[UP]
[1][TOP] >UniRef100_A8IE32 75 kDa chloroplast membrane translocon n=1 Tax=Chlamydomonas reinhardtii RepID=A8IE32_CHLRE Length = 798 Score = 274 bits (700), Expect = 3e-72 Identities = 136/137 (99%), Positives = 136/137 (99%) Frame = +3 Query: 117 MQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSA 296 MQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSA Sbjct: 1 MQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSA 60 Query: 297 LGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQTDGGLPLPLYE 476 LGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQ DGGLPLPLYE Sbjct: 61 LGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQPDGGLPLPLYE 120 Query: 477 LAEESSDEKEKQQKDDK 527 LAEESSDEKEKQQKDDK Sbjct: 121 LAEESSDEKEKQQKDDK 137 [2][TOP] >UniRef100_C5KAA2 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAA2_9ALVE Length = 2139 Score = 65.1 bits (157), Expect = 3e-09 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSL 302 P+ P P PPPPPPPPPPP PP PP P +G +T +ADD P P L Sbjct: 1755 PATSPPPVSPPPPPPPPPPPPPPPPPPQEPPVGETTPCGQADDTPARPKL 1804 [3][TOP] >UniRef100_A8P236 Ground-like domain containing protein n=1 Tax=Brugia malayi RepID=A8P236_BRUMA Length = 205 Score = 63.9 bits (154), Expect = 6e-09 Identities = 36/91 (39%), Positives = 45/91 (49%), Gaps = 1/91 (1%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA 329 F ++++S S PP+ C PP PPPPPPPPPP PP PP PP Sbjct: 13 FYITTIESFVSGHGCGQGPPAPCGAPPPPPPPPPPPPP---PPPPPQPPCSCPQLCLPCP 69 Query: 328 DDNPNLPSLPSAEGWFTLTP-LPLLEHSCCS 239 P LP LPS P +P+L +SCC+ Sbjct: 70 PPLPPLPPLPSLPCPCLPCPCMPMLLNSCCN 100 [4][TOP] >UniRef100_B9F794 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9F794_ORYSJ Length = 249 Score = 63.5 bits (153), Expect = 8e-09 Identities = 48/140 (34%), Positives = 61/140 (43%), Gaps = 3/140 (2%) Frame = +3 Query: 111 LIMQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQP 290 L L A P R GR + A +H SQP H +Q +S S S ++ Sbjct: 8 LFFSPLAAGPSRRVR-GRGRSTSVSAAASASSHNSQPHG--HPQQPLAVASSSSKSESKG 64 Query: 291 SALGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGG---GGGGSGGQGQTDGGLP 461 S L ++A AF+L + GGFGG G GGGGGG GGGG GG G GG Sbjct: 65 SKTFALASAITAAASGAFLLASSGGGFGGGAGGPLGGGGGGWGAGGGGGGGGGGGGGGFW 124 Query: 462 LPLYELAEESSDEKEKQQKD 521 ++ +DEK D Sbjct: 125 SRIFSGGAAHADEKSSGDWD 144 [5][TOP] >UniRef100_Q84Q83 Protein TOC75, chloroplastic n=2 Tax=Oryza sativa Japonica Group RepID=TOC75_ORYSJ Length = 817 Score = 63.5 bits (153), Expect = 8e-09 Identities = 48/140 (34%), Positives = 61/140 (43%), Gaps = 3/140 (2%) Frame = +3 Query: 111 LIMQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQP 290 L L A P R GR + A +H SQP H +Q +S S S ++ Sbjct: 8 LFFSPLAAGPSRRVR-GRGRSTSVSAAASASSHNSQPHG--HPQQPLAVASSSSKSESKG 64 Query: 291 SALGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGG---GGGGSGGQGQTDGGLP 461 S L ++A AF+L + GGFGG G GGGGGG GGGG GG G GG Sbjct: 65 SKTFALASAITAAASGAFLLASSGGGFGGGAGGPLGGGGGGWGAGGGGGGGGGGGGGGFW 124 Query: 462 LPLYELAEESSDEKEKQQKD 521 ++ +DEK D Sbjct: 125 SRIFSGGAAHADEKSSGDWD 144 [6][TOP] >UniRef100_A8J0N1 Chloroplast lumenal protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J0N1_CHLRE Length = 404 Score = 62.4 bits (150), Expect = 2e-08 Identities = 42/130 (32%), Positives = 66/130 (50%), Gaps = 1/130 (0%) Frame = +3 Query: 117 MQGLKATPGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSA 296 + G ++ G++A++ P +R + A Q + SN +E+ E S+ G + + S Sbjct: 9 LSGFRSALGVQAAAPVPRFAVSRRVAITYA---QLAPSNSSERDE-SADGKSAAGSVQSP 64 Query: 297 LGRLGKFGLSSALSAFVLVPNFGGFGGN-GGNRGGGGGGGGGGGSGGQGQTDGGLPLPLY 473 LG + L A GG GG+ GG+ GGGGGGGGGGG G G +D L L Sbjct: 65 LGTVSPVPLVPARDVRAEAATGGGDGGSTGGSSGGGGGGGGGGGGEGAGNSDDDRILTLS 124 Query: 474 ELAEESSDEK 503 E+ ++++K Sbjct: 125 EVEAFAAEKK 134 [7][TOP] >UniRef100_Q4SHS7 Chromosome 5 SCAF14581, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SHS7_TETNG Length = 789 Score = 61.2 bits (147), Expect = 4e-08 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 S PP+ CPP+PPPPPPPPPPP PP+PP P Sbjct: 633 SAPPPATATCPPVPPPPPPPPPPPPPPPMPPTVP 666 [8][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 60.8 bits (146), Expect = 5e-08 Identities = 30/50 (60%), Positives = 31/50 (62%) Frame = -3 Query: 511 CFSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 C SFSS +S S PPS P PP PPPPPPPPPPP PP PP PP Sbjct: 359 CKSFSSYPIDCASFGCS--PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP + P PP PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 [9][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 60.8 bits (146), Expect = 5e-08 Identities = 31/67 (46%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL--PSLPSAE 290 S +PP P PP PPPPPPPPPPP PP PP PP +P L PS+PS Sbjct: 214 SPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSPP 273 Query: 289 GWFTLTP 269 F P Sbjct: 274 FAFGFRP 280 [10][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 60.5 bits (145), Expect = 7e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PPS PC P PPPPPPPPPPP PP PP PP Sbjct: 348 PPSANPCQPCPPPPPPPPPPPPPPPPPPPPP 378 Score = 60.5 bits (145), Expect = 7e-08 Identities = 36/77 (46%), Positives = 38/77 (49%), Gaps = 6/77 (7%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK------LGTSTKADRADDNPNLPSLPSA 293 PPS P PP PPPPPPPPPPP PP PP PP TS + LP+L Sbjct: 377 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTSCGFGCHYRDRLLPTLTYP 436 Query: 292 EGWFTLTPLPLLEHSCC 242 TL LP E SCC Sbjct: 437 CDTCTLICLPGCEQSCC 453 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 S NP CP PP PPPPPPPPPPP PP PP+PP Sbjct: 350 SANPCQPCPPPPPPPPPPPPPPPP--PPPPPSPP 381 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 388 [11][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 60.5 bits (145), Expect = 7e-08 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = -3 Query: 484 SASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 SASS S +P P PP+PPPPPPPPPPP PP PP+PP Sbjct: 227 SASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPP 267 Score = 60.1 bits (144), Expect = 9e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PP P PP PPPPPPPPPPP LPPLPP P K Sbjct: 259 PPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAK 290 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = -3 Query: 499 SSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +S S+ S S PP + P PP PPPPPPPPPPP PP PP PP Sbjct: 228 ASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/48 (58%), Positives = 28/48 (58%) Frame = -3 Query: 505 SFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 S SS SS S PP P PP PPPPPPPPPPP PP PP PP Sbjct: 227 SASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPP 274 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP P LPP PP Sbjct: 256 PPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 53.5 bits (127), Expect = 9e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPP PPP PP PP PP L Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPL 280 [12][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 60.1 bits (144), Expect = 9e-08 Identities = 33/80 (41%), Positives = 39/80 (48%), Gaps = 3/80 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA---DDNPNLPSLPSAEGW 284 PP P PP PPPPPPPPPPP PP PP PP G A P P+LP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPPALPCFHEG 989 Query: 283 FTLTPLPLLEHSCCSAWLLL 224 P ++E + C++ LL Sbjct: 990 QEYPPNTIIEEASCTSSGLL 1009 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/52 (50%), Positives = 27/52 (51%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 PP P PP PPPPPPPPPPP PP PP PP P P+LP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALP 973 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 P+ P PP PPPPPPPPPPP PP PP PP Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPPP 880 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 P VC P PPPPPPPPPPP PP PP PP Sbjct: 845 PMVCEEPTTPPPPPPPPPPPPPPPPPPPPP 874 [13][TOP] >UniRef100_UPI000060414B formin-like domain containing protein MAN n=1 Tax=Mus musculus RepID=UPI000060414B Length = 1083 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 10/55 (18%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRL----------PPLPPNPP 362 S D+S ++ +G+ +PP P PP PPPPPPPPPPP L PPLPP PP Sbjct: 536 SSDTSEAAQNGTASPPMSPPPPPPPPPPPPPPPPPPLPGPAAETSPAPPLPPPPP 590 [14][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP PCPP PPPPPPPPPPP PP PP PP Sbjct: 61 PPPPRPCPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP CP PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 P + P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PERIIPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPPR P PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 PP P PP PPPPPPPPPPP PP PP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 PP P PP PPPPPPPPPPP PP PP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 104 [15][TOP] >UniRef100_A4Z338 Putative Peptidase, Caspase-like domain and TPR repeats n=1 Tax=Bradyrhizobium sp. ORS278 RepID=A4Z338_BRASO Length = 529 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/56 (50%), Positives = 33/56 (58%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 296 S +P P PPLPPPPPP PPPP PP PP+PP KA+ P +P +PS Sbjct: 299 SPSPTLQPPAPPLPPPPPPSPPPPAPPPSPPSPP------KAELVPPLPPVPPVPS 