[UP]
[1][TOP] >UniRef100_Q9ZSJ4 Chlorophyll a-b binding protein of LHCII n=1 Tax=Chlamydomonas reinhardtii RepID=Q9ZSJ4_CHLRE Length = 268 Score = 104 bits (260), Expect = 3e-21 Identities = 50/68 (73%), Positives = 54/68 (79%), Gaps = 3/68 (4%) Frame = +3 Query: 75 PRRPLPPRPRKPS---GEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPG 245 P++ P +K + GW SNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPG Sbjct: 21 PKKAAPASAQKKTIREKAGWW--SNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPG 78 Query: 246 DYGWDSAG 269 DYGWDSAG Sbjct: 79 DYGWDSAG 86 [2][TOP] >UniRef100_A2SY46 Light-harvesting chlorophyll-a/b binding protein LhcbM5 (Fragment) n=1 Tax=Chlamydomonas incerta RepID=A2SY46_CHLIN Length = 232 Score = 103 bits (256), Expect = 8e-21 Identities = 49/68 (72%), Positives = 53/68 (77%), Gaps = 3/68 (4%) Frame = +3 Query: 75 PRRPLPPRPRKPS---GEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPG 245 P++ P +K + GW SNGGNEKL AFYGPDRGLWLGPLSGTTPAYLTGEFPG Sbjct: 15 PKKAAPASAQKKTIREKAGWW--SNGGNEKLGAFYGPDRGLWLGPLSGTTPAYLTGEFPG 72 Query: 246 DYGWDSAG 269 DYGWDSAG Sbjct: 73 DYGWDSAG 80 [3][TOP] >UniRef100_Q41787 Light harvesting chlorophyll a /b binding protein n=1 Tax=Zea mays RepID=Q41787_MAIZE Length = 265 Score = 73.2 bits (178), Expect = 9e-12 Identities = 37/77 (48%), Positives = 44/77 (57%) Frame = +3 Query: 39 PSSTSQYRRVVRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTP 218 PSS++ RV + +P SG W YGPDR L+LGPLSG P Sbjct: 21 PSSSAFEARVTMRKTAAKAKPAAASGSPW--------------YGPDRVLYLGPLSGEPP 66 Query: 219 AYLTGEFPGDYGWDSAG 269 +YLTGEFPGDYGWD+AG Sbjct: 67 SYLTGEFPGDYGWDTAG 83 [4][TOP] >UniRef100_A8HPF9 Chloroplast light-harvesting complex II protein (Fragment) n=1 Tax=Euglena gracilis RepID=A8HPF9_EUGGR Length = 613 Score = 73.2 bits (178), Expect = 9e-12 Identities = 31/47 (65%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +3 Query: 132 ESNGGNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 +S ++KL+A+YGP+R WLGP S G+TP+YLTGEFPGDYGWD+AG Sbjct: 128 KSTPASDKLAAWYGPNRNKWLGPFSEGSTPSYLTGEFPGDYGWDTAG 174 Score = 73.2 bits (178), Expect = 9e-12 Identities = 31/47 (65%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +3 Query: 132 ESNGGNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 +S ++KL+A+YGP+R WLGP S G+TP+YLTGEFPGDYGWD+AG Sbjct: 368 KSTPASDKLAAWYGPNRNKWLGPFSEGSTPSYLTGEFPGDYGWDTAG 414 [5][TOP] >UniRef100_A4QPI3 Chloroplast light-harvesting complex II protein Lhcbm6 (Fragment) n=1 Tax=Euglena gracilis RepID=A4QPI3_EUGGR Length = 825 Score = 73.2 bits (178), Expect = 9e-12 Identities = 31/47 (65%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +3 Query: 132 ESNGGNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 +S ++KL+A+YGP+R WLGP S G+TP+YLTGEFPGDYGWD+AG Sbjct: 111 KSTPASDKLAAWYGPNRNKWLGPFSEGSTPSYLTGEFPGDYGWDTAG 157 Score = 70.9 bits (172), Expect = 4e-11 Identities = 30/47 (63%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +3 Query: 132 ESNGGNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 +S ++KL+A+YGP+R WLGP S +TP+YLTGEFPGDYGWD+AG Sbjct: 351 KSTPASDKLAAWYGPNRNKWLGPFSENSTPSYLTGEFPGDYGWDTAG 397 Score = 70.9 bits (172), Expect = 4e-11 Identities = 30/47 (63%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +3 Query: 132 ESNGGNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 +S ++KL+A+YGP+R WLGP S +TP+YLTGEFPGDYGWD+AG Sbjct: 591 KSTPASDKLAAWYGPNRNKWLGPFSENSTPSYLTGEFPGDYGWDTAG 637 [6][TOP] >UniRef100_P06671 Chlorophyll a-b binding protein, chloroplastic n=1 Tax=Zea mays RepID=CB22_MAIZE Length = 265 Score = 72.4 bits (176), Expect = 1e-11 Identities = 37/77 (48%), Positives = 43/77 (55%) Frame = +3 Query: 39 PSSTSQYRRVVRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTP 218 PSS+ RV + +P SG W YGPDR L+LGPLSG P Sbjct: 21 PSSSFGEARVTMRKTAAKAKPAAASGSPW--------------YGPDRVLYLGPLSGEPP 66 Query: 219 AYLTGEFPGDYGWDSAG 269 +YLTGEFPGDYGWD+AG Sbjct: 67 SYLTGEFPGDYGWDTAG 83 [7][TOP] >UniRef100_Q39726 Chlorophyll a/b binding protein (Fragment) n=2 Tax=Euglena gracilis RepID=Q39726_EUGGR Length = 334 Score = 72.0 bits (175), Expect = 2e-11 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 150 EKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 + LS +YGPDR WLGPL+G PAYLTGE PGDYGWD+AG Sbjct: 147 DNLSQWYGPDRAKWLGPLTGQVPAYLTGELPGDYGWDTAG 186 [8][TOP] >UniRef100_B4FUA1 Chlorophyll a-b binding protein 1 n=1 Tax=Zea mays RepID=B4FUA1_MAIZE Length = 265 Score = 72.0 bits (175), Expect = 2e-11 Identities = 37/77 (48%), Positives = 42/77 (54%) Frame = +3 Query: 39 PSSTSQYRRVVRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTP 218 PSS RV + +P SG W YGPDR L+LGPLSG P Sbjct: 21 PSSLFGEARVTMRKTAAKAKPAASSGSPW--------------YGPDRVLYLGPLSGAPP 66 Query: 219 AYLTGEFPGDYGWDSAG 269 +YLTGEFPGDYGWD+AG Sbjct: 67 SYLTGEFPGDYGWDTAG 83 [9][TOP] >UniRef100_C5YVW5 Putative uncharacterized protein Sb09g028720 n=1 Tax=Sorghum bicolor RepID=C5YVW5_SORBI Length = 265 Score = 71.6 bits (174), Expect = 3e-11 Identities = 37/77 (48%), Positives = 42/77 (54%) Frame = +3 Query: 39 PSSTSQYRRVVRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTP 218 PSS RV + +P SG W YGPDR L+LGPLSG P Sbjct: 21 PSSLFGEARVTMRKTAAKAKPAAASGSPW--------------YGPDRVLYLGPLSGEPP 66 Query: 219 AYLTGEFPGDYGWDSAG 269 +YLTGEFPGDYGWD+AG Sbjct: 67 SYLTGEFPGDYGWDTAG 83 [10][TOP] >UniRef100_P27497 Chlorophyll a-b binding protein M9, chloroplastic n=1 Tax=Zea mays RepID=CB29_MAIZE Length = 265 Score = 71.6 bits (174), Expect = 3e-11 Identities = 37/77 (48%), Positives = 42/77 (54%) Frame = +3 Query: 39 PSSTSQYRRVVRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTP 218 PSS RV + +P SG W YGPDR L+LGPLSG P Sbjct: 21 PSSLFGEARVTMRKTAAKAKPAASSGSPW--------------YGPDRVLYLGPLSGEPP 66 Query: 219 AYLTGEFPGDYGWDSAG 269 +YLTGEFPGDYGWD+AG Sbjct: 67 SYLTGEFPGDYGWDTAG 83 [11][TOP] >UniRef100_Q39725 Light harvesting chlorophyll a /b binding protein of PSII (Fragment) n=1 Tax=Euglena gracilis RepID=Q39725_EUGGR Length = 1055 Score = 71.2 bits (173), Expect = 3e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 147 NEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 ++ LS +YGPDR WLGPL+G P+YLTGE PGDYGWD+AG Sbjct: 128 SDNLSQWYGPDRAKWLGPLTGEVPSYLTGELPGDYGWDTAG 168 Score = 71.2 bits (173), Expect = 3e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 147 NEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 ++ LS +YGPDR WLGPL+G P+YLTGE PGDYGWD+AG Sbjct: 589 SDNLSQWYGPDRAKWLGPLTGEVPSYLTGELPGDYGWDTAG 629 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = +3 Query: 156 LSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 L+ YGPDR WLG +G P YLTGE PGDYGWD+AG Sbjct: 834 LNKLYGPDRVKWLGGFTGFVPEYLTGELPGDYGWDTAG 871 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSG-TTPAYLTGEFPGDYGWDSAG 269 S +YGP+R WLGPLSG P YL GE+ GDYG+D+AG Sbjct: 357 SKWYGPNRPKWLGPLSGGAVPEYLKGEYAGDYGFDTAG 394 [12][TOP] >UniRef100_A8HPF3 Chloroplast light-harvesting complex II protein (Fragment) n=1 Tax=Euglena gracilis RepID=A8HPF3_EUGGR Length = 545 Score = 71.2 bits (173), Expect = 3e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 147 NEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 ++ LS +YGPDR WLGPL+G P+YLTGE PGDYGWD+AG Sbjct: 91 SDNLSQWYGPDRAKWLGPLTGEVPSYLTGELPGDYGWDTAG 131 Score = 71.2 bits (173), Expect = 3e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 147 NEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 ++ LS +YGPDR WLGPL+G P+YLTGE PGDYGWD+AG Sbjct: 326 SDNLSQWYGPDRAKWLGPLTGEVPSYLTGELPGDYGWDTAG 366 [13][TOP] >UniRef100_A4QPI0 Chloroplast light-harvesting complex II protein Lhcbm4 (Fragment) n=1 Tax=Euglena gracilis RepID=A4QPI0_EUGGR Length = 367 Score = 71.2 bits (173), Expect = 3e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 147 NEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 ++ LS +YGPDR WLGPL+G P+YLTGE PGDYGWD+AG Sbjct: 39 SDNLSQWYGPDRAKWLGPLTGEVPSYLTGELPGDYGWDTAG 79 Score = 71.2 bits (173), Expect = 3e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 147 NEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 ++ LS +YGPDR WLGPL+G P+YLTGE PGDYGWD+AG Sbjct: 274 SDNLSQWYGPDRAKWLGPLTGEVPSYLTGELPGDYGWDTAG 314 [14][TOP] >UniRef100_A4QPH8 Chloroplast light-harvesting complex II protein Lhcbm1 (Fragment) n=1 Tax=Euglena gracilis RepID=A4QPH8_EUGGR Length = 642 Score = 71.2 bits (173), Expect = 3e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 147 NEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 ++ LS +YGPDR WLGPL+G P+YLTGE PGDYGWD+AG Sbjct: 385 SDNLSQWYGPDRAKWLGPLTGEVPSYLTGELPGDYGWDTAG 425 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSG-TTPAYLTGEFPGDYGWDSAG 269 S +YGP+R WLGPLSG P YL GE+ GDYG+D+AG Sbjct: 153 SKWYGPNRPKWLGPLSGGAVPEYLKGEYAGDYGFDTAG 190 [15][TOP] >UniRef100_Q9XFU8 Putative uncharacterized protein (Fragment) n=1 Tax=Chlamydomonas sp. HS-5 RepID=Q9XFU8_9CHLO Length = 222 Score = 70.5 bits (171), Expect = 6e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 165 FYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 