139][TOP] >UniRef100_B4XYE9 E2 n=1 Tax=Tursiops truncatus papillomavirus type 3 RepID=B4XYE9_9PAPI Length = 415 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/56 (48%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -3 Query: 166 ATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPR-PPRPPPRPPRPPDGAAGA 2 A +R +PQ + PP P SPPP PPPRPP PPRPP PP P A A Sbjct: 236 AHTKRRRKPQTRRLLGPPPSPPPSPPPGRPPPPRPPTPPPRPPATPPSPLATAVSA 291 [140][TOP] >UniRef100_C1E983 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E983_9CHLO Length = 1724 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/63 (46%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = -3 Query: 181 SRYQRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPR------PPRPPRPPPRPPRPP 20 +R R + R A P S P PP PP PPP PPP PP PP PPP PP PP Sbjct: 1130 AREYRLLIEREAPPPPSPP--PPSPPPPPPPPPPAPPPPNANPLPPPPPPSPPPSPPPPP 1187 Query: 19 DGA 11 A Sbjct: 1188 PDA 1190 [141][TOP] >UniRef100_C0P2F3 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0P2F3_MAIZE Length = 326 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/41 (53%), Positives = 27/41 (65%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PQ P R P PP+ +PPP ++PPP P R P PP +PP PP Sbjct: 42 PQPPPPRRAPPPPALAPPPPTMPPPPPRRAPPPPTQPPPPP 82 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/37 (59%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPP-RPP 20 P +PP PP +PPP + PPP P R P PPP PP RPP Sbjct: 89 PTQPPPPPRRAPPPPTQPPPPPRRAPPPPPSPPIRPP 125 [142][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP SP P S PPP PP PP PPP PP PP Sbjct: 246 PPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPP 278 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPD 17 P LP PP PP SPPP PPP PP PP PP P PP+ Sbjct: 251 PPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPPPE 292 [143][TOP] >UniRef100_O15647 Fibrillarin (Fragment) n=1 Tax=Plasmodium falciparum RepID=O15647_PLAFA Length = 301 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 18 SGGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTG 128 +GGRGG GGG GGRGG GGG+ GGG GG GGR G Sbjct: 3 NGGRGGGGGGGGGRGGGGGGRGGGGGGRGGGGGGRGG 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = +3 Query: 21 GGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTG 128 GG GGRGGG GGRGG GGG+ GGG GG GGR G Sbjct: 11 GGGGGRGGGGGGRGGGGGGRGGGGGGRGGGGGGRGG 46 [144][TOP] >UniRef100_B3NJ07 GG16231 n=1 Tax=Drosophila erecta RepID=B3NJ07_DROER Length = 719 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = +3 Query: 21 GGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTGKLSWGR 146 GGRGG GGGRGG GG GG GGG GG GGR G+ GR Sbjct: 654 GGRGGGGGGRGGGGGFGGRGGGGGGRGGGGFGGRGGRGGGGR 695 [145][TOP] >UniRef100_A9V415 Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Monosiga brevicollis RepID=A9V415_MONBE Length = 1125 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +3 Query: 21 GGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTGK 131 GGRGGRGG RGGRGGRGGG+ GGG GG GGR G+ Sbjct: 1087 GGRGGRGG-RGGRGGRGGGR--GGGRGRGGRGGRGGR 1120 [146][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/55 (45%), Positives = 32/55 (58%) Frame = -3 Query: 184 LSRYQRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 + + Q+ ++ + Q +PP PP PPPAS PPP PP PP PPP PP PP Sbjct: 20 IDQQQQQQQQQQHQEQKQQQQQPPPPPP--PPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 + Q P PP PP ASPPP PPP PP PP PPP PP P Sbjct: 36 KQQQQQPPPPPPPPPASPPPPP-PPPPPPPPPPPPPPPPEP 75 [147][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/55 (45%), Positives = 32/55 (58%) Frame = -3 Query: 184 LSRYQRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 + + Q+ ++ + Q +PP PP PPPAS PPP PP PP PPP PP PP Sbjct: 20 IDQQQQQQQQQQHQEQKQQQQQPPPPPP--PPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 + Q P PP PP ASPPP PPP PP PP PPP PP P Sbjct: 36 KQQQQQPPPPPPPPPASPPPPP-PPPPPPPPPPPPPPPPEP 75 [148][TOP] >UniRef100_B4IT39 GE18257 n=1 Tax=Drosophila yakuba RepID=B4IT39_DROYA Length = 740 Score = 51.2 bits (121), Expect(2) = 4e-06 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -3 Query: 151 MARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 M +P P +PP PP+ PPPA PP PPR P PPP PP PP Sbjct: 402 MPQPPTPQP-QPPLPPT--PPPAQPQPPPPPRTPTPPPAPPTPP 442 Score = 22.7 bits (47), Expect(2) = 4e-06 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -1 Query: 201 PPRPPSCPGTSGPRCDAWRGP 139 PP PPS P TS P W+ P Sbjct: 346 PPLPPSPPPTSQPP-PPWQPP 365 [149][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 52.8 bits (125), Expect(2) = 4e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P PP+PP PPP PPP PP PP PPP PP P Sbjct: 85 PAPSPPTAPPQPPPPPPPPP--PPPPPPPPPTPPPTPPPTP 123 Score = 21.2 bits (43), Expect(2) = 4e-06 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 Query: 204 TPPRPPSCPGTSGP 163 TPP PP P S P Sbjct: 77 TPPPPPIIPAPSPP 90 Score = 52.4 bits (124), Expect(2) = 6e-06 Identities = 22/42 (52%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPP-RPPRPPPRPPRPP 20 P P PP PP PPP +P P PP PP+PPP PP PP Sbjct: 63 PPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPP 104 Score = 21.2 bits (43), Expect(2) = 6e-06 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PP PP+ P T P Sbjct: 40 PPTPPTSPATPPP 52 [150][TOP] >UniRef100_C5GLX8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GLX8_AJEDR Length = 1750 Score = 52.8 bits (125), Expect(2) = 5e-06 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPP--RPPPRPPRPPDGAAG 5 P + P+ PP PP PP LPPP PP PP PP PP PP G G Sbjct: 981 PAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGIGG 1028 Score = 20.8 bits (42), Expect(2) = 5e-06 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PP PP P GP Sbjct: 974 PPPPPPPPAVGGP 986 [151][TOP] >UniRef100_C5JYR8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JYR8_AJEDS Length = 1704 Score = 52.8 bits (125), Expect(2) = 5e-06 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPP--RPPPRPPRPPDGAAG 5 P + P+ PP PP PP LPPP PP PP PP PP PP G G Sbjct: 909 PAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGIGG 956 Score = 20.8 bits (42), Expect(2) = 5e-06 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PP PP P GP Sbjct: 902 PPPPPPPPAVGGP 914 [152][TOP] >UniRef100_Q7XPC0 B1248C03.7 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XPC0_ORYSJ Length = 815 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASP--PPASLPPPRPPRPPRPPPRPPRPP 20 P S PV PPRPP+ SP PP P P PP PP PPP PP P Sbjct: 450 PAPSPPVPPPRPPAPSPPAPPPPTPAPSPPAPPAPPPPPPPCP 492 [153][TOP] >UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum bicolor RepID=C5XPK9_SORBI Length = 613 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P S P P PPS SPPP S PPP PP P PPP PP P Sbjct: 427 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPP 466 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P P PPS SPPP S PPP PP PP P P PP PP Sbjct: 410 PPPSPPPPSPPPPSPSPPPPSPPPPSPP-PPSPSPPPPSPP 449 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P P PPS SPPP S PPP PP PP P P PP PP Sbjct: 454 PPPSPPPPSPPPPSPSPPPPSPPPPSPP-PPSPSPPPPSPP 493 [154][TOP] >UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4IYP5_MAIZE Length = 441 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPP--RPPRPPRPPPRPPRPP 20 P LP PP PP SPPP S