348 [16][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 60.1 bits (144), Expect = 9e-08 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTS 347 PP P PP PPPPPPPPPPP PP PP PP+L TS Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTS 103 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [17][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 60.1 bits (144), Expect = 9e-08 Identities = 32/75 (42%), Positives = 37/75 (49%), Gaps = 11/75 (14%) Frame = -3 Query: 490 DSSASS*SGSGNP-----------PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTST 344 DSS+SS + S P P V P PP+ PPPPPPPPPP PP PP PP G Sbjct: 105 DSSSSSRAASATPVHHHRGRFMPPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPP 164 Query: 343 KADRADDNPNLPSLP 299 +P P+ P Sbjct: 165 PPGPPPPHPPPPAGP 179 [18][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 60.1 bits (144), Expect = 9e-08 Identities = 27/53 (50%), Positives = 28/53 (52%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 296 PPS P PP PPPPPPPPPPP PP PP PP + P P PS Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPS 307 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/53 (49%), Positives = 28/53 (52%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 296 PP P PP PPPP PPPPPP PP PP PP S +P +P PS Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPS 315 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 PP P PP PPPPPP PPPP PP PP PP S R +P+ P P Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPP 312 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +PP P PP PPPPPPPPPPP PP PP PP Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPP-PPSPPPPP 282 [19][TOP] >UniRef100_A2APV2-3 Isoform 3 of Formin-like protein 2 n=1 Tax=Mus musculus RepID=A2APV2-3 Length = 1091 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 10/55 (18%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRL----------PPLPPNPP 362 S D+S ++ +G+ +PP P PP PPPPPPPPPPP L PPLPP PP Sbjct: 536 SSDTSEAAQNGTASPPMSPPPPPPPPPPPPPPPPPPLPGPAAETSPAPPLPPPPP 590 [20][TOP] >UniRef100_A2APV2 Formin-like protein 2 n=1 Tax=Mus musculus RepID=FMNL2_MOUSE Length = 1086 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 10/55 (18%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRL----------PPLPPNPP 362 S D+S ++ +G+ +PP P PP PPPPPPPPPPP L PPLPP PP Sbjct: 536 SSDTSEAAQNGTASPPMSPPPPPPPPPPPPPPPPPPLPGPAAETSPAPPLPPPPP 590 [21][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP PCPP PPPPPPPPPPP PP PP PP Sbjct: 255 PPCPPPCPPPPPPPPPPPPPPPPPPPPPCPP 285 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = -3 Query: 526 LSSFCCFSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 L CC S + A PP PCPP PPPPPPPPPP PP PP PP Sbjct: 227 LGDSCCPSAAPCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPP 281 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP PCPP PPPPPPPPPPP PP PP PP Sbjct: 298 PPPPPPCPP-PPPPPPPPPPPCPPPPPPPPP 327 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPCPPPCPPPPP 292 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP CP PP PPPP PPPPPP PP PP PP Sbjct: 290 PPPPCPPPPPPPPPCPPPPPPPPPPPPPCPP 320 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP CP PP PPPPPPPP PP PP PP PP Sbjct: 300 PPPPCPPPPPPPPPPPPPCPPPPPPPPPCPP 330 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = -3 Query: 454 PPSVCPCPPLPPP--PPPPPPPPRLPPLPPNPP 362 PP PCPP PPP PPPPPPPP PP PP PP Sbjct: 281 PPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPP 313 Score = 53.9 bits (128), Expect = 7e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 295 PPPPPPPPPCPPPPPPPPPPP--PPCPPPPP 323 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPP-PPPPPRLPPLPPNPP 362 PP CP PP PPPPPP PPPPP PP PP PP Sbjct: 279 PPPPCP-PPCPPPPPPCPPPPPPPPPCPPPPP 309 [22][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP CP PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [23][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP CP PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [24][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = -3 Query: 481 ASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 341 +S S G P S P PP PPPPPPPPPPP PP PP PP + S++ Sbjct: 485 SSQDSTRGGPSSTPPPPPPPPPPPPPPPPPPPPPPPPPPPSVTLSSQ 531 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/46 (56%), Positives = 28/46 (60%) Frame = -3 Query: 499 SSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 S +S SS + PS P PP PPPPPPPPPPP PP PP PP Sbjct: 478 SKKNSECSSQDSTRGGPSSTPPPPPPPPPPPPPPPPPPPPPPPPPP 523 [25][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/61 (47%), Positives = 33/61 (54%), Gaps = 8/61 (13%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKA--------DRADDNPNLPSLP 299 PP P PP PPPPPPPPPPP PP PP PPK +T A D A P+ + P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAFPPAPLRRDTASTGPSQETYP 73 Query: 298 S 296 + Sbjct: 74 A 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 [26][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP LPP PP PP L Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPL 282 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PPLPP PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 56.6 bits (135), Expect = 1e-06 Identities = 30/65 (46%), Positives = 31/65 (47%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 275 PP P PP PPPPPPPPPPP PP PP PP P LP P + Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPS------ 288 Query: 274 TPLPL 260 PLPL Sbjct: 289 LPLPL 293 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/53 (50%), Positives = 28/53 (52%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 296 PP P PP PPPPP PPPPP PPLPP PP L A P S P+ Sbjct: 257 PPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVAPPSTSQPT 309 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP V PP PPPPPPPPPPP PP PP PP Sbjct: 227 PPQVQVVPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 264 [27][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PPLPP+PP Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PPLPPPPPPPPPPP PP PP PP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 58.5 bits (140), Expect = 3e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP LPP PP PP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 PP P PP PPPPPPPPPPP PP PP PP L S P P P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 PP P PPLPP PPPPPPPP PP PP PP P +P+LP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALP 717 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +PP P PP PPPPPPPPPPP PP PP PP Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP + P PP PPPPPPPPPPP PP PP PP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 PP P PP PPPPPPPPPPP PP PP PP P LP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 53.9 bits (128), Expect = 7e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PPS P PP PPPP PPPPPP PP PP PP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPP 256 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLP-PLPPNPPKL 356 +PP P PP PPPPPPPPPPP P P PP+PP L Sbjct: 678 SPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPL 712 [28][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTS 347 PP P PP PPPPPPPPPPP PP PP PP LG++ Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSN 55 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 [29][TOP] >UniRef100_UPI0000E1F767 PREDICTED: formin-like 2 isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E1F767 Length = 994 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 451 PPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 496 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 S PP P PP PPPPPPPPPPP PPLP P T A P+ P LP Sbjct: 448 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLPSAPPLP 500 [30][TOP] >UniRef100_UPI0000E1F766 PREDICTED: formin-like 2 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E1F766 Length = 1026 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 547 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 S PP P PP PPPPPPPPPPP PPLP P T A P+ P LP Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLPSAPPLP 551 [31][TOP] >UniRef100_UPI0000E1F765 PREDICTED: formin-like 2 isoform 7 n=1 Tax=Pan troglodytes RepID=UPI0000E1F765 Length = 1045 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 547 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 S PP P PP PPPPPPPPPPP PPLP P T A P+ P LP Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLPSAPPLP 551 [32][TOP] >UniRef100_UPI0000E1F763 PREDICTED: formin-like 2 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E1F763 Length = 1037 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 547 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 S PP P PP PPPPPPPPPPP PPLP P T A P+ P LP Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLPSAPPLP 551 [33][TOP] >UniRef100_UPI0000E1F761 PREDICTED: formin-like 2 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E1F761 Length = 1087 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 550 PPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 595 Score = 55.8 bits (133), Expect = 2e-06 Identities = 30/66 (45%), Positives = 34/66 (51%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 317 S D+ + +G PP P PP PPPPPPPPPPP PPLP P T A P Sbjct: 