FYGPDR WLGP S TP+YLTGEFPGDYGWD+AG Sbjct: 32 FYGPDRAKWLGPFSDDTPSYLTGEFPGDYGWDTAG 66 [16][TOP] >UniRef100_O22496 Chlorophyll a/b binding protein n=1 Tax=Tetraselmis sp. RG-15 RepID=O22496_9CHLO Length = 251 Score = 70.5 bits (171), Expect = 6e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 165 FYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 FYGPDR WLGP S TP+YLTGEFPGDYGWD+AG Sbjct: 34 FYGPDRAKWLGPFSDDTPSYLTGEFPGDYGWDTAG 68 [17][TOP] >UniRef100_A8BDJ0 Major light-harvesting chlorophyll a/b protein 3 n=1 Tax=Dunaliella salina RepID=A8BDJ0_DUNSA Length = 261 Score = 69.7 bits (169), Expect = 1e-10 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +3 Query: 129 VESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 V+ + G+ SA+YGPDR L+LG LSG P+YLTGEFPGDYGWD+AG Sbjct: 30 VKPSKGSTPDSAWYGPDRPLFLGSLSGEPPSYLTGEFPGDYGWDTAG 76 [18][TOP] >UniRef100_P22686 Chlorophyll a-b binding protein of LHCII type I, chloroplastic n=1 Tax=Chlamydomonas moewusii RepID=CB2_CHLMO Length = 256 Score = 69.7 bits (169), Expect = 1e-10 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 165 FYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 +YGPDR WLGP S TPAYLTGEFPGDYGWD+AG Sbjct: 39 WYGPDRAKWLGPFSTNTPAYLTGEFPGDYGWDTAG 73 [19][TOP] >UniRef100_Q32291 Chlorophyll A/B binding protein n=1 Tax=Gossypium hirsutum RepID=Q32291_GOSHI Length = 264 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 82 [20][TOP] >UniRef100_C1K5D0 Chloroplast chlorophyll A-B binding protein n=1 Tax=Gossypium hirsutum RepID=C1K5D0_GOSHI Length = 264 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 82 [21][TOP] >UniRef100_B4FQ80 Chlorophyll a-b binding protein 2 n=1 Tax=Zea mays RepID=B4FQ80_MAIZE Length = 266 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 84 [22][TOP] >UniRef100_B4FGG4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FGG4_MAIZE Length = 185 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 84 [23][TOP] >UniRef100_B0L806 Chloroplast chlorophyll a/b binding protein n=1 Tax=Phyllostachys edulis RepID=B0L806_9POAL Length = 265 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 83 [24][TOP] >UniRef100_A9TKU6 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TKU6_PHYPA Length = 266 Score = 69.3 bits (168), Expect = 1e-10 Identities = 35/76 (46%), Positives = 47/76 (61%) Frame = +3 Query: 42 SSTSQYRRVVRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPA 221 S+T + ++RP L + S + +V + S +YGPDR L+LGP SG TP+ Sbjct: 9 STTFAGQSLLRPANELAQKVG--SNQARVVMRGSKSSSGSMWYGPDRPLFLGPFSGNTPS 66 Query: 222 YLTGEFPGDYGWDSAG 269 YL GEFPGDYGWD+AG Sbjct: 67 YLKGEFPGDYGWDTAG 82 [25][TOP] >UniRef100_A8D752 Light-harvesting chlorophyll a/b-binding protein (Fragment) n=1 Tax=Camellia sinensis RepID=A8D752_CAMSI Length = 153 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 44 SPWYGPDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAG 80 [26][TOP] >UniRef100_A7QQL7 Chromosome undetermined scaffold_143, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QQL7_VITVI Length = 264 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAG 82 [27][TOP] >UniRef100_A5BAI4 Chromosome undetermined scaffold_143, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A5BAI4_VITVI Length = 264 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAG 82 [28][TOP] >UniRef100_A5B5I4 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B5I4_VITVI Length = 264 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAG 82 [29][TOP] >UniRef100_Q461R4 Chloroplast putative light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus krempfii RepID=Q461R4_PINKR Length = 250 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 147 NEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 +E S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SESPSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 88 [30][TOP] >UniRef100_Q8W0E6 Os01g0720500 protein n=2 Tax=Oryza sativa RepID=Q8W0E6_ORYSJ Length = 265 Score = 68.9 bits (167), Expect = 2e-10 Identities = 34/69 (49%), Positives = 39/69 (56%) Frame = +3 Query: 63 RVVRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFP 242 RV + P+P SG W YG DR L+LGPLSG P+YLTGEFP Sbjct: 29 RVTMRKSAAKPKPAAASGSPW--------------YGADRVLYLGPLSGEPPSYLTGEFP 74 Query: 243 GDYGWDSAG 269 GDYGWD+AG Sbjct: 75 GDYGWDTAG 83 [31][TOP] >UniRef100_B9G329 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9G329_ORYSJ Length = 225 Score = 68.6 bits (166), Expect = 2e-10 Identities = 33/69 (47%), Positives = 39/69 (56%) Frame = +3 Query: 63 RVVRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFP 242 R+ + P+P SG W YG DR L+LGPLSG P+YLTGEFP Sbjct: 24 RITMRKTAAKPKPAASSGSPW--------------YGADRVLYLGPLSGEPPSYLTGEFP 69 Query: 243 GDYGWDSAG 269 GDYGWD+AG Sbjct: 70 GDYGWDTAG 78 [32][TOP] >UniRef100_A4QPJ3 Chloroplast light-harvesting complex II protein Lhcbm13 n=1 Tax=Acetabularia acetabulum RepID=A4QPJ3_ACEAT Length = 255 Score = 68.6 bits (166), Expect = 2e-10 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 G+ S +YGPDR +LGP SG TP+YLTGEFPGDYGWD+AG Sbjct: 30 GSAPDSVWYGPDRPQFLGPFSGDTPSYLTGEFPGDYGWDTAG 71 [33][TOP] >UniRef100_P12330 Chlorophyll a-b binding protein 1, chloroplastic n=3 Tax=Oryza sativa RepID=CB21_ORYSJ Length = 265 Score = 68.6 bits (166), Expect = 2e-10 Identities = 33/69 (47%), Positives = 39/69 (56%) Frame = +3 Query: 63 RVVRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFP 242 R+ + P+P SG W YG DR L+LGPLSG P+YLTGEFP Sbjct: 29 RITMRKTAAKPKPAASSGSPW--------------YGADRVLYLGPLSGEPPSYLTGEFP 74 Query: 243 GDYGWDSAG 269 GDYGWD+AG Sbjct: 75 GDYGWDTAG 83 [34][TOP] >UniRef100_Q4VV47 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Picea sitchensis RepID=Q4VV47_PICSI Length = 253 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = +3 Query: 114 GEGWLVESNGGNEKLSA------FYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 GE + +K+SA +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 32 GEARVTMRKSSTKKVSASASTSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [35][TOP] >UniRef100_Q40770 Light harvesting chlorophyll a /b-binding protein Lhcb1*2-1 n=1 Tax=Picea abies RepID=Q40770_PICAB Length = 274 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = +3 Query: 114 GEGWLVESNGGNEKLSA------FYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 GE + +K+SA +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 35 GEARVTMRKSSTKKVSASASPSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 92 [36][TOP] >UniRef100_O04685 Chlorophyll a/b-binding protein n=1 Tax=Mesembryanthemum crystallinum RepID=O04685_MESCR Length = 267 Score = 68.2 bits (165), Expect = 3e-10 Identities = 34/66 (51%), Positives = 43/66 (65%), Gaps = 5/66 (7%) Frame = +3 Query: 87 LPPRPRKPSGEGWL-VESNGGNEKL----SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDY 251 L P + GEG + + G K+ S +YGPDR +LGP SG +P+YLTGEFPGDY Sbjct: 20 LSPTASETLGEGRITMRKAAGKSKVATIDSPWYGPDRVKYLGPFSGESPSYLTGEFPGDY 79 Query: 252 GWDSAG 269 GWD+AG Sbjct: 80 GWDTAG 85 [37][TOP] >UniRef100_A9NK15 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NK15_PICSI Length = 274 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = +3 Query: 114 GEGWLVESNGGNEKLSA------FYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 GE + +K+SA +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 35 GEARVTMRKSSTKKVSASASTSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 92 [38][TOP] >UniRef100_A5HSG6 Chloroplast light-harvesting chlorophyll a/b-binding protein (Fragment) n=1 Tax=Artemisia annua RepID=A5HSG6_ARTAN Length = 254 Score = 68.2 bits (165), Expect = 3e-10 Identities = 33/67 (49%), Positives = 38/67 (56%) Frame = +3 Query: 69 VRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGD 248 V R+ P+ PSG W YGPDR +LGP SG P+YLTGEFPGD Sbjct: 20 VSMRKTAAPKKVAPSGSPW--------------YGPDRVKYLGPFSGEAPSYLTGEFPGD 65 Query: 249 YGWDSAG 269 YGWD+AG Sbjct: 66 YGWDTAG 72 [39][TOP] >UniRef100_P12333 Chlorophyll a-b binding protein, chloroplastic n=2 Tax=Spinacia oleracea RepID=CB2A_SPIOL Length = 267 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/56 (57%), Positives = 41/56 (73%) Frame = +3 Query: 102 RKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 RK +G+ V+S+ S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 36 RKTAGKPKTVQSS------SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85 [40][TOP] >UniRef100_Q93XK4 Chlorophyll a/b binding protein n=1 Tax=Pinus contorta RepID=Q93XK4_PINCO Length = 274 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 56 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 92 [41][TOP] >UniRef100_Q4VV62 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus echinata RepID=Q4VV62_PINEC Length = 253 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [42][TOP] >UniRef100_Q4VV61 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus ponderosa RepID=Q4VV61_PINPO Length = 256 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [43][TOP] >UniRef100_Q4VV60 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus radiata RepID=Q4VV60_PINRA Length = 256 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [44][TOP] >UniRef100_Q4VV59 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus contorta RepID=Q4VV59_PINCO Length = 256 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [45][TOP] >UniRef100_Q4VV58 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus merkusii RepID=Q4VV58_9CONI Length = 256 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [46][TOP] >UniRef100_Q4VV57 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus roxburghii RepID=Q4VV57_PINRO Length = 256 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [47][TOP] >UniRef100_Q4VV56 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus chiapensis RepID=Q4VV56_9CONI Length = 256 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [48][TOP] >UniRef100_Q4VV52 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=4 Tax=Strobus RepID=Q4VV52_PINST Length = 256 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [49][TOP] >UniRef100_Q4VV51 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus monophylla RepID=Q4VV51_9CONI Length = 256 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [50][TOP] >UniRef100_Q4VV50 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus remota RepID=Q4VV50_9CONI Length = 256 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [51][TOP] >UniRef100_Q4VV49 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus longaeva RepID=Q4VV49_PINLO Length = 253 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 50 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 86 [52][TOP] >UniRef100_Q4VV48 Chloroplast light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus nelsonii RepID=Q4VV48_9CONI Length = 256 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [53][TOP] >UniRef100_Q461R5 Chloroplast putative light harvesting chlorophyll a/b binding protein (Fragment) n=1 Tax=Pinus gerardiana RepID=Q461R5_PINGE Length = 253 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 89 [54][TOP] >UniRef100_Q41234 Chlorophyll a/b-binding protein n=1 Tax=Pinus thunbergii RepID=Q41234_PINTH Length = 274 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 56 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 92 [55][TOP] >UniRef100_Q40788 Chlorophyll a/b binding protein n=1 Tax=Pinus contorta RepID=Q40788_PINCO Length = 274 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 56 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 92 [56][TOP] >UniRef100_Q40771 Light harvesting chlorophyll a /b-binding protein Lhcb1*2-2 n=1 Tax=Picea abies RepID=Q40771_PICAB Length = 275 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 57 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 93 [57][TOP] >UniRef100_Q40769 Light harvesting chlorophyll a /b-binding protein Lhcb1*1 n=1 Tax=Picea abies RepID=Q40769_PICAB Length = 278 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [58][TOP] >UniRef100_C0PQF4 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=C0PQF4_PICSI Length = 278 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [59][TOP] >UniRef100_C0PQD7 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=C0PQD7_PICSI Length = 278 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEQPSYLTGEFPGDYGWDTAG 96 [60][TOP] >UniRef100_A9P0Q2 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9P0Q2_PICSI Length = 251 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [61][TOP] >UniRef100_A9NZL0 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NZL0_PICSI Length = 278 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [62][TOP] >UniRef100_A9NVX9 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NVX9_PICSI Length = 151 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 16 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 52 [63][TOP] >UniRef100_A9NT88 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NT88_PICSI Length = 278 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [64][TOP] >UniRef100_A9NRK2 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NRK2_PICSI Length = 278 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [65][TOP] >UniRef100_A9NR30 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NR30_PICSI Length = 110 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [66][TOP] >UniRef100_A9NPE9 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NPE9_PICSI Length = 278 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [67][TOP] >UniRef100_A9NNW9 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NNW9_PICSI Length = 278 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [68][TOP] >UniRef100_P15194 Chlorophyll a-b binding protein type 2 member 1B, chloroplastic n=1 Tax=Pinus sylvestris RepID=CB2B_PINSY Length = 274 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 56 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 92 [69][TOP] >UniRef100_P15193 Chlorophyll a-b binding protein type 2 member 1A, chloroplastic n=1 Tax=Pinus sylvestris RepID=CB2A_PINSY Length = 278 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [70][TOP] >UniRef100_B1PL34 Chloroplast chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera grandiflora RepID=B1PL34_9MYRT Length = 118 Score = 67.4 bits (163), Expect = 5e-10 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +3 Query: 102 RKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 RK +G+ S+G S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 22 RKTAGKAKPAVSSG-----SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 72 [71][TOP] >UniRef100_B1PL33 Chloroplast chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera elata subsp. hookeri RepID=B1PL33_OENEH Length = 119 Score = 67.4 bits (163), Expect = 5e-10 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +3 Query: 102 RKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 RK +G+ S+G S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 35 RKTAGKAKPAVSSG-----SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85 [72][TOP] >UniRef100_Q9XFU7 Putative uncharacterized protein (Fragment) n=1 Tax=Chlamydomonas sp. HS-5 RepID=Q9XFU7_9CHLO Length = 155 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/64 (46%), Positives = 37/64 (57%) Frame = +3 Query: 78 RRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGW 257 ++ + +P P+G W YGPDR WLGP TP+YLTGEFPGDYGW Sbjct: 47 KKTVSKKPSGPAGAEW--------------YGPDRPKWLGPFFQNTPSYLTGEFPGDYGW 92 Query: 258 DSAG 269 D+AG Sbjct: 93 DTAG 96 [73][TOP] >UniRef100_Q39768 Light-harvesting chlorophyll a/b binding protein of photosystem II n=1 Tax=Ginkgo biloba RepID=Q39768_GINBI Length = 270 Score = 67.0 bits (162), Expect = 6e-10 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 5/57 (8%) Frame = +3 Query: 114 GEGWLVESNGGNEKL-----SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 GEG + ++K+ S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 32 GEGRITMRKTASKKVVASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 88 [74][TOP] >UniRef100_Q1EPK5 Chlorophyll A-B binding protein (CAB), putative n=1 Tax=Musa acuminata RepID=Q1EPK5_MUSAC Length = 265 Score = 67.0 bits (162), Expect = 6e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAG 83 [75][TOP] >UniRef100_O04686 Chlorophyll a/b-binding protein n=1 Tax=Mesembryanthemum crystallinum RepID=O04686_MESCR Length = 267 Score = 67.0 bits (162), Expect = 6e-10 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = +3 Query: 102 RKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 RK +G+ V S+ S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 36 RKTAGKTKSVSSD------SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85 [76][TOP] >UniRef100_B6T2Y9 Chlorophyll a-b binding protein 2 n=1 Tax=Zea mays RepID=B6T2Y9_MAIZE Length = 264 Score = 67.0 bits (162), Expect = 6e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YG DR L+LGPLSG+ P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTAG 82 [77][TOP] >UniRef100_A3FPF0 Chlorophyll a/b-binding protein n=1 Tax=Nelumbo nucifera RepID=A3FPF0_NELNU Length = 269 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 165 FYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 +YGPDR ++GP SG TP+YLTGEFPGDYGWDSAG Sbjct: 52 WYGPDRVKYMGPFSGQTPSYLTGEFPGDYGWDSAG 86 [78][TOP] >UniRef100_P24006 Chlorophyll a-b binding protein 1A, chloroplastic n=1 Tax=Pyrus pyrifolia RepID=CB2A_PYRPY Length = 278 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR ++LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 60 SPWYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAG 96 [79][TOP] >UniRef100_Q9LE97 Chloroplast light-harvesting complex II protein Lhcbm3 n=1 Tax=Bigelowiella natans RepID=Q9LE97_BIGNA Length = 333 Score = 66.6 bits (161), Expect = 8e-10 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 G +YGPDR LWLGP S G+ P+YLTGEFPGDYGWD+ G Sbjct: 108 GGAACQEWYGPDRALWLGPFSEGSVPSYLTGEFPGDYGWDTQG 150 [80][TOP] >UniRef100_Q9LE96 Chloroplast light-harvesting