PPP PP P PPP PP PP Sbjct: 248 PPPRLPSPPPSPPPPSPPPPSPPPPLMSPPPPSPPPPSPPPPP 290 [155][TOP] >UniRef100_C1EFP7 Receptor-like cell wall protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EFP7_9CHLO Length = 1985 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 1465 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 1499 [156][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -3 Query: 133 SLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 S P PP PP PPP S PPP PP PP P P PP PP Sbjct: 34 SPPSPPPSPPPPFPPPPSPPPPPPPLPPPPSPPPPPPP 71 [157][TOP] >UniRef100_A8HQ73 Pepsin-type aspartyl protease n=1 Tax=Chlamydomonas reinhardtii RepID=A8HQ73_CHLRE Length = 547 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRP----PRPPRPPPRPPRP 23 P PP PP A+PPPA+L P RP P PPRPPPR P P Sbjct: 497 PPPPPSPPPAAPPPAALKPKRPRRTSPPPPRPPPRSPSP 535 [158][TOP] >UniRef100_Q6UDW6 Erythrocyte membrane protein 1 n=1 Tax=Plasmodium falciparum RepID=Q6UDW6_PLAFA Length = 2322 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPP-RPPRPPRPPPRPPRPP 20 P RPP PPS PPP+ PPP RPP P RPPP PP PP Sbjct: 1694 PSRPP-PPSRPPPPSRPPPPSRPPPPSRPPPPPPPPP 1729 [159][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PPS+S P+ PPP PP PP PPP PP PP Sbjct: 1524 PPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPPPP 1559 [160][TOP] >UniRef100_B4QNU1 GD12411 n=1 Tax=Drosophila simulans RepID=B4QNU1_DROSI Length = 553 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/53 (56%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Frame = -3 Query: 169 RATVRRMARPQLSLPVRPPRPPSASPPPASLPPP--RPPRPPRPPPRPP-RPP 20 R TVR RP L P RPP P PP LPPP R RPP PP RPP RPP Sbjct: 432 RTTVRTTPRPTLP-PTRPPTRPPTRPPTTYLPPPTVRTTRPPPPPTRPPTRPP 483 [161][TOP] >UniRef100_B4KZE2 GI13529 n=1 Tax=Drosophila mojavensis RepID=B4KZE2_DROMO Length = 981 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/61 (45%), Positives = 32/61 (52%), Gaps = 6/61 (9%) Frame = -3 Query: 184 LSRYQRATVRRMARPQLSLPVRPPRPPSASPPPAS-----LPPPRPPRPPRP-PPRPPRP 23 L R V P + LP P PP PP A LPPP+PP+PP+P PPRPP P Sbjct: 488 LMRPAAMAVLESLEPDIELPSSTPDPPPNPPPNAPPKTPPLPPPQPPQPPQPLPPRPPPP 547 Query: 22 P 20 P Sbjct: 548 P 548 [162][TOP] >UniRef100_C0NIM8 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NIM8_AJECG Length = 281 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PPS SP P PPP PP PP PPP PP P Sbjct: 123 PPPPPSPPSPSPSPPPPPPPPPPPPPPPPPSPPAP 157 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/45 (51%), Positives = 25/45 (55%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAA 8 P LS PP PP + P P+ PPP PP PP PPP PP P A Sbjct: 114 PPLSYSPPPPPPPPSPPSPSPSPPPPPPPPPPPPPPPPPSPPAPA 158 [163][TOP] >UniRef100_A4RL81 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4RL81_MAGGR Length = 486 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/47 (59%), Positives = 29/47 (61%) Frame = +3 Query: 6 PAAPSGGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTGKLSWGR 146 P GG GGRGGGRGG GGRGGG+ GG GG GGR G GR Sbjct: 422 PPREDGGFGGRGGGRGGFGGRGGGRGGGGFGGRGG-GGRGGGRGGGR 467 [164][TOP] >UniRef100_Q55CW0 rRNA 2'-O-methyltransferase fibrillarin n=1 Tax=Dictyostelium discoideum RepID=FBRL_DICDI Length = 334 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +3 Query: 21 GGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTG 128 GGRGG GGGRGGRGG GGG G G A GG GG G Sbjct: 49 GGRGGFGGGRGGRGGFGGGDRGGRGGARGGRGGARG 84 [165][TOP] >UniRef100_UPI00015B4CAB PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B4CAB Length = 972 Score = 52.0 bits (123), Expect(2) = 7e-06 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 151 