536 SSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLP 593 Query: 316 NLPSLP 299 + P LP Sbjct: 594 SAPPLP 599 [34][TOP] >UniRef100_UPI0000E1F760 PREDICTED: formin-like 2 isoform 8 n=1 Tax=Pan troglodytes RepID=UPI0000E1F760 Length = 1093 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP L A+ P P LPSA Sbjct: 550 PPMPPPPPPPPPPPPPPPPPPPPPPL-PGPAAETVPAPPLAPPLPSA 595 Score = 55.8 bits (133), Expect = 2e-06 Identities = 30/66 (45%), Positives = 34/66 (51%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 317 S D+ + +G PP P PP PPPPPPPPPPP PPLP P T A P Sbjct: 536 SSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLP--GPAAETVPAPPLAPPLP 593 Query: 316 NLPSLP 299 + P LP Sbjct: 594 SAPPLP 599 [35][TOP] >UniRef100_UPI0001B798A6 UPI0001B798A6 related cluster n=1 Tax=Homo sapiens RepID=UPI0001B798A6 Length = 625 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 30/47 (63%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP G + A+ P P LPSA Sbjct: 88 PPMPPPPPPPPPPPPPPPPPPPPPLPGPA--AETVPAPPLAPPLPSA 132 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP-PKLGTSTKADRADDNPNLPSLP 299 N P P PP PPPPPPPPPPP PP PP P P T A P+ P LP Sbjct: 83 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 136 [36][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/111 (32%), Positives = 42/111 (37%) Frame = -3 Query: 466 GSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 287 G+ PP P PP PPPPPPPPPPP PP PP PP + + DR Sbjct: 650 GAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPDVLAADAFDR--------------- 694 Query: 286 WFTLTPLPLLEHSCCSAWLLLEG*DAWARTTSAVRAVRSVGRPLEARRPGV 134 + + W AW SA R S G + PGV Sbjct: 695 ------------TVAAGWGSAPTGGAWTHAGSASRYAASAGAGIHRMGPGV 733 [37][TOP] >UniRef100_C1E983 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E983_9CHLO Length = 1724 Score = 58.9 bits (141), Expect = 2e-07 Identities = 37/108 (34%), Positives = 45/108 (41%), Gaps = 4/108 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPP----PPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 287 PP P PP PPPPPPP PPPP PLPP PP + D P +P P A Sbjct: 1142 PPPPSPPPPSPPPPPPPPPPAPPPPNANPLPPPPPPSPPPSPPPPPPDAPPMPPPPLAPY 1201 Query: 286 WFTLTPLPLLEHSCCSAWLLLEG*DAWARTTSAVRAVRSVGRPLEARR 143 + P E + C A + D + T A +V + R R Sbjct: 1202 ATPVAPADSNECTHCPAGTFSDLQDVLSCTPCAAGSVTATTRSRSCER 1249 [38][TOP] >UniRef100_B4HDK5 GL19678 n=1 Tax=Drosophila persimilis RepID=B4HDK5_DROPE Length = 281 Score = 58.9 bits (141), Expect = 2e-07 Identities = 42/123 (34%), Positives = 59/123 (47%), Gaps = 2/123 (1%) Frame = +3 Query: 159 GRPTLRTARTALVVRAHASQPSSSNHAEQQ-ECSSSGSGVSVNQPSALGRLGKFGLSSAL 335 GRPTLR A+ ++ + A Q H E E + ++++ L S Sbjct: 41 GRPTLRRAKRSVHPKLQAVQEL---HVESPAEADTLDIDATLDEAIVLRERRAAEPGSQE 97 Query: 336 SAFVLVPNFGGFGGNGGNRGG-GGGGGGGGGSGGQGQTDGGLPLPLYELAEESSDEKEKQ 512 S+ G G NGGN GG GGGGGGGGGSGG G GG ++L ++ ++ KQ Sbjct: 98 SSVSQQSQEQGVGKNGGNNGGAGGGGGGGGGSGGGGGGGGGNNRRQHQLRKQQQQQRRKQ 157 Query: 513 QKD 521 Q + Sbjct: 158 QNN 160 [39][TOP] >UniRef100_Q96PY5-3 Isoform 2 of Formin-like protein 2 n=1 Tax=Homo sapiens RepID=Q96PY5-3 Length = 1092 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 30/47 (63%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP G + A+ P P LPSA Sbjct: 550 PPMPPPPPPPPPPPPPPPPPPPPPLPGPA--AETVPAPPLAPPLPSA 594 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP-PKLGTSTKADRADDNPNLPSLP 299 N P P PP PPPPPPPPPPP PP PP P P T A P+ P LP Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 598 [40][TOP] >UniRef100_Q96PY5 Formin-like protein 2 n=1 Tax=Homo sapiens RepID=FMNL2_HUMAN Length = 1086 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/47 (57%), Positives = 30/47 (63%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP G + A+ P P LPSA Sbjct: 550 PPMPPPPPPPPPPPPPPPPPPPPPLPGPA--AETVPAPPLAPPLPSA 594 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP-PKLGTSTKADRADDNPNLPSLP 299 N P P PP PPPPPPPPPPP PP PP P P T A P+ P LP Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 598 [41][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 58.5 bits (140), Expect = 3e-07 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 15/62 (24%) Frame = -3 Query: 502 FSSLDSSASS*SGSGN---------------PPSVCPCPPLPPPPPPPPPPPRLPPLPPN 368 F+ LD+ S +G GN PP P PP PPPPPPPPPPP PP PP Sbjct: 1381 FAFLDAMVSYTAGDGNDVGLTLTPTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPT 1440 Query: 367 PP 362 PP Sbjct: 1441 PP 1442 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/37 (59%), Positives = 24/37 (64%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTST 344 PP P PP PPPPPPP PPP PP PP PP + + T Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGT 1459 [42][TOP] >UniRef100_B8AMH8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AMH8_ORYSI Length = 368 Score = 58.5 bits (140), Expect = 3e-07 Identities = 34/70 (48%), Positives = 34/70 (48%), Gaps = 3/70 (4%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPR---LPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 S PP P PP PPPPPPPPPR PP PP PP G T A P P P Sbjct: 179 SPTPPPPLPSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQPTLAP-----PPPPPPPPY 233 Query: 292 EGWFTLTPLP 263 G TL PLP Sbjct: 234 CGHPTLAPLP 243 [43][TOP] >UniRef100_A9RE09 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RE09_PHYPA Length = 705 Score = 58.5 bits (140), Expect = 3e-07 Identities = 45/122 (36%), Positives = 61/122 (50%), Gaps = 12/122 (9%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPL--PPNPPKLGTST--KADRADDNPNLPSLPSAEGW 284 P+V PP PPPPPPPPPP LPPL P P ++ TST ++R D + L ++ Sbjct: 505 PAVPSPPPPRPPPPPPPPPPPLPPLRSPTQPAQIKTSTTSSSERPDSSTQLEAVGP---- 560 Query: 283 FTLTPLPLLEHSCCS-----AWLLLEG*DAWARTTSAVRA--VRSVGRP-LEARRPGVAF 128 + PLP +EH CS WL+ TT A RA + S+ P ++ R+ V Sbjct: 561 -RILPLP-IEHWTCSMSYVACWLM--------TTTDASRAALLASIRNPSIQLRKTNVGD 610 Query: 127 NP 122 P Sbjct: 611 KP 612 [44][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADD 323 PP P PP PPPPPPPPPPP PP PP PP S +A R D Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVD 74 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -3 Query: 493 LDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 LD+ +S + PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 LDTPVASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/55 (43%), Positives = 28/55 (50%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 290 PP P PP PPPPPPPPPPP PP PP P + D + P P+ + Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVDAVEVAPRSSVWPNGK 89 [45][TOP] >UniRef100_A8QDB8 Ground-like domain containing protein n=1 Tax=Brugia malayi RepID=A8QDB8_BRUMA Length = 276 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 5/36 (13%) Frame = -3 Query: 454 PPSVCP----CPPLPPPPPPPPP-PPRLPPLPPNPP 362 PP VCP CPP PPPPPPPPP PP PP PP+PP Sbjct: 110 PPVVCPRPIICPPPPPPPPPPPPCPPSPPPCPPSPP 145 Score = 54.3 bits (129), Expect = 5e-06 Identities = 32/85 (37%), Positives = 38/85 (44%), Gaps = 13/85 (15%) Frame = -3 Query: 454 PPSVCPCPP---LPPP---------PPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 311 PP PCPP PPP PPPPPPPP PP PP+PP S P + Sbjct: 96 PPLPXPCPPPPICPPPVVCPRPIICPPPPPPPPPPPPCPPSPPPCPPS---------PPM 146 Query: 310 PSLPSAEGWFTLT-PLPLLEHSCCS 239 P P T T +P++ CC+ Sbjct: 147 PICPILAPKLTPTYTIPVINDCCCT 171 [46][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 58.2 bits (139), Expect = 4e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP +C PP PPPPPPPPPPP PP PP PP Sbjct: 132 PPPMCAPPPPPPPPPPPPPPPPPPPPPPPPP 162 Score = 57.8 bits (138), Expect = 5e-07 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 5/36 (13%) Frame = -3 Query: 454 PPSVCP-----CPPLPPPPPPPPPPPRLPPLPPNPP 362 PP VCP C P PPPPPPPPPPP PP PP PP Sbjct: 125 PPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPP 160 Score = 57.0 bits (136), Expect = 8e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 133 PPMCAPPPPPPPPPPPPPPPPPPPPPPPPPP 163 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP CP PP P PPPPPPPP LPP PP PP Sbjct: 171 PPPPCPPPPAPCPPPPPPPPMCLPPPPPPPP 201 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 6/37 (16%) Frame = -3 Query: 454 PPSVCPCPP------LPPPPPPPPPPPRLPPLPPNPP 362 PP+ CP PP LPPPPPPPPPPP P PP PP Sbjct: 178 PPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPP 214 [47][TOP] >UniRef100_UPI00017C2B21 PREDICTED: similar to WAS/WASL interacting protein family, member 3 n=1 Tax=Bos taurus RepID=UPI00017C2B21 Length = 486 Score = 58.2 bits (139), Expect = 4e-07 Identities = 36/69 (52%), Positives = 40/69 (57%), Gaps = 1/69 (1%) Frame = -3 Query: 460 GNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP-NLPSLPSAEGW 284 G+PP V P P L PPPPPPPPPP LPP PP LG S KA + P +LP +P Sbjct: 211 GSPP-VVPPPLLCPPPPPPPPPPPLPP----PPALGPSDKAAKPQLAPLHLPPVP----- 260 Query: 283 FTLTPLPLL 257 PLPLL Sbjct: 261 ---PPLPLL 266 [48][TOP] >UniRef100_UPI0001795F40 PREDICTED: leiomodin 2 (cardiac) n=1 Tax=Equus caballus RepID=UPI0001795F40 Length = 549 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 P V P PP PPPPPPPPPP RLPP PP PP Sbjct: 419 PVVPPAPPPPPPPPPPPPPQRLPPPPPPPP 448 [49][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP + P PPLPPPPP PPPPP PPLPP PP Sbjct: 79 PPPLPPPPPLPPPPPLPPPPPPPPPLPPPPP 109 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP + P PPLPPPPPPPPP P PPLPP PP Sbjct: 85 PPPLPPPPPLPPPPPPPPPLPPPPPLPPPPP 115 Score = 53.9 bits (128), Expect = 7e-06 Identities = 30/60 (50%), Positives = 31/60 (51%) Frame = -3 Query: 487 SSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 308 +S S S SV P PPLPPPPP PPPPP LPP PP PP L P LP Sbjct: 62 ASTESWQCSSTLGSVPPPPPLPPPPPLPPPPP-LPPPPPPPPPLPPPPPLPPPPPPPPLP 120 [50][TOP] >UniRef100_UPI000179ED76 UPI000179ED76 related cluster n=1 Tax=Bos taurus RepID=UPI000179ED76 Length = 455 Score = 58.2 bits (139), Expect = 4e-07 Identities = 36/69 (52%), Positives = 40/69 (57%), Gaps = 1/69 (1%) Frame = -3 Query: 460 GNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP-NLPSLPSAEGW 284 G+PP V P P L PPPPPPPPPP LPP PP LG S KA + P +LP +P Sbjct: 180 GSPP-VVPPPLLCPPPPPPPPPPPLPP----PPALGPSDKAAKPQLAPLHLPPVP----- 229 Query: 283 FTLTPLPLL 257 PLPLL Sbjct: 230 ---PPLPLL 235 [51][TOP] >UniRef100_A1TG37 Putative uncharacterized protein n=1 Tax=Mycobacterium vanbaalenii PYR-1 RepID=A1TG37_MYCVP Length = 396 Score = 58.2 bits (139), Expect = 4e-07 Identities = 28/55 (50%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPP-RLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+ P PP PPPPPPPPPPP + PP PP P T A + P P LP A Sbjct: 222 PPAPAPPPPPPPPPPPPPPPPAQQPPPPPQP----TPPPAQQPSPEPQFPWLPPA 272 [52][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 58.2 bits (139), Expect = 4e-07 Identities = 28/60 (46%), Positives = 32/60 (53%), Gaps = 5/60 (8%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPP-----NPPKLGTSTKADRADDNPNLPSLPSA 293 +PP P PP PPPPPPPPPPP PP P PP T T + LPS+P+A Sbjct: 103 SPPPPSPPPPSPPPPPPPPPPPSPPPPSPPPPTTTPPTTTTPTPSMHPIQPTQLPSIPNA 162 [53][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 58.2 bits (139), Expect = 4e-07 Identities = 28/62 (45%), Positives = 31/62 (50%) Frame = -3 Query: 460 GNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWF 281 G PP P PP PPPPPPPPPPP P PP+PP +P PS P W+ Sbjct: 1201 GQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPP---------PPPSPPPPSPPPPPPWW 1251 Query: 280 TL 275 L Sbjct: 1252 ML 1253 [54][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PPLPPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP + P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP CP PP PPPP PPPPPP PP PP PP Sbjct: 17 PPPHCPPPPPPPPPLPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 [55][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 58.2 bits (139), Expect = 4e-07 Identities = 32/68 (47%), Positives = 34/68 (50%), Gaps = 4/68 (5%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLP----PNPPKLGTSTKADRADDNPNLPSLPSAEG 287 PPS P PP PPPPPPPPPPP PP P P PP G + A + P P PS Sbjct: 420 PPS--PPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYP 477 Query: 286 WFTLTPLP 263 PLP Sbjct: 478 PSPAPPLP 485 [56][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 NPP P PP PPPPPPPPPPP PP PP PP + Sbjct: 42 NPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPI 75 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP PP PP P KL Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPIKL 77 [57][TOP] >UniRef100_Q581D1 Flagellum-adhesion glycoprotein, putative n=1 Tax=Trypanosoma brucei RepID=Q581D1_9TRYP Length = 590 Score = 58.2 bits (139), Expect = 4e-07 Identities = 33/59 (55%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = -3 Query: 487 SSASS*SGSGNP-PSVCPCPPLPPPPPPPPPPPRLP-PLPPNPPKLGTSTKADRADDNP 317 S + S S S +P PSV P PP PPPPPPPPPPP P P PP+PP+ T+ A RA P Sbjct: 354 SPSPSPSASPSPSPSVQPPPPPPPPPPPPPPPPITPNPDPPSPPR-PTAVAAFRASSFP 411 [58][TOP] >UniRef100_Q581C6 Flagellum-adhesion glycoprotein, putative n=1 Tax=Trypanosoma brucei RepID=Q581C6_9TRYP Length = 590 Score = 58.2 bits (139), Expect = 4e-07 Identities = 33/59 (55%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = -3 Query: 487 SSASS*SGSGNP-PSVCPCPPLPPPPPPPPPPPRLP-PLPPNPPKLGTSTKADRADDNP 317 S + S S S +P PSV P PP PPPPPPPPPPP P P PP+PP+ T+ A RA P Sbjct: 354 SPSPSPSASPSPSPSVQPPPPPPPPPPPPPPPPITPNPDPPSPPR-PTAVAAFRASSFP 411 [59][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PPLPP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 57.8 bits (138), Expect = 5e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP + P PP PPPPPPPPPPP PP PP PP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 102 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP+ P PP PPPPPPPPPPP PP PP PP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 [60][TOP] >UniRef100_A4R6T5 Predicted protein n=1 Tax=Magnaporthe grisea RepID=A4R6T5_MAGGR Length = 166 Score = 58.2 bits (139), Expect = 4e-07 Identities = 48/137 (35%), Positives = 59/137 (43%), Gaps = 14/137 (10%) Frame = +3 Query: 93 ALY*IHLIMQGLKATPGLRASS-------GRPTLRTARTALVVRAHASQPSSSNHAEQQE 251 AL+ + L G+ A P AS G P + A A +Q ++N AE+++ Sbjct: 8 ALFILLLPFYGVMALPIDPASGSLDAVDHGVPAVARDVQAAAATADTAQIETANEAEKRK 67 Query: 252 CSSSGSGVSVNQPSALG-------RLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGG 410 G G G +GK GL S F FGG GG GG GGGGGG Sbjct: 68 KKGGGGGGGGGGGGGGGGGAGGFLEIGKDGLKLGGSGF----GFGGGGGGGGRNGGGGGG 123 Query: 411 GGGGGSGGQGQTDGGLP 461 G GG GG G GGLP Sbjct: 124 GLGGSGGGGG--GGGLP 138 [61][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 57.8 bits (138), Expect = 5e-07 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 341 PPS P PP PPPPPPPPPPP PP PP PP + + + Sbjct: 171 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNAR 208 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 167 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 169 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 199 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 170 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PPS P PP PPPPPPPPPP PP PP PP Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 193 Score = 53.5 bits (127), Expect = 9e-06 Identities = 26/56 (46%), Positives = 27/56 (48%) Frame = -3 Query: 466 GSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 G PP CPP PPP PPPPPPP PP P PP S + P PS P Sbjct: 120 GCPPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPP 175 [62][TOP] >UniRef100_UPI0000F53460 enabled homolog isoform 2 n=2 Tax=Mus musculus RepID=UPI0000F53460 Length = 789 Score = 57.8 bits (138), Expect = 5e-07 Identities = 33/71 (46%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 317 SLDS S P PP PPPPPPPPPPP LPP PP PP S +A P Sbjct: 408 SLDSVTYPVSPPPTSGPAAPPPPPPPPPPPPPPPPPLPP-PPLPPLASLSHCGSQASPPP 466 Query: 316 NLP--SLPSAE 290 P S PS++ Sbjct: 467 GTPLASTPSSK 477 [63][TOP] >UniRef100_UPI0000E1203E Os03g0308700 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E1203E Length = 464 Score = 57.8 bits (138), Expect = 5e-07 Identities = 34/70 (48%), Positives = 34/70 (48%), Gaps = 3/70 (4%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPR---LPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 S PP P PP PPPPPPPPPR PP PP PP G T A P P P Sbjct: 276 SPTPPPPPPSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQPTLA------PPPPPPPPY 329 Query: 292 EGWFTLTPLP 263 G TL PLP Sbjct: 330 CGHPTLAPLP 339 [64][TOP] >UniRef100_UPI000047625B enabled homolog isoform 3 n=1 Tax=Mus musculus RepID=UPI000047625B Length = 785 Score = 57.8 bits (138), Expect = 5e-07 Identities = 33/71 (46%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 317 SLDS S P PP PPPPPPPPPPP LPP PP PP S +A P Sbjct: 404 SLDSVTYPVSPPPTSGPAAPPPPPPPPPPPPPPPPPLPP-PPLPPLASLSHCGSQASPPP 462 Query: 316 NLP--SLPSAE 290 P S PS++ Sbjct: 463 GTPLASTPSSK 473 [65][TOP] >UniRef100_UPI00015DF6E5 enabled homolog (Drosophila) n=1 Tax=Mus musculus RepID=UPI00015DF6E5 Length = 391 Score = 57.8 bits (138), Expect = 5e-07 Identities = 33/71 (46%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 317 SLDS S P PP PPPPPPPPPPP LPP PP PP S +A P Sbjct: 11 SLDSVTYPVSPPPTSGPAAPPPPPPPPPPPPPPPPPLPP-PPLPPLASLSHCGSQASPPP 69 Query: 316 NLP--SLPSAE 290 P S PS++ Sbjct: 70 GTPLASTPSSK 80 [66][TOP] >UniRef100_UPI00015DF6E3 enabled homolog (Drosophila) n=1 Tax=Mus musculus RepID=UPI00015DF6E3 Length = 701 Score = 57.8 bits (138), Expect = 5e-07 Identities = 33/71 (46%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 317 SLDS S P PP PPPPPPPPPPP LPP PP PP S +A P Sbjct: 320 SLDSVTYPVSPPPTSGPAAPPPPPPPPPPPPPPPPPLPP-PPLPPLASLSHCGSQASPPP 378 Query: 316 NLP--SLPSAE 290 P S PS++ Sbjct: 379 GTPLASTPSSK 389 [67][TOP] >UniRef100_UPI000056479E enabled homolog isoform 1 n=1 Tax=Mus musculus RepID=UPI000056479E Length = 804 Score = 57.8 bits (138), Expect = 5e-07 Identities = 33/71 (46%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 317 SLDS S P PP PPPPPPPPPPP LPP PP PP S +A P Sbjct: 423 SLDSVTYPVSPPPTSGPAAPPPPPPPPPPPPPPPPPLPP-PPLPPLASLSHCGSQASPPP 481 Query: 316 NLP--SLPSAE 290 P S PS++ Sbjct: 482 GTPLASTPSSK 492 [68][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 57.8 bits (138), Expect = 5e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PPS P PP PPPPPPPPPPP PP PNPP Sbjct: 240 PPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 Score = 57.0 bits (136), Expect = 8e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP+PP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 PP P PP PPPPPPPPPPP PP PP P Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 53.5 bits (127), Expect = 9e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 S +PP P PP PPPPPPP PPP PP PP PP Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 [69][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 57.8 bits (138), Expect = 5e-07 Identities = 32/80 (40%), Positives = 38/80 (47%), Gaps = 11/80 (13%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP--------KLGTSTKADRADDNPNLPSLP 299 PP P PP PPPPPPPPPPP PP PP PP + T + A +P L Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLIEEAQSSPALGGCR 554 Query: 298 SAEGWFTLT---PLPLLEHS 248 ++T P P+ EHS Sbjct: 555 RPVMTVSITSHIPRPIPEHS 574 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +PP P PP PPPPPPPPPPP PP PP PP Sbjct: 487 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 [70][TOP] >UniRef100_Q9Q5L3 EBNA-2 n=1 Tax=Macacine herpesvirus 4 RepID=Q9Q5L3_9GAMA Length = 605 Score = 57.4 bits (137), Expect = 6e-07 Identities = 31/62 (50%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Frame = -3 Query: 460 GNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK---LGTSTKADRADDNPNLPSLPSAE 290 G PP P PPLPPPPPPP PPP PP+ P PP+ +GT + D D NP SA Sbjct: 63 GAPPPPPPPPPLPPPPPPPLPPPPPPPVQPPPPERRDVGTQ-EPDPRDRNPLGGPGGSAV 121 Query: 289 GW 284 W Sbjct: 122 SW 123 [71][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/46 (56%), Positives = 27/46 (58%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPN 314 P P PP PPPPPPPPPPP PP PP PP + TS K A N Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVETSPKIVLAGTTAN 513 [72][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -3 Query: 469 SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 S S PP P PP PPPPPPPPPPP PP PP PP Sbjct: 84 SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPP 119 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PPS P PP PPP PPPPPPP PP PP+PP Sbjct: 82 PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPP 112 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 PP V P PP PPPPPPPP PP PP PP PP PN P P Sbjct: 92 PPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/52 (48%), Positives = 28/52 (53%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 PP P PP PPPPPPPPPPP PP PP PP + + P+ P P Sbjct: 118 PPPPPPSPP-PPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSP 168 [73][TOP] >UniRef100_A8IC93 Heavy metal transporting ATPase n=1 Tax=Chlamydomonas reinhardtii RepID=A8IC93_CHLRE Length = 1086 Score = 57.4 bits (137), Expect = 6e-07 Identities = 45/113 (39%), Positives = 57/113 (50%), Gaps = 1/113 (0%) Frame = +3 Query: 174 RTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSS-ALSAFVL 350 R AR ALV A S P ++ + Q +S + V L F +S A +A V Sbjct: 24 RRARPALVTLA-VSCPGNNTSLQSQPQHASWAQKFVRATVVATTLQFFAAASHAANASV- 81 Query: 351 VPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQTDGGLPLPLYELAEESSDEKEK 509 GG G GG+RGGGGGG GGGG G + GG P L ++AE SSD E+ Sbjct: 82 ---GGGIGAGGGHRGGGGGG-GGGGDGHSSMSHGGSPTVLGDIAEASSDLVEE 130 [74][TOP] >UniRef100_A4LAN9 Androgen receptor n=1 Tax=Saimiri boliviensis RepID=A4LAN9_9PRIM Length = 918 Score = 57.4 bits (137), Expect = 6e-07 Identities = 39/102 (38%), Positives = 47/102 (46%), Gaps = 4/102 (3%) Frame = +3 Query: 204 AHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSSALSAFVLVPNFGGFGGNG 383 A A+Q + A ++GSG PSA L +A + P GG GG G Sbjct: 395 AAAAQCRYGDLASLHGAGAAGSGSG--SPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGG 452 Query: 384 GNRGGGGGGGGGGGSGGQGQTDG----GLPLPLYELAEESSD 497 G GGGGGGGGGGG GG G+ G P P LA + D Sbjct: 453 GGGGGGGGGGGGGGGGGGGEAGAVDPYGYPRPPQGLASQEGD 494 [75][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 57.4 bits (137), Expect = 6e-07 Identities = 33/89 (37%), Positives = 38/89 (42%), Gaps = 11/89 (12%) Frame = -3 Query: 520 SFCCFSFSSLDSSASS*SGSGNP-PSVC----------PCPPLPPPPPPPPPPPRLPPLP 374 S C + +L + +G P P+VC P PP PPPPPPPPPPP PP P Sbjct: 13 SIACTNAKTLHDTIKRQAGCAAPCPAVCAPACQPICCVPAPPPPPPPPPPPPPPPPPPPP 72 Query: 373 PNPPKLGTSTKADRADDNPNLPSLPSAEG 287 P PP NP P P G Sbjct: 73 PPPP---PPPPQQPLPGNPGPPGRPGPAG 98 [76][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 57.4 bits (137), Expect = 6e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP PP PP PP+L Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQL 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 [77][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 57.4 bits (137), Expect = 6e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 113 PPIFTPAPPPPPPPPPPPPPPPPPPPPPPPP 143 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/63 (44%), Positives = 31/63 (49%), Gaps = 12/63 (19%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP------------NLP 308 P P PP PPPPPPPPPPP PP PP P+ T + NP NLP Sbjct: 120 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPRFTTRGVSFPPHGNPYPYPPRTPRPIFNLP 179 Query: 307 SLP 299 +LP Sbjct: 180 TLP 182 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 P+ P PP PPPPPPPPPPP PP PP PP Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 147 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 PP P PP PPPPPPPPPPP PP PP P Sbjct: 120 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTP 149 [78][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 57.4 bits (137), Expect = 6e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 113 PPIFTPAPPPPPPPPPPPPPPPPPPPPPPPP 143 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/67 (44%), Positives = 33/67 (49%), Gaps = 15/67 (22%) Frame = -3 Query: 454 PPSV---CPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP----------- 317 PP + P PP PPPPPPPPPPP PP PP PP T + NP Sbjct: 112 PPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPLFTTRGVSFPPHGNPYPYPPRTPRPI 171 Query: 316 -NLPSLP 299 NLP+LP Sbjct: 172 FNLPTLP 178 [79][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/49 (53%), Positives = 28/49 (57%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 308 PP P PP PPPPPPPPPPP PP PP PP RA + N+P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNIP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -3 Query: 448 SVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 S+ P PP PPPPPPPPPPP PP PP PP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPP 34 [80][TOP] >UniRef100_UPI0001926BC7 PREDICTED: similar to mini-collagen isoform 3 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC7 Length = 148 Score = 57.0 bits (136), Expect = 8e-07 Identities = 30/66 (45%), Positives = 32/66 (48%), Gaps = 7/66 (10%) Frame = -3 Query: 463 SGNPPSVCP-------CPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPS 305 SG+ P+VC C P PPPPPPPPPPP PP PP PP L NP P Sbjct: 32 SGDCPAVCAPACLPICCVPPPPPPPPPPPPPPPPPPPPPPPPL-------PLPGNPGPPG 84 Query: 304 LPSAEG 287 P G Sbjct: 85 RPGPPG 90 [81][TOP] >UniRef100_UPI0000F2B430 PREDICTED: similar to SRY (sex determining region Y)-box 30 n=1 Tax=Monodelphis domestica RepID=UPI0000F2B430 Length = 844 Score = 57.0 bits (136), Expect = 8e-07 Identities = 35/75 (46%), Positives = 37/75 (49%), Gaps = 16/75 (21%) Frame = -3 Query: 469 SGSGNPPS---VCPCPPL---------PPPPPPPPPPPRLPPLPPNPPKL----GTSTKA 338 SG+G PP C P L PPPPPPP PPP PPLPP PP L A Sbjct: 88 SGAGGPPPRGPACAAPRLLLQVKAEQPPPPPPPPLPPPPPPPLPPPPPLLFLHPTPHPAA 147 Query: 337 DRADDNPNLPSLPSA 293 + A P LPS PSA Sbjct: 148 EEAATPPLLPSHPSA 162 [82][TOP] >UniRef100_A0YMD7 Putative uncharacterized protein n=1 Tax=Lyngbya sp. PCC 8106 RepID=A0YMD7_9CYAN Length = 1010 Score = 57.0 bits (136), Expect = 8e-07 Identities = 33/72 (45%), Positives = 36/72 (50%), Gaps = 11/72 (15%) Frame = +3 Query: 258 SSGSGVSVNQPSALGRLGKFGLSSALSAF-----------VLVPNFGGFGGNGGNRGGGG 404 S G+G S P+ G G GL + A V PN GG GGNGG G GG Sbjct: 181 SGGNGASDQTPAGSGEAGSGGLFATGGASGGGGGGGGGEAVSFPNAGGQGGNGGAGGFGG 240 Query: 405 GGGGGGGSGGQG 440 GGGGGGG GG G Sbjct: 241 GGGGGGGGGGGG 252 [83][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/50 (52%), Positives = 28/50 (56%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPS 305 PP P PP PPPPPPPPPPP PP PP PP + A+ P PS Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILPAPANRAPPAPS 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [84][TOP] >UniRef100_A4S6G3 Predicted protein (Fragment) n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S6G3_OSTLU Length = 2146 Score = 57.0 bits (136), Expect = 8e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 S +PPS P PP+P PPPP PPPP PPLPP PP Sbjct: 927 SPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPP 960 [85][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 57.0 bits (136), Expect = 8e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPP PPPPPPP PP PPNPP Sbjct: 312 PPPPLPSPPPPPPTPPPPPPPPPPPPPPNPP 342 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/56 (48%), Positives = 29/56 (51%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 290 +PP P PPLP PPPPPP PP PP PP PP PN P +P AE Sbjct: 306 SPPPPPPPPPLPSPPPPPPTPPPPPPPPPPPPP-------------PNPPFIPPAE 348 [86][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 57.0 bits (136), Expect = 8e-07 Identities = 34/87 (39%), Positives = 39/87 (44%), Gaps = 12/87 (13%) Frame = -3 Query: 514 CCFSFSS------------LDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPP 371 CCF SS +++A+S + PP P PP PPPPPPPPPPP PP PP Sbjct: 321 CCFKTSSDATTPTLVTGGTQENNATSDAPKLMPP---PPPPPPPPPPPPPPPPPRPPPPP 