complex II protein Lhcbm7 n=1 Tax=Bigelowiella natans RepID=Q9LE96_BIGNA Length = 346 Score = 66.6 bits (161), Expect = 8e-10 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 G +YGPDR LWLGP S G+ P+YLTGEFPGDYGWD+ G Sbjct: 121 GGAACQEWYGPDRALWLGPFSEGSVPSYLTGEFPGDYGWDTQG 163 [81][TOP] >UniRef100_O64448 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64448_NICSY Length = 267 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGNSPSYLTGEFPGDYGWDTAG 85 [82][TOP] >UniRef100_A3F6K2 Chloroplast chlorophyll a/b binding protein n=1 Tax=Pisum sativum RepID=A3F6K2_PEA Length = 266 Score = 66.6 bits (161), Expect = 8e-10 Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 4/65 (6%) Frame = +3 Query: 87 LPPRPRKPSGEGWLVESNGGNEKL----SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYG 254 L P ++ G + + + +K+ S +YGPDR +LGP SG +P+YLTGEFPGDYG Sbjct: 20 LNPSSQELGGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYG 79 Query: 255 WDSAG 269 WD+AG Sbjct: 80 WDTAG 84 [83][TOP] >UniRef100_UPI00019839E5 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019839E5 Length = 558 Score = 66.2 bits (160), Expect = 1e-09 Identities = 31/55 (56%), Positives = 34/55 (61%) Frame = +3 Query: 105 KPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 KPSG W YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 336 KPSGSPW--------------YGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 376 [84][TOP] >UniRef100_Q9ZSV2 Chlorophyll a/b binding protein n=1 Tax=Acetabularia acetabulum RepID=Q9ZSV2_ACEAT Length = 251 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 6/48 (12%) Frame = +3 Query: 144 GNEKLSA-----FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 GN+++S +YGPDR WLGP S G P+YLTGEFPGDYGWD+AG Sbjct: 21 GNKRVSVQAAVEWYGPDRAKWLGPYSDGAVPSYLTGEFPGDYGWDTAG 68 [85][TOP] >UniRef100_Q9LE98 Chloroplast light-harvesting complex II protein Lhcbm2 n=1 Tax=Bigelowiella natans RepID=Q9LE98_BIGNA Length = 345 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 G +YGPDR LWLGP S G P+YLTGEFPGDYGWD+ G Sbjct: 120 GGAACQEWYGPDRALWLGPFSEGAVPSYLTGEFPGDYGWDTQG 162 [86][TOP] >UniRef100_Q84U94 Chlorophyll a/b-binding protein (Fragment) n=1 Tax=Citrus limon RepID=Q84U94_CITLI Length = 216 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/64 (50%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = +3 Query: 87 LPPRPRKPSGEGWLVESNGGNEKLSA---FYGPDRGLWLGPLSGTTPAYLTGEFPGDYGW 257 L P + S G + G++ +S+ +YGPDR +LGP SG P+YLTGEFPGDYGW Sbjct: 19 LAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGW 78 Query: 258 DSAG 269 D+AG Sbjct: 79 DTAG 82 [87][TOP] >UniRef100_Q7XYQ7 Chlorophyll a/b-binding protein II 1 n=1 Tax=Bigelowiella natans RepID=Q7XYQ7_BIGNA Length = 346 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 G +YGPDR LWLGP S G P+YLTGEFPGDYGWD+ G Sbjct: 121 GGAACQEWYGPDRALWLGPFSEGAVPSYLTGEFPGDYGWDTQG 163 [88][TOP] >UniRef100_Q5ZF93 Light harvesting protein 1 (Fragment) n=1 Tax=Plantago major RepID=Q5ZF93_PLAMJ Length = 229 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 11 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 47 [89][TOP] >UniRef100_Q41426 Chlorophyll a/b binding protein (Fragment) n=1 Tax=Solanum tuberosum RepID=Q41426_SOLTU Length = 135 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83 [90][TOP] >UniRef100_Q41425 Chlorophyll a/b binding protein n=1 Tax=Solanum tuberosum RepID=Q41425_SOLTU Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83 [91][TOP] >UniRef100_Q41424 Chlorophyll a/b binding protein n=1 Tax=Solanum tuberosum RepID=Q41424_SOLTU Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83 [92][TOP] >UniRef100_Q41423 Chlorophyll a/b binding protein n=1 Tax=Solanum tuberosum RepID=Q41423_SOLTU Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83 [93][TOP] >UniRef100_Q41422 Chlorophyll a/b binding protein n=1 Tax=Solanum tuberosum RepID=Q41422_SOLTU Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83 [94][TOP] >UniRef100_Q41421 Chlorophyll a/b binding protein n=1 Tax=Solanum tuberosum RepID=Q41421_SOLTU Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83 [95][TOP] >UniRef100_O64450 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64450_NICSY Length = 267 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85 [96][TOP] >UniRef100_O64447 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64447_NICSY Length = 266 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 48 SLWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 84 [97][TOP] >UniRef100_O64446 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64446_NICSY Length = 267 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85 [98][TOP] >UniRef100_O64444 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64444_NICSY Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83 [99][TOP] >UniRef100_O64443 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64443_NICSY Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83 [100][TOP] >UniRef100_O24401 Chlorophyll a/b-binding protein WCAB n=1 Tax=Triticum aestivum RepID=O24401_WHEAT Length = 266 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YG DR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 84 [101][TOP] >UniRef100_O04687 Chlorophyll a/b-binding protein n=1 Tax=Mesembryanthemum crystallinum RepID=O04687_MESCR Length = 267 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +3 Query: 102 RKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 RK +G+ V S+ S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 36 RKTAGKTKNVSSD------SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85 [102][TOP] >UniRef100_C0PQV4 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=C0PQV4_PICSI Length = 274 Score = 66.2 bits (160), Expect = 1e-09 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = +3 Query: 114 GEGWLVESNGGNEKLSA------FYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 GE + +K+SA +YGPDR L+LGP SG P++LTGEFPGDYGWD+AG Sbjct: 35 GEARVTMRKSSTKKVSASASTSPWYGPDRVLYLGPFSGEPPSHLTGEFPGDYGWDTAG 92 [103][TOP] >UniRef100_B8XLF1 Putative chloroplast chlorophyll a/b binding protein (Fragment) n=1 Tax=Solanum nigrum RepID=B8XLF1_SOLNI Length = 249 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 31 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 67 [104][TOP] >UniRef100_B6SZ08 Chlorophyll a-b binding protein 2 n=1 Tax=Zea mays RepID=B6SZ08_MAIZE Length = 241 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YG DR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGADRVLYLGPLSGQPPSYLTGEFPGDYGWDTAG 82 [105][TOP] >UniRef100_B5A4I4 Light harvesting complex protein LHCII-1 n=1 Tax=Gymnochlora stellata RepID=B5A4I4_GYMST Length = 335 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 G +YGPDR LWLGP S G P+YLTGEFPGDYGWD+ G Sbjct: 105 GGAACQEWYGPDRALWLGPFSEGAVPSYLTGEFPGDYGWDTQG 147 [106][TOP] >UniRef100_B4G143 Chlorophyll a-b binding protein 2 n=1 Tax=Zea mays RepID=B4G143_MAIZE Length = 264 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YG DR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGADRVLYLGPLSGQPPSYLTGEFPGDYGWDTAG 82 [107][TOP] >UniRef100_B1PL28 Chloroplast chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera grandiflora RepID=B1PL28_9MYRT Length = 109 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 89 [108][TOP] >UniRef100_B1PL27 Chloroplast chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera elata subsp. hookeri RepID=B1PL27_OENEH Length = 94 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 53 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 89 [109][TOP] >UniRef100_B0L805 Chloroplast chlorophyll a/b binding protein n=1 Tax=Phyllostachys edulis RepID=B0L805_9POAL Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEF GDYGWD+AG Sbjct: 47 SPWYGPDRVLYLGPLSGEPPSYLTGEFAGDYGWDTAG 83 [110][TOP] >UniRef100_A8QJP9 Chloroplast light-harvesting chlorophyll a/b binding protein n=1 Tax=Bambusa oldhamii RepID=A8QJP9_BAMOL Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR L+LGPLSG P+YLTGEF GDYGWD+AG Sbjct: 47 SPWYGPDRVLYLGPLSGEPPSYLTGEFAGDYGWDTAG 83 [111][TOP] >UniRef100_A7Q0V3 Chromosome chr7 scaffold_42, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7Q0V3_VITVI Length = 263 Score = 66.2 bits (160), Expect = 1e-09 Identities = 31/55 (56%), Positives = 34/55 (61%) Frame = +3 Query: 105 KPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 KPSG W YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 41 KPSGSPW--------------YGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 81 [112][TOP] >UniRef100_A4QPL1 Chloroplast light-harvesting complex II protein Lhcbm2 (Fragment) n=1 Tax=Acetabularia acetabulum RepID=A4QPL1_ACEAT Length = 248 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 6/48 (12%) Frame = +3 Query: 144 GNEKLSA-----FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 GN+++S +YGPDR WLGP S G P+YLTGEFPGDYGWD+AG Sbjct: 18 GNKRVSVQAAVEWYGPDRAKWLGPYSDGAVPSYLTGEFPGDYGWDTAG 65 [113][TOP] >UniRef100_P07369 Chlorophyll a-b binding