MARPQLSLPVRPPRPPSASPPPASLPPPRPPRPP-RPPPRPPRPP 20 + RP P RPP PP PP P RPP PP RPP RPP PP Sbjct: 517 VTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPP 561 Score = 21.2 bits (43), Expect(2) = 7e-06 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 204 TPPRPPSCPGTSGP 163 TPP PP+ P T P Sbjct: 476 TPPPPPTRPPTRPP 489 [166][TOP] >UniRef100_A4R5L4 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4R5L4_MAGGR Length = 737 Score = 51.2 bits (121), Expect(2) = 7e-06 Identities = 23/49 (46%), Positives = 26/49 (53%), Gaps = 8/49 (16%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRP--------PPRPPRPP 20 P+ P PP+PP PPA PP PPRPP P PP PP+PP Sbjct: 537 PRRGEPPAPPKPPPFGEPPAPPRPPAPPRPPAPPKPPPFGKPPAPPKPP 585 Score = 21.9 bits (45), Expect(2) = 7e-06 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 207 GTPPRPPSCPGTSGP 163 G PPRP + P GP Sbjct: 522 GGPPRPGNPPALGGP 536 [167][TOP] >UniRef100_UPI0001A7B0BF actin binding n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B0BF Length = 605 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/52 (51%), Positives = 30/52 (57%), Gaps = 7/52 (13%) Frame = -3 Query: 142 PQLSLPV---RPPRPPSASPPPASLPPPRPPRPPRPPPR----PPRPPDGAA 8 P L LP PP PP+A+PPP PPP P P PPP+ PP PP GAA Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAA 305 [168][TOP] >UniRef100_UPI00019259C5 PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI00019259C5 Length = 496 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PV PP PP PPPA LPP PP P PPP PP PP Sbjct: 420 PVPPPVPPPFPPPPAPLPPVPPPAPLPPPPPPPVPP 455 [169][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/49 (51%), Positives = 26/49 (53%) Frame = -3 Query: 169 RATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 RA R L P+ PP PP PPP PPP PP PP PPP PP P Sbjct: 3 RAAGGRNNEIYLPPPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPPPPLP 51 [170][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/49 (55%), Positives = 27/49 (55%) Frame = -3 Query: 160 VRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDG 14 V MAR LP PP PP PPP PPP PP PP PPP PR P G Sbjct: 1464 VIHMARETPPLPPPPPPPPPPPPPPP--PPPPPPPPPPPPPPLPRTPRG 1510 [171][TOP] >UniRef100_UPI0000DC1294 UPI0000DC1294 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DC1294 Length = 90 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP PPPA PPP PP PP PPP PP PP Sbjct: 56 PPPPPDPPPPPAPPPPPAPPAPP-PPPAPPAPP 87 [172][TOP] >UniRef100_UPI00016E4781 UPI00016E4781 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E4781 Length = 906 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/55 (47%), Positives = 28/55 (50%), Gaps = 6/55 (10%) Frame = -3 Query: 151 MARPQLSLPVRPPRP------PSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 M P LP+ PP P P+ SPP PPP PP PP PPP PP PP G Sbjct: 578 MNHPPPPLPLPPPSPRLNPTIPNQSPPTPRPPPPPPPPPPPPPPPPPPPPQHPEG 632 [173][TOP] >UniRef100_Q4A373 Putative lectin protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A373_EHV86 Length = 1994 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/42 (57%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = -3 Query: 130 LPVRPPRPPSASPPPASLPPPRPPRPPRPPPRP---PRPPDG 14 LP PP PP SPPP + PP PP PP PPP P P PP G Sbjct: 1690 LPPSPPSPPPPSPPPPASPPLLPPAPPSPPPPPDPAPPPPPG 1731 [174][TOP] >UniRef100_Q60399 Chinese hamster C23 nucleolin, glycine rich region. (Fragment) n=1 Tax=Cricetus cricetus RepID=Q60399_CRICR Length = 192 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 4/40 (10%) Frame = +3 Query: 21 GGRGGRGGGRGGRGGRGGGKEAG----GGEALGGLGGRTG 128 GG GGRGGGRGG GGRGGG+ G GG GG GGR G Sbjct: 129 GGFGGRGGGRGGFGGRGGGRGGGRGGFGGRGRGGFGGRGG 168 [175][TOP] >UniRef100_Q091P4 Putative uncharacterized protein n=1 Tax=Stigmatella aurantiaca DW4/3-1 RepID=Q091P4_STIAU Length = 407 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/69 (46%), Positives = 38/69 (55%), Gaps = 9/69 (13%) Frame = -3 Query: 190 AVLSRYQRATVRRMARPQLSLPVR------PPRPPSASPPPASLPP---PRPPRPPRPPP 38 A+LS ++A VR + P S PV PP PP+ PP+S P PRPPRP RP P Sbjct: 22 ALLSGSEQAPVRPRS-PLASSPVAVDLVFVPPAPPAPQAPPSSSRPEGPPRPPRPSRPKP 80 Query: 37 RPPRPPDGA 11 PP PP A Sbjct: 81 SPPAPPPSA 89 [176][TOP] >UniRef100_C4B111 Intracellular motility protein A n=4 Tax=Burkholderia mallei RepID=C4B111_BURMA Length = 373 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRP 23 P PP PP SPPP S PPP PP P PPP PP P Sbjct: 98 PPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 132 [177][TOP] >UniRef100_Q9SRL3 Putative uncharacterized protein F9F8.15 n=1 Tax=Arabidopsis thaliana RepID=Q9SRL3_ARATH Length = 451 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 PP PP SPPP S PPP PP PP PPP P PP A G Sbjct: 64 PPPPPPTSPPPPSPPPPSPP-PPSPPPPSPPPPAFAVG 100 [178][TOP] >UniRef100_Q6ZD62 Os08g0108300 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ZD62_ORYSJ Length = 342 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP +PPP S+PPP PPR PPP P PP Sbjct: 92 PALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPP 127 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/48 (54%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = -3 Query: 154 RMARPQLSLPVRPPRPPSASPPPASLPPPRP---PRPPRPPPRPPRPP 20 R A P S+P PP PP +PPP + PPP P P PP PP RPP PP Sbjct: 100 RRAPPPPSMP--PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPP 145 [179][TOP] >UniRef100_Q42421 Chitinase n=1 Tax=Beta vulgaris subsp. vulgaris RepID=Q42421_BETVU Length = 439 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -3 Query: 151 MARPQLSLPVRPP--RPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 + RP P RPP RPP PP PPPRPP PRPPP PRPP Sbjct: 45 VGRPSRPTPPRPPTPRPPPPRPPTPRPPPPRPP-TPRPPPPTPRPP 89 [180][TOP] >UniRef100_Q00TD0 Chromosome 17 contig 1, DNA sequence. (Fragment) n=1 Tax=Ostreococcus tauri RepID=Q00TD0_OSTTA Length = 281 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP P SPPP S PPP PP P PPP PP PP Sbjct: 120 PPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPP 155 [181][TOP] >UniRef100_C1FHQ4 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FHQ4_9CHLO Length = 1159 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/47 (51%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -3 Query: 154 RMARPQLSLPVRPPRPPSASPPPASLPPPRP--PRPPRPPPRPPRPP 20 R + P P PP PP PPP LPPP P P P PPP PP PP Sbjct: 314 RWSEPPPPSPPPPPSPPPPGPPPPPLPPPSPRAPPSPNPPPAPPPPP 360 [182][TOP] >UniRef100_C1EC31 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EC31_9CHLO Length = 939 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPPDGAAG 5 P P PP SPPP+S PP PP PPRPPP PP P G Sbjct: 494 PSPPSPPPPPSPPPSSPPPSPPPFPPRPPPLPPPAPSTRTG 534 [183][TOP] >UniRef100_A9RYC3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RYC3_PHYPA Length = 465 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/36 (58%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP+ SPPP P P PP PP P P PP PP Sbjct: 409 PPSPPPPPTPSPPPPPTPTPSPPPPPTPTPSPPPPP 444 [184][TOP] >UniRef100_Q1HMI7 Formin B n=2 Tax=Trypanosoma cruzi RepID=Q1HMI7_TRYCR Length = 968 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 5/45 (11%) Frame = -3 Query: 133 SLPVRPPRPPSASPPPASLPPPRPP-----RPPRPPPRPPRPPDG 14 S+P P PS+SPPP + PPP PP PP PPP PP PP G Sbjct: 453 SIPTNQPVSPSSSPPPRTPPPPPPPPPGKNAPPPPPPPPPPPPHG 497 [185][TOP] >UniRef100_B4JKE8 GH12647 