377 Query: 370 NPPKLGTSTKADRADDNPNLPSLPSAE 290 P K G A P L E Sbjct: 378 PPIKKGAPPPAPPKATMARFPKLSPTE 404 [87][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA 329 P PP PPPPPPPPPPP PP PP PP STK +A Sbjct: 346 PPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPASTKPPQA 386 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGT 350 P + P PP PPPPPPPPPPP PP PP PP T Sbjct: 347 PAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPAST 381 [88][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 56.6 bits (135), Expect = 1e-06 Identities = 30/67 (44%), Positives = 36/67 (53%) Frame = -3 Query: 499 SSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDN 320 S+++S S P S P PP P PPPPPPPPP PP PP PP L + +N Sbjct: 316 STVESPPKISSAFLKPVSAPPPPPPPRPPPPPPPPPPPPPPPPPPPAL-------KNVEN 368 Query: 319 PNLPSLP 299 P +PS P Sbjct: 369 PMIPSPP 375 [89][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 56.6 bits (135), Expect = 1e-06 Identities = 34/77 (44%), Positives = 39/77 (50%), Gaps = 9/77 (11%) Frame = -3 Query: 502 FSSLDSSASS*SGSG--------NPPSVCPCPPLPPPPPPPPPP-PRLPPLPPNPPKLGT 350 FSS S++ S S G PPS+ P PP PPPPPPPPP P+ P PP PP Sbjct: 673 FSSSSSTSRSSSSHGVPPPHPPPPPPSLAPKPPSAPPPPPPPPPAPKPPGAPPPPPPPPP 732 Query: 349 STKADRADDNPNLPSLP 299 +TK A P P P Sbjct: 733 TTKPLGAHPPPPPPPPP 749 [90][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 4/50 (8%) Frame = -3 Query: 499 SSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRL----PPLPPNPP 362 S L S+S +G + PS P PP PPPPPPPPPPP L PP+PP PP Sbjct: 535 SPLLGSSSVENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 584 [91][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 4/50 (8%) Frame = -3 Query: 499 SSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRL----PPLPPNPP 362 S L S+S +G + PS P PP PPPPPPPPPPP L PP+PP PP Sbjct: 547 SPLLGSSSVENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 596 [92][TOP] >UniRef100_O22459 Hydroxyproline-rich glycoprotein gas29p n=1 Tax=Chlamydomonas reinhardtii RepID=O22459_CHLRE Length = 433 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 P S P PP PPPPPPPPPPP LPP P PP Sbjct: 49 PQSPSPPPPPPPPPPPPPPPPPLPPFPAKPP 79 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 +PP P PP PPPPPPPPPPP PPLPP P K Sbjct: 46 SPPPQSPSPP-PPPPPPPPPPPPPPPLPPFPAK 77 [93][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPTPPPPPPRPP 449 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPP PP PP PP+PP Sbjct: 422 PPPPPPPPPPPPPPPPPPTPPPPPPRPPSPP 452 [94][TOP] >UniRef100_C5WQ18 Putative uncharacterized protein Sb01g039800 n=1 Tax=Sorghum bicolor RepID=C5WQ18_SORBI Length = 850 Score = 56.6 bits (135), Expect = 1e-06 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 4/142 (2%) Frame = +3 Query: 108 HLIMQGLKATPGLRASSGRPTLRTARTALVVRAHAS---QPSSSNHAEQQECSSSGSGVS 278 H Q L +P + RP R ++ +RA AS QP S + Sbjct: 40 HHAGQALSISPARYEPAARPP-RGGSSSSAIRAAASAGAQPGSDPVPAEPRIELPAIFTV 98 Query: 279 VNQPSALGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQTDGGL 458 ++ + G F ++S+ +AF+L +FGGFGG G GGGGGGGG G+GG G GG Sbjct: 99 FSEAAKTG--AAFFIASSGAAFLL-GSFGGFGGGAGGLFGGGGGGGGWGAGGAGGGGGGD 155 Query: 459 PLP-LYELAEESSDEKEKQQKD 521 L L+ + +D+K D Sbjct: 156 FLSRLFSVGAAHADDKSSGDWD 177 [95][TOP] >UniRef100_A7XYI3 JXC1 n=1 Tax=Monodelphis domestica RepID=A7XYI3_MONDO Length = 918 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/55 (47%), Positives = 31/55 (56%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 290 PP + P PLPPPPPPPPPP PP PP PP S K + + P + L S + Sbjct: 766 PPPLLPPLPLPPPPPPPPPP---PPPPPPPPPAPASQKKSQQPEEPAVSELESVK 817 [96][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLG 353 PP P PPLPPPPPPPPP P PP PP PP +G Sbjct: 1215 PPPPPPPPPLPPPPPPPPPLPPPPPPPPPPPPVG 1248 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/35 (68%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPP----PPPPPRLPPLPPNPP 362 PP P PPLPPPPPP PPPPP PPLPP PP Sbjct: 1205 PPLTPPPPPLPPPPPPPPPLPPPPPPPPPLPPPPP 1239 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/32 (71%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPP-PPPPPPPPRLPPLPPNPP 362 PP + P PP PPP PPPPPPPP LPP PP PP Sbjct: 1211 PPPLPPPPPPPPPLPPPPPPPPPLPPPPPPPP 1242 [97][TOP] >UniRef100_Q20327 Ground-like (Grd related) protein 4 n=1 Tax=Caenorhabditis elegans RepID=Q20327_CAEEL Length = 210 Score = 56.6 bits (135), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP CP PP+ PPPPPPPPPP PP PP P Sbjct: 52 PPQFCPPPPMCPPPPPPPPPPMCPPPPPPMP 82 [98][TOP] >UniRef100_C4QFT9 Diaphanous, putative n=1 Tax=Schistosoma mansoni RepID=C4QFT9_SCHMA Length = 1068 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGT 350 SL SS G PP + PP PPPPPPPPPPP + +PP PP +G+ Sbjct: 485 SLSSSIPPPPGIPPPPPMEGVPPPPPPPPPPPPPPPMGGIPPPPPPMGS 533 [99][TOP] >UniRef100_C0SUE0 Ecdysone receptor A isoform n=1 Tax=Apis mellifera RepID=C0SUE0_APIME Length = 629 Score = 56.6 bits (135), Expect = 1e-06 Identities = 35/84 (41%), Positives = 43/84 (51%) Frame = +3 Query: 204 AHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSSALSAFVLVPNFGGFGGNG 383 AH Q +SN+ S+S S + S ++G+ LS S + GG GG G Sbjct: 145 AHQQQQPNSNNGYASPMSTS----SYDPYSPNSKIGRDELSQPGSLNGYGSSGGGGGGGG 200 Query: 384 GNRGGGGGGGGGGGSGGQGQTDGG 455 G GGGGGGGGGGG GG G GG Sbjct: 201 GGGGGGGGGGGGGGGGGGGGGGGG 224 [100][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 39 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA 329 PP P PP PPPPPPPPPPP PP PP PP +A A Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPSA 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 [101][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [102][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -3 Query: 466 GSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 341 G G P PP PPPPPPPPPPP PP PP PPK + TK Sbjct: 33 GGGKKQEQAPPPPPPPPPPPPPPPPP-PPPPPPPPKKTSDTK 73 [103][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 PP P PP PPPPPPPPPPP PPLPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 100 [104][TOP] >UniRef100_UPI000184A1A2 Zinc finger protein ZIC 5 (Zinc finger protein of the cerebellum 5). n=2 Tax=Canis lupus familiaris RepID=UPI000184A1A2 Length = 668 Score = 51.2 bits (121), Expect(2) = 1e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKAD 335 S PP P PPLPP P PPPPP PP PP PP L T D Sbjct: 148 SAPPP---PAPPLPPSPSPPPPPSPPPPPPPPPPALSGYTTTD 187 Score = 25.0 bits (53), Expect(2) = 1e-06 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 519 PSAASPSRRWTPRQARRAAVAIRHPSA 439 PS A P++ P A RAA + HP A Sbjct: 107 PSQALPAQPEAPAAAARAAASDTHPGA 133 [105][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 PP P PP PPPPPPPPPPP PP PP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [106][TOP] >UniRef100_UPI0000DB6DA2 PREDICTED: similar to CG5921-PB, isoform B n=1 Tax=Apis mellifera RepID=UPI0000DB6DA2 Length = 913 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/66 (39%), Positives = 37/66 (56%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 275 PP++ P PP PP PP PP PP P PP PP L +K ++D+ + S+ S + Sbjct: 665 PPTIPPAPPAPPAPPAPPAPPAPPSAPPAPPPLPLPSKPKCSEDSVEMQSIESFK--LKE 722 Query: 274 TPLPLL 257 TP P++ Sbjct: 723 TPNPVI 728 [107][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 1472 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 1504 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/48 (50%), Positives = 25/48 (52%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 311 PP P PP PPPPPPPPPPP PPLP P K + P L Sbjct: 1479 PPPPPPPPPPPPPPPPPPPPPPPPPLPRTPRGGKRKHKQQQQQQQPQL 1526 [108][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/49 (51%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPL-PPNPPKLGTSTKADRADDNPN 314 +PP+ P PP PPPPPPPPPPP PP PP PP T PN Sbjct: 88 SPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTPPPTPPPTPPPTPPPTPN 136 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PS PP PPPPPPPPPPP PP PP PP Sbjct: 87 PSPPTAPPQPPPPPPPPPPPPPPPPPPTPP 116 [109][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 469 SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 S S +PP P PP PPPPPPPPPPP P PNPP Sbjct: 201 SASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPP 236 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -3 Query: 487 SSASS*SGSGNPPSVCPCPP--LPPPPPPPPPPPRLPPLPPNPP 362 S SS S + PPS P PP PPPP PPPPPP PP PP+PP Sbjct: 188 SPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPP 231 Score = 53.5 bits (127), Expect = 9e-06 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 +PP P PP PPPP PPP PP LPP P PP S +P+ PS P Sbjct: 21 SPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPP 73 Score = 53.5 bits (127), Expect = 9e-06 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 +PPS P PP P PPPP PPPP PP P PP S + +P PS P Sbjct: 86 SPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPP 138 [110][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/58 (48%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP--NLPSLPSAEG 287 PP P PP PPPPPPPPPPP PP PP PP + D P P S EG Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPPVTTAPGSNSVEG 384 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 [111][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTS 347 PPS P PP PPPPPPPPPP PP PP PP G S Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPS 537 Score = 53.5 bits (127), Expect = 9e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 466 GSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 G PP P PP PPPPPPP PPP PP PP PP Sbjct: 483 GVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPP 517 [112][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -3 Query: 466 GSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 G PP P PP PPPPPPPPPPP PP PP PP Sbjct: 220 GGEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -3 Query: 460 GNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGT 350 G P P PP PPPPPPPPPPP PP PP PP T Sbjct: 221 GEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCNT 257 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -3 Query: 466 GSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLG 353 G PP P PP PPPPPPPPPPP PP PP P G Sbjct: 221 GEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCNTG 258 [113][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 237 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPP PPPP PP PP+PP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 242 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPP PPPP PP PP+PP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 254 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 PP P PP PPPPPPPPPPP PP PP P Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 [114][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 272 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PPS P PP PPPPPPP PPP PP PP PP Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPP 261 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 PPS P PP PPPPPPPPPPP PP PP P Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PPS P PP PPPPPPPPPPP PP PP+PP Sbjct: 250 PPS--PPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPP PP PP PP Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPP 257 [115][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/53 (50%), Positives = 28/53 (52%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 296 PPS P PP PPP P PPPPP PP PP PP S A P P+ PS Sbjct: 2124 PPSPPPPPPSPPPAPLPPPPPSPPPSPPPPPSPPPSPPAPPPHPPPEPPAPPS 2176 [116][TOP] >UniRef100_A2XDP2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XDP2_ORYSI Length = 820 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 6/56 (10%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRL------PPLPPNPPKLGTSTKADRADDNPNLPS 305 P + P PP PPPPPPPPPPP+L PP PP PP + ++ + + P +P+ Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEPPAVPT 400 Score = 53.5 bits (127), Expect = 9e-06 Identities = 28/52 (53%), Positives = 30/52 (57%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 296 PS P P PPPPPPPPP PP PP PPKL T+ K P PS+PS Sbjct: 338 PSPRPVQPSNAPPPPPPPPP--PPPPPPPPKLNTAPKPPPPPPPP--PSVPS 385 [117][TOP] >UniRef100_Q5CLH8 Protease n=1 Tax=Cryptosporidium hominis RepID=Q5CLH8_CRYHO Length = 1569 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 32/55 (58%), Gaps = 12/55 (21%) Frame = -3 Query: 490 DSSASS*SGSGNPP-----SVCPCPPLPPPPPPPP-------PPPRLPPLPPNPP 362 + S S+ SGS +PP S P PP PPPPPPPP PPP PPLPP PP Sbjct: 1510 NGSPSAGSGSNSPPLPPPSSSSPSPPPPPPPPPPPPSSSSPSPPPPPPPLPPPPP 1564 [118][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -3 Query: 493 LDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 L S ++ S PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 LQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [119][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLG 353 PP P PP PPPPPPPPPPP PP PP PP G Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 80 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLG 353 PP P PP PPPPPPPPPPP PP PP PP G Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGG 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 [120][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [121][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 114 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 [122][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/62 (50%), Positives = 34/62 (54%) Frame = -3 Query: 484 SASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPS 305 SA +G+ PP P PPLPPPPPPPPPPP PP PP PP L + P LP Sbjct: 460 SAIPHAGASLPPP--PPPPLPPPPPPPPPPP--PPPPPPPPALDVG-ETSSLQPPPPLPP 514 Query: 304 LP 299 P Sbjct: 515 PP 516 [123][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -3 Query: 469 SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +G G PP P PP PPPPPPPPPPP PP PP PP Sbjct: 266 TGPGPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPP 299 [124][TOP] >UniRef100_Q0GNC1-3 Isoform 2 of Inverted formin-2 n=1 Tax=Mus musculus RepID=Q0GNC1-3 Length = 1264 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/88 (38%), Positives = 46/88 (52%), Gaps = 8/88 (9%) Frame = -3 Query: 469 SGSGNPPSVCPCPPLP------PPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 308 +G+ +PP P P LP PPPPPPPP P + P+PP PP +A + P LP Sbjct: 503 TGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPPPPP----LPRAGQIPPPPPLP 558 Query: 307 --SLPSAEGWFTLTPLPLLEHSCCSAWL 230 S+PS G + ++HS SAW+ Sbjct: 559 GFSVPSMMGGVEEIIVAQVDHSLGSAWV 586 [125][TOP] >UniRef100_Q0GNC1 Inverted formin-2 n=1 Tax=Mus musculus RepID=INF2_MOUSE Length = 1273 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/88 (38%), Positives = 46/88 (52%), Gaps = 8/88 (9%) Frame = -3 Query: 469 SGSGNPPSVCPCPPLP------PPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 308 +G+ +PP P P LP PPPPPPPP P + P+PP PP +A + P LP Sbjct: 503 TGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPPPPP----LPRAGQIPPPPPLP 558 Query: 307 --SLPSAEGWFTLTPLPLLEHSCCSAWL 230 S+PS G + ++HS SAW+ Sbjct: 559 GFSVPSMMGGVEEIIVAQVDHSLGSAWV 586 [126][TOP] >UniRef100_Q10Q99 Formin-like protein 8 n=1 Tax=Oryza sativa Japonica Group RepID=FH8_ORYSJ Length = 892 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 6/56 (10%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRL------PPLPPNPPKLGTSTKADRADDNPNLPS 305 P + P PP PPPPPPPPPPP+L PP PP PP + ++ + + P +P+ Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEPPAVPT 400 Score = 53.5 bits (127), Expect = 9e-06 Identities = 28/52 (53%), Positives = 30/52 (57%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 296 PS P P PPPPPPPPP PP PP PPKL T+ K P PS+PS Sbjct: 338 PSPRPVQPSNAPPPPPPPPP--PPPPPPPPKLNTAPKPPPPPPPP--PSVPS 385 [127][TOP] >UniRef100_UPI000176023F PREDICTED: similar to protein kinase beta like (3E511) n=1 Tax=Danio rerio RepID=UPI000176023F Length = 639 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = -3 Query: 490 DSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 ++ SS S SG P P PP PPP PPPPPPP PP PP PP Sbjct: 335 EARTSSDSASGPSPGTAP-PPAPPPQPPPPPPPPPPPPPPPPP 376 [128][TOP] >UniRef100_UPI0001661EAE PREDICTED: similar to Putative acrosin-like protease n=1 Tax=Homo sapiens RepID=UPI0001661EAE Length = 355 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTST 344 PP+ P PP PPPPPPPPP LPP PP PP +ST Sbjct: 273 PPAAQPRPPPSPPPPPPPPPSPLPPPPPPPPPTPSST 309 [129][TOP] >UniRef100_UPI0000E24D2B PREDICTED: SET binding protein 1 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E24D2B Length = 1596 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/45 (53%), Positives = 28/45 (62%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 PPLPPPPPPP PPP PPLPP PP L + + + P P+ P Sbjct: 1520 PPLPPPPPPPLPPPPPPPLPP-PPPLPKTPRGGKRKHKPQAPAQP 1563 [130][TOP] >UniRef100_UPI00005A3429 PREDICTED: similar to hemojuvelin isoform a isoform 1 n=1 Tax=Canis lupus familiaris RepID=UPI00005A3429 Length = 469 Score = 55.8 bits (133), Expect = 2e-06 Identities = 38/105 (36%), Positives = 43/105 (40%) Frame = +3 Query: 138 PGLRASSGRPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKF 317 PG PTL T L++ HA + SS+ S P AL G Sbjct: 4 PGWSPHGSPPTLSTLTLLLLLCGHAHSQCKILRCNAEYVSSTLSLRGGGSPGALRGGGGG 63 Query: 318 GLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQTDG 452 G GG GG GG RGGGGGGGG GG+GG G G Sbjct: 64 G------------GGGGGGGGGGRRGGGGGGGGAGGAGGAGGAGG 96 [131][TOP] >UniRef100_UPI000069FBE2 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE2 Length = 980 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = -3 Query: 490 DSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRL----PPLPPNPP 362 D S +G + PS P PP PPPPPPPPPPP L PP+PP PP Sbjct: 437 DGDISMENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 483 [132][TOP] >UniRef100_Q9Y6X0 SET-binding protein n=2 Tax=Homo sapiens RepID=SETBP_HUMAN Length = 1542 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/45 (53%), Positives = 28/45 (62%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 PPLPPPPPPP PPP PPLPP PP L + + + P P+ P Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPP-PPPLPKTPRGGKRKHKPQAPAQP 1509 [133][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +PP P PPLPPPPPPPPPP PP PP PP Sbjct: 204 SPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPP 235 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/56 (44%), Positives = 28/56 (50%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 287 PP P PP PPPPP PPPP PP PP+PP + P P LP+ G Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPTG 265 [134][TOP] >UniRef100_Q2RTE8 Putative