protein 3C, chloroplastic n=1 Tax=Solanum lycopersicum RepID=CB2G_SOLLC Length = 267 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85 [114][TOP] >UniRef100_P07370 Chlorophyll a-b binding protein 1B, chloroplastic n=1 Tax=Solanum lycopersicum RepID=CB2B_SOLLC Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83 [115][TOP] >UniRef100_P27490 Chlorophyll a-b binding protein 8, chloroplastic n=1 Tax=Pisum sativum RepID=CB28_PEA Length = 268 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 50 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 86 [116][TOP] >UniRef100_P27496 Chlorophyll a-b binding protein 50, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB25_TOBAC Length = 267 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85 [117][TOP] >UniRef100_P12470 Chlorophyll a-b binding protein E, chloroplastic n=1 Tax=Nicotiana plumbaginifolia RepID=CB25_NICPL Length = 266 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 84 [118][TOP] >UniRef100_P27495 Chlorophyll a-b binding protein 40, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB24_TOBAC Length = 267 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85 [119][TOP] >UniRef100_P15195 Chlorophyll a-b binding protein type 1 member F3, chloroplastic n=1 Tax=Polystichum munitum RepID=CB23_POLMU Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/61 (49%), Positives = 38/61 (62%) Frame = +3 Query: 87 LPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSA 266 + P+ + PSG W YG DR L+LGP SG+ P+YL+GEFPGDYGWD+A Sbjct: 37 MAPKSKAPSGSIW--------------YGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTA 82 Query: 267 G 269 G Sbjct: 83 G 83 [120][TOP] >UniRef100_P27493 Chlorophyll a-b binding protein 21, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB22_TOBAC Length = 265 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83 [121][TOP] >UniRef100_P07371 Chlorophyll a-b binding protein AB80, chloroplastic n=1 Tax=Pisum sativum RepID=CB22_PEA Length = 269 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 51 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 87 [122][TOP] >UniRef100_P12331 Chlorophyll a-b binding protein 2, chloroplastic n=3 Tax=Oryza sativa RepID=CB22_ORYSJ Length = 261 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YG DR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 43 SPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 79 [123][TOP] >UniRef100_P08963 Chlorophyll a-b binding protein 2, chloroplastic n=1 Tax=Hordeum vulgare RepID=CB22_HORVU Length = 264 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 82 [124][TOP] >UniRef100_P04784 Chlorophyll a-b binding protein, chloroplastic n=1 Tax=Triticum aestivum RepID=CB21_WHEAT Length = 266 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YG DR L+LGPLSG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 84 [125][TOP] >UniRef100_P27492 Chlorophyll a-b binding protein 16, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB21_TOBAC Length = 266 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 84 [126][TOP] >UniRef100_A7P1F1 Chromosome chr19 scaffold_4, whole genome shotgun sequence n=2 Tax=Vitis vinifera RepID=A7P1F1_VITVI Length = 264 Score = 65.9 bits (159), Expect = 1e-09 Identities = 34/60 (56%), Positives = 39/60 (65%) Frame = +3 Query: 90 PPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 P R P G G + GNE +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 27 PLRDVVPMGTG---KYTMGNE---LWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAG 80 [127][TOP] >UniRef100_Q9ZSJ5 Light harvesting complex II protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q9ZSJ5_CHLRE Length = 254 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +3 Query: 165 FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 FYGP+R WLGP S +TPAYLTGEFPGDYGWD+AG Sbjct: 37 FYGPNRAKWLGPYSENSTPAYLTGEFPGDYGWDTAG 72 [128][TOP] >UniRef100_Q9LKI0 LHCII type I chlorophyll a/b-binding protein n=1 Tax=Vigna radiata var. radiata RepID=Q9LKI0_PHAAU Length = 264 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 82 [129][TOP] >UniRef100_Q9LKH9 LHCII type I chlorophyll a/b-binding protein n=1 Tax=Vigna radiata var. radiata RepID=Q9LKH9_PHAAU Length = 264 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 82 [130][TOP] >UniRef100_Q8S3T9 Chlorophyll a-b binding protein of LHCII n=1 Tax=Chlamydomonas reinhardtii RepID=Q8S3T9_CHLRE Length = 254 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +3 Query: 165 FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 FYGP+R WLGP S +TPAYLTGEFPGDYGWD+AG Sbjct: 37 FYGPNRAKWLGPYSENSTPAYLTGEFPGDYGWDTAG 72 [131][TOP] >UniRef100_Q677H3 Chloroplast chlorophyll A-B binding protein (Fragment) n=1 Tax=Hyacinthus orientalis RepID=Q677H3_HYAOR Length = 239 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 5/66 (7%) Frame = +3 Query: 87 LPPRPRKPSGEG-WLVESNGGNEKL----SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDY 251 L P SG+G + + G K S +YGP+R +LGP SG P+YLTGEFPGDY Sbjct: 31 LTPSSSVVSGDGRFTMRKTAGKPKTVSSGSPWYGPERVKYLGPFSGEAPSYLTGEFPGDY 90 Query: 252 GWDSAG 269 GWD+AG Sbjct: 91 GWDTAG 96 [132][TOP] >UniRef100_Q677F6 Chloroplast chlorophyll A-B binding protein 40 (Fragment) n=1 Tax=Hyacinthus orientalis RepID=Q677F6_HYAOR Length = 237 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 34 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 70 [133][TOP] >UniRef100_Q677D0 Chloroplast chlorophyll A-B binding protein 40 n=1 Tax=Hyacinthus orientalis RepID=Q677D0_HYAOR Length = 211 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85 [134][TOP] >UniRef100_Q40961 Light-harvesting chlorophyll a/b-binding protein n=1 Tax=Prunus persica RepID=Q40961_PRUPE Length = 267 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85 [135][TOP] >UniRef100_Q40247 Light-harvesting chlorophyll a/b-binding protein (LHCP) n=1 Tax=Lactuca sativa RepID=Q40247_LACSA Length = 266 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 84 [136][TOP] >UniRef100_Q2XTE0 Chlorophyll a-b binding protein 3C-like n=1 Tax=Solanum tuberosum RepID=Q2XTE0_SOLTU Length = 267 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85 [137][TOP] >UniRef100_O64449 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64449_NICSY Length = 267 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85 [138][TOP] >UniRef100_O64445 Light harvesting chlorophyll a/b-binding protein n=1 Tax=Nicotiana sylvestris RepID=O64445_NICSY Length = 265 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 83 [139][TOP] >UniRef100_O24226 Chlorophyll a/b binding protein n=1 Tax=Oryza sativa RepID=O24226_ORYSA Length = 265 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/69 (47%), Positives = 38/69 (55%) Frame = +3 Query: 63 RVVRPRRPLPPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFP 242 RV + P+P SG W YG DR L+LGPLSG P+YLTGEF Sbjct: 29 RVTMRKSAAKPKPAAASGSPW--------------YGADRVLYLGPLSGEPPSYLTGEFS 74 Query: 243 GDYGWDSAG 269 GDYGWD+AG Sbjct: 75 GDYGWDTAG 83 [140][TOP] >UniRef100_O22669 Chlorophyll a/b binding protein of LHCII type I n=1 Tax=Panax ginseng RepID=O22669_PANGI Length = 266 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 84 [141][TOP] >UniRef100_B1PL36 Chloroplast photosystem II type I chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera grandiflora RepID=B1PL36_9MYRT Length = 103 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 84 [142][TOP] >UniRef100_B1PL35 Chloroplast photosystem II type I chlorophyll A/B-binding protein (Fragment) n=1 Tax=Oenothera elata subsp. hookeri RepID=B1PL35_OENEH Length = 103 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 84 [143][TOP] >UniRef100_A8J270 Chlorophyll a-b binding protein of LHCII n=1 Tax=Chlamydomonas reinhardtii RepID=A8J270_CHLRE Length = 254 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +3 Query: 165 FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 FYGP+R WLGP S +TPAYLTGEFPGDYGWD+AG Sbjct: 37 FYGPNRAKWLGPYSENSTPAYLTGEFPGDYGWDTAG 72 [144][TOP] >UniRef100_A8J264 Chloropyll a-b binding protein of LHCII n=1 Tax=Chlamydomonas reinhardtii RepID=A8J264_CHLRE Length = 254 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +3 Query: 165 FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 FYGP+R WLGP S +TPAYLTGEFPGDYGWD+AG Sbjct: 37 FYGPNRAKWLGPYSENSTPAYLTGEFPGDYGWDTAG 72 [145][TOP] >UniRef100_A4QPK2 Chloroplast light-harvesting complex II protein Lhcbm12 n=1 Tax=Acetabularia acetabulum RepID=A4QPK2_ACEAT Length = 255 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 35 SVWYGPDRPQFLGPFSGDCPSYLTGEFPGDYGWDTAG 71 [146][TOP] >UniRef100_A4F3R4 Major chlorophyll a/b binding protein LHCb1.1 n=1 Tax=Spinacia oleracea RepID=A4F3R4_SPIOL Length = 267 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85 [147][TOP] >UniRef100_A4F3R3 Major chlorophyll a/b binding protein LHCb1.2 n=1 Tax=Spinacia oleracea RepID=A4F3R3_SPIOL Length = 267 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85 [148][TOP] >UniRef100_A2SY47 