n=1 Tax=Drosophila grimshawi RepID=B4JKE8_DROGR Length = 232 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = +3 Query: 21 GGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTGKLSW 140 GGRGG GGG GG GG GG K AGGG GG GG G W Sbjct: 85 GGRGGYGGGGGGGGGAGGWKGAGGGGGAGGYGGGGGAGGW 124 [186][TOP] >UniRef100_Q2U9G0 Rho GTPase effector BNI1 and related formins n=1 Tax=Aspergillus oryzae RepID=Q2U9G0_ASPOR Length = 1813 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/51 (52%), Positives = 28/51 (54%), Gaps = 10/51 (19%) Frame = -3 Query: 127 PVRPPRPPSASPPPAS---LPPPRPPRPPRP-------PPRPPRPPDGAAG 5 P PP PP PPP S +PPP PP PP P PP PP PP GAAG Sbjct: 1051 PPPPPPPPPPPPPPGSATGVPPPPPPPPPPPGMGAGIPPPPPPPPPPGAAG 1101 [187][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P+ P PP PPPAS PPP PP PP PP P PP Sbjct: 145 PPSSAPLPQPPPPPPPPPPASAPPPPPPPPPPPPISPSLPP 185 [188][TOP] >UniRef100_B8ND33 Cytokinesis protein SepA n=1 Tax=Aspergillus flavus NRRL3357 RepID=B8ND33_ASPFN Length = 1813 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/51 (52%), Positives = 28/51 (54%), Gaps = 10/51 (19%) Frame = -3 Query: 127 PVRPPRPPSASPPPAS---LPPPRPPRPPRP-------PPRPPRPPDGAAG 5 P PP PP PPP S +PPP PP PP P PP PP PP GAAG Sbjct: 1051 PPPPPPPPPPPPPPGSATGVPPPPPPPPPPPGMGAGIPPPPPPPPPPGAAG 1101 [189][TOP] >UniRef100_P08199 Nucleolin n=1 Tax=Mesocricetus auratus RepID=NUCL_MESAU Length = 714 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 4/40 (10%) Frame = +3 Query: 21 GGRGGRGGGRGGRGGRGGGKEAG----GGEALGGLGGRTG 128 GG GGRGGGRGG GGRGGG+ G GG GG GGR G Sbjct: 651 GGFGGRGGGRGGFGGRGGGRGGGRGGFGGRGRGGFGGRGG 690 [190][TOP] >UniRef100_O23373 Formin-like protein 3 n=1 Tax=Arabidopsis thaliana RepID=FH3_ARATH Length = 785 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/52 (51%), Positives = 30/52 (57%), Gaps = 7/52 (13%) Frame = -3 Query: 142 PQLSLPV---RPPRPPSASPPPASLPPPRPPRPPRPPPR----PPRPPDGAA 8 P L LP PP PP+A+PPP PPP P P PPP+ PP PP GAA Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAA 305 [191][TOP] >UniRef100_UPI0001A2BBDD hypothetical protein LOC100009637 n=1 Tax=Danio rerio RepID=UPI0001A2BBDD Length = 502 Score = 51.2 bits (121), Expect(2) = 7e-06 Identities = 25/53 (47%), Positives = 28/53 (52%), Gaps = 10/53 (18%) Frame = -3 Query: 148 ARPQLSLPVRPP----RPPSASPPPASLPPPRPPRP------PRPPPRPPRPP 20 +RP + P PP PP P PAS+PPP PP P P PPP PP PP Sbjct: 329 SRPSMGAPPPPPPSRGHPPPPPPAPASMPPPPPPPPMSGGAAPPPPPPPPPPP 381 Score = 21.9 bits (45), Expect(2) = 7e-06 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 207 GTPPRPPSCPGTSGP 163 G PP PP P TSGP Sbjct: 285 GPPPPPP--PHTSGP 297 [192][TOP] >UniRef100_A2RUY4 Zgc:158395 protein n=1 Tax=Danio rerio RepID=A2RUY4_DANRE Length = 502 Score = 51.2 bits (121), Expect(2) = 7e-06 Identities = 25/53 (47%), Positives = 28/53 (52%), Gaps = 10/53 (18%) Frame = -3 Query: 148 ARPQLSLPVRPP----RPPSASPPPASLPPPRPPRP------PRPPPRPPRPP 20 +RP + P PP PP P PAS+PPP PP P P PPP PP PP Sbjct: 329 SRPSMGAPPPPPPSRGHPPPPPPAPASMPPPPPPPPMSGGAAPPPPPPPPPPP 381 Score = 21.9 bits (45), Expect(2) = 7e-06 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 207 GTPPRPPSCPGTSGP 163 G PP PP P TSGP Sbjct: 285 GPPPPPP--PHTSGP 297 [193][TOP] >UniRef100_UPI00016E98C2 UPI00016E98C2 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E98C2 Length = 500 Score = 49.3 bits (116), Expect(2) = 7e-06 Identities = 25/52 (48%), Positives = 28/52 (53%), Gaps = 9/52 (17%) Frame = -3 Query: 148 ARPQLSLPVRPPRPPSASPPP---------ASLPPPRPPRPPRPPPRPPRPP 20 +RP +S P PP PPS PPP + PPP PP PP P P PP PP Sbjct: 337 SRPGISAPPPPP-PPSRPPPPPPPSIPSGGGAPPPPPPPPPPPPGPPPPAPP 387 Score = 