Light-harvesting chlorophyll-a/b binding protein LhcbM8 (Fragment) n=1 Tax=Chlamydomonas incerta RepID=A2SY47_CHLIN Length = 245 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +3 Query: 165 FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 FYGP+R WLGP S +TPAYLTGEFPGDYGWD+AG Sbjct: 28 FYGPNRAKWLGPYSENSTPAYLTGEFPGDYGWDTAG 63 [149][TOP] >UniRef100_P27491 Chlorophyll a-b binding protein 7, chloroplastic n=1 Tax=Nicotiana tabacum RepID=CB27_TOBAC Length = 267 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85 [150][TOP] >UniRef100_P04782 Chlorophyll a-b binding protein 25, chloroplastic n=1 Tax=Petunia sp. RepID=CB24_PETSP Length = 266 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 84 [151][TOP] >UniRef100_P92919 Chlorophyll a-b binding protein, chloroplastic n=1 Tax=Apium graveolens RepID=CB23_APIGR Length = 264 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 82 [152][TOP] >UniRef100_P04780 Chlorophyll a-b binding protein 22L, chloroplastic n=1 Tax=Petunia sp. RepID=CB22_PETSP Length = 267 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85 [153][TOP] >UniRef100_P04779 Chlorophyll a-b binding protein 13, chloroplastic n=1 Tax=Petunia sp. RepID=CB21_PETSP Length = 266 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 84 [154][TOP] >UniRef100_Q9ZP08 Chlorophyll a/b binding protein n=1 Tax=Cicer arietinum RepID=Q9ZP08_CICAR Length = 266 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 84 [155][TOP] >UniRef100_Q9XQB3 LHCII type I chlorophyll a/b binding protein n=1 Tax=Vigna radiata var. radiata RepID=Q9XQB3_PHAAU Length = 263 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 45 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 81 [156][TOP] >UniRef100_Q9XF73 Putative chlorophyll a/b-binding protein n=1 Tax=Phalaenopsis hybrid cultivar RepID=Q9XF73_9ASPA Length = 277 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 59 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 95 [157][TOP] >UniRef100_Q9M600 Chlorophyll a/b binding protein n=1 Tax=Euphorbia esula RepID=Q9M600_EUPES Length = 268 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 50 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 86 [158][TOP] >UniRef100_Q9C8S5 Chlorophyll A-B-binding protein 2, 5' partial; 1-750 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q9C8S5_ARATH Length = 249 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/58 (51%), Positives = 36/58 (62%) Frame = +3 Query: 96 RPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 +P+ PSG W YG DR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 23 KPKGPSGSPW--------------YGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 66 [159][TOP] >UniRef100_Q93WL4 Light-harvesting chlorophyll-a/b binding protein LhcII-1.3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q93WL4_CHLRE Length = 257 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/36 (77%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 165 FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 FYGP+R WLGP S TPAYLTGEFPGDYGWD+AG Sbjct: 40 FYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAG 75 [160][TOP] >UniRef100_Q8VZ87 Chlorophyll a/b-binding protein n=1 Tax=Arabidopsis thaliana RepID=Q8VZ87_ARATH Length = 267 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/58 (51%), Positives = 36/58 (62%) Frame = +3 Query: 96 RPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 +P+ PSG W YG DR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 41 KPKGPSGSPW--------------YGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 84 [161][TOP] >UniRef100_Q6T705 Chlorophyll a/b binding protein n=1 Tax=Trifolium pratense RepID=Q6T705_TRIPR Length = 266 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 84 [162][TOP] >UniRef100_Q43437 Photosystem II type I chlorophyll a/b-binding protein n=1 Tax=Glycine max RepID=Q43437_SOYBN Length = 264 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 82 [163][TOP] >UniRef100_Q3SA42 Putative chlorophyll a/b-binding protein (Fragment) n=1 Tax=Fagus sylvatica RepID=Q3SA42_FAGSY Length = 260 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 43 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 79 [164][TOP] >UniRef100_Q39831 Chlorophyll a/b-binding protein n=1 Tax=Glycine max RepID=Q39831_SOYBN Length = 263 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 45 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 81 [165][TOP] >UniRef100_Q1WLW0 Chloroplast light-harvesting chlorophyll-a/b binding protein n=1 Tax=Chlamydomonas incerta RepID=Q1WLW0_CHLIN Length = 257 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/36 (77%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 165 FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 FYGP+R WLGP S TPAYLTGEFPGDYGWD+AG Sbjct: 40 FYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAG 75 [166][TOP] >UniRef100_Q1KLZ3 Putative chloroplast chlorophyll a/b-binding protein n=1 Tax=Carya cathayensis RepID=Q1KLZ3_9ROSI Length = 267 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 85 [167][TOP] >UniRef100_Q1EP45 Chlorophyll A-B binding protein (CAB), putative n=1 Tax=Musa balbisiana RepID=Q1EP45_MUSBA Length = 267 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 85 [168][TOP] >UniRef100_Q1A179 Chloroplast chlorophyll a/b binding protein n=1 Tax=Pachysandra terminalis RepID=Q1A179_9MAGN Length = 267 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 85 [169][TOP] >UniRef100_O81391 Chlorophyll a/b binding protein n=1 Tax=Medicago sativa RepID=O81391_MEDSA Length = 266 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 84 [170][TOP] >UniRef100_O48657 Chlorophyll a/b-binding protein n=1 Tax=Fagus crenata RepID=O48657_FAGCR Length = 264 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 82 [171][TOP] >UniRef100_C8XPS1 Chloroplast light harvesting chlorophyll a/b binding protein n=1 Tax=Populus euphratica RepID=C8XPS1_POPEU Length = 263 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 45 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 81 [172][TOP] >UniRef100_C6TNE6 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TNE6_SOYBN Length = 263 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 45 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 81 [173][TOP] >UniRef100_C6TLM4 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TLM4_SOYBN Length = 263 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 45 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 81 [174][TOP] >UniRef100_C5X7M3 Putative uncharacterized protein Sb02g032040 n=1 Tax=Sorghum bicolor RepID=C5X7M3_SORBI Length = 262 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 44 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 80 [175][TOP] >UniRef100_C4TNZ9 Chlorophyll a/b binding protein n=1 Tax=Vicia cinerea RepID=C4TNZ9_9FABA Length = 266 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 84 [176][TOP] >UniRef100_C0PAQ4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PAQ4_MAIZE Length = 233 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 15 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 51 [177][TOP] >UniRef100_C0L2S1 Chlorophyll A/B binding protein n=1 Tax=Gardenia jasminoides RepID=C0L2S1_9GENT Length = 264 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 82 [178][TOP] >UniRef100_B9SF47 Chlorophyll A/B binding protein, putative n=1 Tax=Ricinus communis RepID=B9SF47_RICCO Length = 265 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 83 [179][TOP] >UniRef100_B9S155 Chlorophyll A/B binding protein, putative n=1 Tax=Ricinus communis RepID=B9S155_RICCO Length = 265 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 83 [180][TOP] >UniRef100_B9RN67 Chlorophyll A/B binding protein, putative n=1 Tax=Ricinus communis RepID=B9RN67_RICCO Length = 267 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 85 [181][TOP] >UniRef100_B9I107 Light-harvesting complex II protein Lhcb1 n=1 Tax=Populus trichocarpa RepID=B9I107_POPTR Length = 264 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 82 [182][TOP] >UniRef100_B9GSZ2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GSZ2_POPTR Length = 266 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 84 [183][TOP] >UniRef100_B6STN4 Chlorophyll a-b binding protein 2 n=1 Tax=Zea mays RepID=B6STN4_MAIZE Length = 262 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 44 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 80 [184][TOP] >UniRef100_B3G0G4 Chloroplast chlorophyll a/b-binding protein n=1 Tax=Ophiopogon japonicus RepID=B3G0G4_9ASPA Length = 264 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 82 [185][TOP] >UniRef100_A9PHD4 Light-harvesting complex II protein Lhcb1 n=2 Tax=Populus RepID=A9PHD4_POPTR Length = 264 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 82 [186][TOP] >UniRef100_A9PEI5 Light-harvesting complex II protein Lhcb1 n=1 Tax=Populus trichocarpa RepID=A9PEI5_POPTR Length = 264 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 46 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 82 [187][TOP] >UniRef100_A8J287 Chloropyll a-b binding protein of LHCII type I, chloroplast n=1 Tax=Chlamydomonas reinhardtii RepID=A8J287_CHLRE Length = 253 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/36 (77%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 165 FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 FYGP+R WLGP S TPAYLTGEFPGDYGWD+AG Sbjct: 36 FYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAG 71 [188][TOP] >UniRef100_A7PJV3 Chromosome chr12 scaffold_18, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PJV3_VITVI Length = 254 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 49 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 85 [189][TOP] >UniRef100_A5BPB2 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BPB2_VITVI Length = 270 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 52 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 88 [190][TOP] >UniRef100_A4QPK6 Chloroplast light-harvesting complex II protein Lhcbm3 (Fragment) n=1 Tax=Acetabularia acetabulum RepID=A4QPK6_ACEAT Length = 208 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/48 (60%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +3 Query: 129 VESNGGNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 V N G + +YGP+R WLGP S G P+YLTGEFPGDYGWD+AG Sbjct: 19 VARNVGAKAADEWYGPNRAKWLGPYSDGAVPSYLTGEFPGDYGWDTAG 66 [191][TOP] >UniRef100_A2SY48 Light-harvesting chlorophyll-a/b binding protein LhcbM9 n=1 Tax=Chlamydomonas incerta RepID=A2SY48_CHLIN Length = 254 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/36 (77%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 165 FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 FYGP+R WLGP S TPAYLTGEFPGDYGWD+AG Sbjct: 37 FYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAG 72 [192][TOP] >UniRef100_A2SY35 Light-harvesting chlorophyll-a/b binding protein LhcbM4 n=1 Tax=Scenedesmus obliquus RepID=A2SY35_SCEOB Length = 255 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +3 Query: 153 KLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 K + FYGP+R WLGP S TP YLTGEF GDYGWD+AG Sbjct: 35 KGTEFYGPNRAKWLGPFSTATPGYLTGEFAGDYGWDTAG 73 [193][TOP] >UniRef100_P14273 Chlorophyll a-b binding protein of LHCII type I, chloroplastic n=2 Tax=Chlamydomonas reinhardtii RepID=CB2_CHLRE Length = 253 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/36 (77%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 165 FYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAG 269 FYGP+R WLGP S TPAYLTGEFPGDYGWD+AG Sbjct: 36 FYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAG 71 [194][TOP] >UniRef100_P09756 Chlorophyll a-b binding protein 3, chloroplastic n=1 Tax=Glycine max RepID=CB23_SOYBN Length = 263 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 45 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 81 [195][TOP] >UniRef100_P04778 Chlorophyll a-b binding protein 2, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=CB22_ARATH Length = 267 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/58 (51%), Positives = 36/58 (62%) Frame = +3 Query: 96 RPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 +P+ PSG W YG DR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 41 KPKGPSGSPW--------------YGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 84 [196][TOP] >UniRef100_P12471 Chlorophyll a-b binding protein, chloroplastic (Fragment) n=1 Tax=Glycine max RepID=CB21_SOYBN Length = 245 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 27 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 63 [197][TOP] >UniRef100_P12329 Chlorophyll a-b binding protein 1, chloroplastic n=2 Tax=Zea mays RepID=CB21_MAIZE Length = 262 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 44 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 80 [198][TOP] >UniRef100_P08221 Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) n=1 Tax=Cucumis sativus RepID=CB21_CUCSA Length = 255 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 37 SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 73 [199][TOP] >UniRef100_P04777 Chlorophyll a-b binding protein 165/180, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=CB21_ARATH Length = 267 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/58 (51%), Positives = 36/58 (62%) Frame = +3 Query: 96 RPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 +P+ PSG W YG DR +LGP SG +P+YLTGEFPGDYGWD+AG Sbjct: 41 KPKGPSGSPW--------------YGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 84 [200][TOP] >UniRef100_A7QYH5 Chromosome undetermined scaffold_247, whole genome shotgun sequence n=2 Tax=Vitis vinifera RepID=A7QYH5_VITVI Length = 264 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 GNE +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 42 GNE---LWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAG 80 [201][TOP] >UniRef100_Q9SWE9 Chlorophyll a/b binding protein n=1 Tax=Rumex palustris RepID=Q9SWE9_9CARY Length = 264 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 46 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 82 [202][TOP] >UniRef100_Q9LKZ0 Chlorophyll a/b-binding protein n=1 Tax=Picea glauca RepID=Q9LKZ0_PICGL Length = 151 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 84 [203][TOP] >UniRef100_Q5PYQ1 Chloroplast chlorophyll A/B binding protein (Fragment) n=1 Tax=Manihot esculenta RepID=Q5PYQ1_MANES Length = 243 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 25 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 61 [204][TOP] >UniRef100_Q40956 Type 2 light-harvesting chlorophyll a/b-binding polypeptide (Fragment) n=1 Tax=Pinus palustris RepID=Q40956_PINPA Length = 246 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 28 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 64 [205][TOP] >UniRef100_Q40934 Light-harvesting chlorophyll a/b binding protein of photosystem II (Fragment) n=1 Tax=Pseudotsuga menziesii RepID=Q40934_PSEMZ Length = 234 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 16 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 52 [206][TOP] >UniRef100_Q3LFQ5 Chlorophyll a/b binding protein n=1 Tax=Panax ginseng RepID=Q3LFQ5_PANGI Length = 265 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 47 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 83 [207][TOP] >UniRef100_Q39631 A/b binding protein n=1 Tax=Pyrobotrys stellata RepID=Q39631_PYRST Length = 254 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S FYGP+R L+LG LSG PAYL GEFPGDYGWD+AG Sbjct: 38 SPFYGPNRPLFLGGLSGEPPAYLNGEFPGDYGWDTAG 74 [208][TOP] >UniRef100_Q38713 Chlorophyll a/b binding protein n=1 Tax=Amaranthus hypochondriacus RepID=Q38713_AMAHP Length = 264 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 46 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 82 [209][TOP] >UniRef100_Q1EP00 Chlorophyll A-B binding protein (CAB), putative n=1 Tax=Musa acuminata RepID=Q1EP00_MUSAC Length = 264 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 46 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 82 [210][TOP] >UniRef100_Q19UF9 Chloroplast chlorophyll a/b binding protein n=1 Tax=Pachysandra terminalis RepID=Q19UF9_9MAGN Length = 264 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 46 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 82 [211][TOP] >UniRef100_Q10HC9 Chlorophyll a-b binding protein, chloroplast, putative, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q10HC9_ORYSJ Length = 118 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 45 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 81 [212][TOP] >UniRef100_O82425 Light harvesting chlorophyll A/B binding protein n=1 Tax=Prunus persica RepID=O82425_PRUPE Length = 265 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 47 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 83 [213][TOP] >UniRef100_O49812 Chlorophyll a/b-binding protein n=1 Tax=Beta vulgaris subsp. vulgaris RepID=O49812_BETVU Length = 264 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 46 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 82 [214][TOP] >UniRef100_D0F1Q5 Chlorophyll A/B binding protein n=1 Tax=Jatropha curcas RepID=D0F1Q5_9ROSI Length = 261 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 47 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 83 [215][TOP] >UniRef100_C5WTC1 Putative uncharacterized protein Sb01g015400 n=1 Tax=Sorghum bicolor RepID=C5WTC1_SORBI Length = 262 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 44 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 80 [216][TOP] >UniRef100_C1K5B9 Chlorophyll a-b binding protein n=1 Tax=Triticum aestivum RepID=C1K5B9_WHEAT Length = 263 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 45 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 81 [217][TOP] >UniRef100_C1K5B7 Chlorophyll a-b binding protein n=1 