23.9 bits (50), Expect(2) = 7e-06 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PP PPS PG S P Sbjct: 332 PPPPPSRPGISAP 344 [194][TOP] >UniRef100_A1KR25 Cell wall glycoprotein GP2 (Fragment) n=2 Tax=Chlamydomonas reinhardtii RepID=A1KR25_CHLRE Length = 1226 Score = 52.4 bits (124), Expect(2) = 9e-06 Identities = 27/49 (55%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = -3 Query: 142 PQLSLPVRPP--RPPSASPPPASLPP--PRPPRPPRPPPRPPRPPDGAA 8 P LS P PP PP +PPP S PP P PP PP P P PP PP AA Sbjct: 970 PVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAA 1018 Score = 20.4 bits (41), Expect(2) = 9e-06 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PP PPS P S P Sbjct: 956 PPTPPSPPPPSPP 968 [195][TOP] >UniRef100_Q9XDH2 Proline-rich mucin homolog n=1 Tax=Mycobacterium tuberculosis RepID=Q9XDH2_MYCTU Length = 763 Score = 52.4 bits (124), Expect(2) = 9e-06 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -3 Query: 148 ARPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRP--PPRPPRPP 20 A P+ S+P PP PPS PP L PP PP PP P PP PP PP Sbjct: 513 AAPRASMPALPPAPPS--PPATRLCPPLPPSPPAPNSPPAPPAPP 555 Score = 20.4 bits (41), Expect(2) = 9e-06 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -1 Query: 201 PPRPPSCPGTSGP 163 PP PP+ P S P Sbjct: 508 PPAPPAAPRASMP 520 [196][TOP] >UniRef100_A8HTC4 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HTC4_CHLRE Length = 512 Score = 50.1 bits (118), Expect(2) = 9e-06 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPP-PRPPRPPRP-PPRPPRP 23 P P PP+PP + PP+ PP P+PP+PP P PPRPP P Sbjct: 100 PSPKPPSPPPKPPPSPKPPSPSPPSPKPPKPPSPNPPRPPSP 141 Score = 22.7 bits (47), Expect(2) = 9e-06 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 207 GTPPRPPSCPGTSGPR 160 GTPP PP P PR Sbjct: 81 GTPPSPPRPPLPPSPR 96 [197][TOP] >UniRef100_UPI00015B5E40 PREDICTED: similar to CG4038-PA n=1 Tax=Nasonia vitripennis RepID=UPI00015B5E40 Length = 226 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = +3 Query: 21 GGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTGKLSWG 143 GGRGG GGGRGG GGRGGG GG GG GGR G +G Sbjct: 156 GGRGGGGGGRGGFGGRGGGGGFGGRGGGGGFGGRGGGGGFG 196 [198][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -3 Query: 118 PPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PP PP PPP PPP PP PP PPP PP PP Sbjct: 77 PPPPPLPPPPPLPPPPPLPPPPPPPPPLPPPPP 109 [199][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPP--RPPRPPPRPPRPP 20 P PP PP SPPP S PPP PP PP PPP PP PP Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 [200][TOP] >UniRef100_Q6YYS1 Putative uncharacterized protein B1047A05.11 n=1 Tax=Oryza sativa Japonica Group RepID=Q6YYS1_ORYSJ Length = 107 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -3 Query: 142 PQLSLPVRPPRPPSAS-PPPASLPPPRPPRPPRPPPRPPRP 23 P P RPP PPS++ PPP PPP PP P PPP PP P Sbjct: 26 PHQPKPTRPPSPPSSTLPPPPPAPPPPPPSLPPPPPPPPSP 66 [201][TOP] >UniRef100_Q5ZB68 Os01g0594300 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5ZB68_ORYSJ Length = 551 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P P PPS SPPP S PPP PP PP P P PP PP Sbjct: 401 PPPSPPPPSPPPPSPSPPPPSPPPPSPP-PPSPSPPPPSPP 440 [202][TOP] >UniRef100_Q4U2V8 Hydroxyproline-rich glycoprotein GAS28 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V8_CHLRE Length = 433 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/61 (47%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -3 Query: 199 TAAAVLSRYQRATVRRMARPQLSLPVRPPRPPSASPP-PASLPPPRPPRPPRPPPRPPRP 23 +A A L +Y + R P L PP PPS SPP P S PP PP PP PPP P P Sbjct: 192 SAGAGLCKYALSNQDRDCCPVSILGNAPPPPPSPSPPSPPSPSPPPPPSPPPPPPPTPSP 251 Query: 22 P 