Tax=Triticum aestivum RepID=C1K5B7_WHEAT Length = 215 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 45 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 81 [218][TOP] >UniRef100_C1K5B6 Chlorophyll a-b binding protein n=1 Tax=Triticum aestivum RepID=C1K5B6_WHEAT Length = 196 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 45 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 81 [219][TOP] >UniRef100_B9T0C1 Chlorophyll A/B binding protein, putative n=1 Tax=Ricinus communis RepID=B9T0C1_RICCO Length = 265 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 47 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 83 [220][TOP] >UniRef100_B9N576 Light-harvesting complex II protein Lhcb3 n=1 Tax=Populus trichocarpa RepID=B9N576_POPTR Length = 263 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/60 (53%), Positives = 37/60 (61%) Frame = +3 Query: 90 PPRPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 P R G G + SN +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 26 PLRDVVSMGNGKYIMSN------ELWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAG 79 [221][TOP] >UniRef100_B9IAR5 Light-harvesting complex II protein Lhcb2 n=1 Tax=Populus trichocarpa RepID=B9IAR5_POPTR Length = 265 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 47 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 83 [222][TOP] >UniRef100_B9I013 Light-harvesting complex II protein Lhcb3 n=1 Tax=Populus trichocarpa RepID=B9I013_POPTR Length = 263 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 GNE +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 41 GNE---LWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAG 79 [223][TOP] >UniRef100_B8LPT5 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=B8LPT5_PICSI Length = 266 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 84 [224][TOP] >UniRef100_B6T1H1 Chlorophyll a-b binding protein n=1 Tax=Zea mays RepID=B6T1H1_MAIZE Length = 260 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 42 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 78 [225][TOP] >UniRef100_B6SZT9 Chlorophyll a-b binding protein n=1 Tax=Zea mays RepID=B6SZT9_MAIZE Length = 260 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 42 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 78 [226][TOP] >UniRef100_B6RAX2 Light-harvesting chlorophyll a/b binding protein n=1 Tax=Bambusa oldhamii RepID=B6RAX2_BAMOL Length = 263 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 45 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 81 [227][TOP] >UniRef100_B1P0S0 Chloroplast chlorophyll-a/b binding protein n=1 Tax=Medicago sativa subsp. falcata RepID=B1P0S0_MEDFA Length = 266 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 GNE +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 44 GNE---LWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAG 82 [228][TOP] >UniRef100_B0L0Y2 Chloroplast chlorophyll a/b binding protein n=1 Tax=Phyllostachys edulis RepID=B0L0Y2_9POAL Length = 263 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 45 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 81 [229][TOP] >UniRef100_A9PJV4 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PJV4_9ROSI Length = 224 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 GNE +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 2 GNE---LWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAG 40 [230][TOP] >UniRef100_A9NWZ3 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NWZ3_PICSI Length = 240 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 84 [231][TOP] >UniRef100_A9NT55 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NT55_PICSI Length = 166 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 84 [232][TOP] >UniRef100_A9NQ87 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NQ87_PICSI Length = 253 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 84 [233][TOP] >UniRef100_A9NPD6 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NPD6_PICSI Length = 266 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 84 [234][TOP] >UniRef100_A9NP21 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NP21_PICSI Length = 266 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 84 [235][TOP] >UniRef100_A9NMJ8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NMJ8_PICSI Length = 266 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 84 [236][TOP] >UniRef100_A9NLB8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NLB8_PICSI Length = 266 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 84 [237][TOP] >UniRef100_A9NL12 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NL12_PICSI Length = 266 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 84 [238][TOP] >UniRef100_A5BW14 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BW14_VITVI Length = 269 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 144 GNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 GNE +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 47 GNE---LWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAG 85 [239][TOP] >UniRef100_A5ASG6 Chromosome chr12 scaffold_47, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A5ASG6_VITVI Length = 265 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 47 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 83 [240][TOP] >UniRef100_Q00827 Chlorophyll a-b binding protein 48, chloroplastic n=1 Tax=Zea mays RepID=CB48_MAIZE Length = 264 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YG DR L+LGPLSG+ P+YLTGEFPGDYGWD+ G Sbjct: 46 SPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTEG 82 [241][TOP] >UniRef100_Q10HD0 Chlorophyll a-b binding protein, chloroplastic n=2 Tax=Oryza sativa RepID=CB23_ORYSJ Length = 263 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 45 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 81 [242][TOP] >UniRef100_P12332 Chlorophyll a-b binding protein, chloroplastic (Fragment) n=1 Tax=Silene latifolia subsp. alba RepID=CB21_SILPR Length = 205 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 46 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 82 [243][TOP] >UniRef100_Q42276 CAB binding protein,photosystem II (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q42276_ARATH Length = 101 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/58 (51%), Positives = 35/58 (60%) Frame = +3 Query: 96 RPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 +P+ PSG W YG DR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 23 KPKGPSGSPW--------------YGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 66 [244][TOP] >UniRef100_Q39141 Photosystem II type I chlorophyll a /b binding protein n=1 Tax=Arabidopsis thaliana RepID=Q39141_ARATH Length = 265 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/58 (51%), Positives = 35/58 (60%) Frame = +3 Query: 96 RPRKPSGEGWLVESNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 +P+ PSG W YG DR +LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 39 KPKGPSGSPW--------------YGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 82 [245][TOP] >UniRef100_Q00984 Chlorophyll a/b-binding protein n=1 Tax=Pinus thunbergii RepID=Q00984_PINTH Length = 266 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 48 SIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTAG 84 [246][TOP] >UniRef100_C5XQ83 Putative uncharacterized protein Sb03g027040 n=1 Tax=Sorghum bicolor RepID=C5XQ83_SORBI Length = 265 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YG DR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 47 SPWYGADRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 83 [247][TOP] >UniRef100_C5XQ82 Putative uncharacterized protein Sb03g027030 n=1 Tax=Sorghum bicolor RepID=C5XQ82_SORBI Length = 266 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YG DR L+LGP SG P+YLTGEFPGDYGWD+AG Sbjct: 48 SPWYGADRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 84 [248][TOP] >UniRef100_C5IFT7 Chloroplast chlorophyll A/B binding protein n=1 Tax=Mangifera indica RepID=C5IFT7_MANIN Length = 264 Score = 64.7 bits (156), Expect = 3e-09 Identities = 32/63 (50%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 87 LPPRPRKPSGEGWLVESNGGNEKLSA--FYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWD 260 L P PR+ G G + S +YGPDR +L P SG P+YLTGEFPGDYGWD Sbjct: 20 LSPAPRELMGNGRVSMRRTAKPTPSGSPWYGPDRVKYLSPFSGEPPSYLTGEFPGDYGWD 79 Query: 261 SAG 269 +AG Sbjct: 80 TAG 82 [249][TOP] >UniRef100_A9PJH7 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PJH7_9ROSI Length = 265 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 47 SIWYGPDRPKFLGPFSEQTPSYLTGEFPGDYGWDTAG 83 [250][TOP] >UniRef100_A9PFW7 Light-harvesting complex II protein Lhcb2 n=1 Tax=Populus trichocarpa RepID=A9PFW7_POPTR Length = 265 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 159 SAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAG 269 S +YGPDR +LGP S TP+YLTGEFPGDYGWD+AG Sbjct: 47 SIWYGPDRPKFLGPFSEQTPSYLTGEFPGDYGWDTAG 83