20 P Sbjct: 252 P 252 [203][TOP] >UniRef100_Q2QY58 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q2QY58_ORYSJ Length = 950 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/46 (52%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -3 Query: 154 RMARPQLSLPVRPPRPPSASPPPASLPPPRP--PRPPRPPPRPPRP 23 R A ++ P PP PPS P S+PPPRP P PP PPP PP P Sbjct: 447 RQAASRVPSPPAPPSPPSPPAPSPSVPPPRPPAPSPPAPPPPPPAP 492 [204][TOP] >UniRef100_C5YLU5 Putative uncharacterized protein Sb07g000890 n=1 Tax=Sorghum bicolor RepID=C5YLU5_SORBI Length = 318 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P PP PP +PPP +LPPP P R P PP PP PP Sbjct: 66 PTLPPPPPRRAPPPPALPPPPPRRAPPPPTMPPPPP 101 [205][TOP] >UniRef100_C1EBZ3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EBZ3_9CHLO Length = 191 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +3 Query: 21 GGRGGRGGGRGGRGGRGGGKEAGGGEALGGLGGRTG 128 GG GGRGGGRGGRGGRGGG+ GGG G GGR G Sbjct: 132 GGGGGRGGGRGGRGGRGGGR--GGGRGGGRGGGRGG 165 [206][TOP] >UniRef100_B9SMV7 Vegetative cell wall protein gp1, putative n=1 Tax=Ricinus communis RepID=B9SMV7_RICCO Length = 479 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 127 PVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 PV P PP SPPP PPP PP P PPP PP PP Sbjct: 190 PVIVPSPPPPSPPPPCPPPPSPPPPSPPPPSPPPPP 225 [207][TOP] >UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9EXV1_ORYSJ Length = 532 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P P PPS SPPP S PPP PP PP P P PP PP Sbjct: 365 PPPSPPPPSPPPPSPSPPPPSPPPPSPP-PPSPSPPPPSPP 404 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P P PPS SPPP S PPP PP PP P P PP PP Sbjct: 382 PPPSPPPPSPPPPSPSPPPPSPPPPSPP-PPSPSPPPPSPP 421 [208][TOP] >UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa RepID=Q8L3T8_ORYSJ Length = 570 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P P PPS SPPP S PPP PP PP P P PP PP Sbjct: 403 PPPSPPPPSPPPPSPSPPPPSPPPPSPP-PPSPSPPPPSPP 442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 P S P P PPS SPPP S PPP PP PP P P PP PP Sbjct: 420 PPPSPPPPSPPPPSPSPPPPSPPPPSPP-PPSPSPPPPSPP 459 [209][TOP] >UniRef100_A0EFA7 Chromosome undetermined scaffold_93, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0EFA7_PARTE Length = 1566 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/42 (47%), Positives = 27/42 (64%) Frame = -3 Query: 145 RPQLSLPVRPPRPPSASPPPASLPPPRPPRPPRPPPRPPRPP 20 +P + PV PP+PP P P + PP P PP+PP +PP+PP Sbjct: 392 QPPVKPPVEPPKPPVEPPQPPTEPPKPPAEPPQPPVQPPQPP 433 [210][TOP] >UniRef100_A3LNF1 Putative uncharacterized protein n=1 Tax=Pichia stipitis RepID=A3LNF1_PICST Length = 442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/57 (49%), Positives = 30/57 (52%), Gaps = 8/57 (14%) Frame = -3 Query: 166 ATVRRMARP------QLSLPVRPPRPPSASPPPASLPPPRPPRPPRP--PPRPPRPP 20 A+ R MARP LS PP PP+ PPA PP PP PP P PP PP PP Sbjct: 217 ASARSMARPFHATHVPLSYDHHPPAPPAPPAPPAPPAPPAPPAPPAPPAPPAPPAPP 273 [211][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/60 (43%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = -3 Query: 172 QRATVRRMARPQLSLPVRPPRPPSASPPPASLPPPRPPR----PPRPPPRPPRPPDGAAG 5 + A + ++ +S P PP PP PPP PPP PP PP PPP PP PP G G Sbjct: 1005 EEAKLESESKKPVSAPAPPPPPPPPPPPPP--PPPPPPGAIGVPPPPPPPPPPPPPGGKG 1062 [212][TOP] >UniRef100_Q94B77 Formin-like protein 5 n=1 Tax=Arabidopsis thaliana RepID=FH5_ARATH Length = 900 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 10/57 (17%) Frame = -3 Query: 142 PQLSLPVRPPRPPSASPPPAS----LPPPRPPRPPRPP------PRPPRPPDGAAGA 2 PQ+ PPRPP +PPP S PPP P+ PRPP P+ PRPP G A A Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGPADA 433