uncharacterized protein n=1 Tax=Rhodospirillum rubrum ATCC 11170 RepID=Q2RTE8_RHORT Length = 208 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADD 323 P P PP PPPPPPPPPPP PP PP PP + + D D+ Sbjct: 87 PEPEPEPPPPPPPPPPPPPPPPPPPPPEPPPFVSEIEDDPVDE 129 [135][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +PP P PP PPPPPPPPPPP PP PP PP Sbjct: 305 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 [136][TOP] >UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia MC0-3 RepID=B1JXE0_BURCC Length = 505 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 GG GGNGGN GGGGGGGGGGG GG G GG Sbjct: 360 GGAGGNGGNGGGGGGGGGGGGGGGGGGGGGG 390 [137][TOP] >UniRef100_Q08RT8 Putative uncharacterized protein n=1 Tax=Stigmatella aurantiaca DW4/3-1 RepID=Q08RT8_STIAU Length = 909 Score = 55.8 bits (133), Expect = 2e-06 Identities = 37/100 (37%), Positives = 48/100 (48%), Gaps = 8/100 (8%) Frame = +3 Query: 180 ARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSS-------ALS 338 A + +R +ASQ + E +G+G S P G S+ + S Sbjct: 240 APSGATIRVYASQNCTGAEVASGE---AGAGNSCEIPIYTPGYTSGGYSARSYNGAGSAS 296 Query: 339 AFVLVPNFGGFGGNGG-NRGGGGGGGGGGGSGGQGQTDGG 455 +P++GG GG G GGGGGGGGGGG GGQG DGG Sbjct: 297 GCASIPSYGGGGGGGSCGGGGGGGGGGGGGYGGQGYGDGG 336 [138][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/53 (49%), Positives = 29/53 (54%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 296 PP + P PP PPP PPPPPPP PP PPNPP + P+ P PS Sbjct: 792 PPPLPPSPP-PPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPS 843 [139][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/46 (52%), Positives = 26/46 (56%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 317 PP P PP PPPPPPPPPPP PP PP PP T ++ P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPCCEKCRRGP 127 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 445 VCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 V P PP PPPPPPPPPPP PP PP PP Sbjct: 75 VIPPPPPPPPPPPPPPPPPPPPPPPPPP 102 [140][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLG 353 PP P PP PPPPPPPPPPP PP PP PP G Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPG 118 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 [141][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 [142][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 [143][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PP P PP PPPPPPPPPPP PP PP PP+ Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPE 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKAD 335 PP P PP PPPPPPPPPPP PP PP P +AD Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQAD 42 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 439 PCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 308 P PP PPPPPPPPPPP PP PP PP + + D P +P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQADPPAVP 47 [144][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP PP PP PP + Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHI 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [145][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/35 (68%), Positives = 25/35 (71%), Gaps = 4/35 (11%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPP----PPPPPRLPPLPPNPP 362 PPS+ P PP PPPPPP PPPPP LPP PP PP Sbjct: 265 PPSLPPQPPPPPPPPPPLPPPPPPPPLPPQPPPPP 299 [146][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/58 (48%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = -3 Query: 523 SSFCCFSFSSLDSSASS*SGSGNPPSVCPC----PPLPPPPPPPPPPPRLPPLPPNPP 362 S FCC F P VC C PP PPPPPPPPPPP PP PP PP Sbjct: 20 SYFCCVPFL---------------PFVCQCLCCPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.8 bits (133), Expect = 2e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 442 CPCPPLPPPPPPPPPPPRLPPLPPNPP 362 CP PP PPPPPPPPPPP PP PP PP Sbjct: 37 CPPPPPPPPPPPPPPPPPPPPPPPPPP 63 [147][TOP] >UniRef100_A7F1V6 Putative uncharacterized protein n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7F1V6_SCLS1 Length = 644 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 3/92 (3%) Frame = +3 Query: 258 SSGSGVSVNQPSALGRLGK---FGLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGS 428 SS +G+ P+A+ R G F + S GG GG GG GGGGGGGGGGG Sbjct: 199 SSATGIFSVAPAAMDRKGGMDGFAIGSTRGG----GGGGGGGGFGGGGGGGGGGGGGGGG 254 Query: 429 GGQGQTDGGLPLPLYELAEESSDEKEKQQKDD 524 GG G +GG+ + L+ E+S + + D+ Sbjct: 255 GGSGSGNGGVNV----LSAENSSTFDPEYPDE 282 [148][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 +G PP + P PP PPPPPPPPPPP PP PP P Sbjct: 56 TGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.5 bits (127), Expect = 9e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPP 362 PPLPPPPPPPPPPP PP PP PP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.5 bits (127), Expect = 9e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP+PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPP--PPPPPSPP 91 [149][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 448 SVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 S P PP PPPPPPPPPPP PP PP PPK Sbjct: 143 SQTPPPPPPPPPPPPPPPPPPPPPPPKPPK 172 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/73 (41%), Positives = 34/73 (46%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 275 PP P PP PPPPPPPPPPP PPL P PP S+ P +P P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPLLPPPPPPSISSFLVPPQSCP-IPCSPQC------ 479 Query: 274 TPLPLLEHSCCSA 236 P +CCS+ Sbjct: 480 --APSCSENCCSS 490 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 P + P PP PPPPPPPPPPP PP PP PP L Sbjct: 422 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPLL 453 Score = 54.3 bits (129), Expect = 5e-06 Identities = 30/60 (50%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Frame = -3 Query: 520 SFCC-----FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 SFCC F S S + PP P PP PPPPPPPPPPP PP PP PP L Sbjct: 395 SFCCKPLPQFYSQSQPSLPFAPLPQIQPPLPPPPPPPPPPPPPPPPPP--PPPPPPPPPL 452 [150][TOP] >UniRef100_UPI00017974C7 PREDICTED: similar to KIAA1902 protein n=1 Tax=Equus caballus RepID=UPI00017974C7 Length = 1089 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/70 (41%), Positives = 34/70 (48%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 317 +L S+ + N P+ P PP PPPPPPPPPPP PP PP P + A P Sbjct: 528 ALPPSSDTPEAVQNGPATPPMPPPPPPPPPPPPPPPPPPPPPLPGPAADTVPAPPLPPPP 587 Query: 316 NLPSLPSAEG 287 PS P G Sbjct: 588 P-PSAPPLPG 596 [151][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2324 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [152][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2324 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [153][TOP] >UniRef100_UPI0000E48C90 PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E48C90 Length = 200 Score = 55.5 bits (132), Expect = 2e-06 Identities = 38/115 (33%), Positives = 49/115 (42%), Gaps = 11/115 (9%) Frame = +3 Query: 210 ASQPSSSNHAEQQECSSSG------SGVSVNQPSALGRLGKFGLSSALSAFVLVPNFGGF 371 ++Q ++ + C S G +G++ L FG SA + G Sbjct: 35 SNQRNAGTGGGEGRCGSDGVTIAMSNGITRTNNIPLNGNATFGFGSAGGGLDEIGLDGHD 94 Query: 372 GGNGGNRG-----GGGGGGGGGGSGGQGQTDGGLPLPLYELAEESSDEKEKQQKD 521 GG GG RG GGGGGGGGGG GG G DGG E D K++ KD Sbjct: 95 GGGGGGRGSGGGGGGGGGGGGGGGGGDGDGDGG-----GRRGRERRDRKKRSSKD 144 [154][TOP] >UniRef100_UPI0000DA3CD5 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3CD5 Length = 311 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/79 (41%), Positives = 37/79 (46%), Gaps = 18/79 (22%) Frame = +3 Query: 273 VSVNQPSALGRLGKFGLSSALSAF------------------VLVPNFGGFGGNGGNRGG 398 V +P +G + GL S + AF V VP GG GG GG GG Sbjct: 131 VDPKKPEFIGTVRASGLPSHVLAFFWKQEVCFPVIYRIKGCSVRVPGRGGGGGGGGGGGG 190 Query: 399 GGGGGGGGGSGGQGQTDGG 455 GGGGGGGGG GG G GG Sbjct: 191 GGGGGGGGGGGGGGGGGGG 209 Score = 53.5 bits (127), Expect = 9e-06 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGGLPLPLYELAEES 491 GG GG GG GGGGGGGGGGG GG G++ GG + +EES Sbjct: 206 GGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGRGILLSSEES 248 [155][TOP] >UniRef100_UPI00005A3937 PREDICTED: similar to formin-like 2 isoform B n=1 Tax=Canis lupus familiaris RepID=UPI00005A3937 Length = 1119 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/47 (55%), Positives = 29/47 (61%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP G + + A P P PSA Sbjct: 576 PPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLPP-PPPPSA 621 [156][TOP] >UniRef100_UPI0001B7C13A Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C13A Length = 4226 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 1482 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 1524 [157][TOP] >UniRef100_UPI0001B7C139 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C139 Length = 4330 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 1478 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 1520 [158][TOP] >UniRef100_UPI0001B7C138 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C138 Length = 4129 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 1478 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 1520 [159][TOP] >UniRef100_UPI0001B7A6BD enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6BD Length = 804 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 290 PP+ P P PPPPPPPPPPP PP PP PP S +A P P S PS++ Sbjct: 437 PPTSGPAAP-PPPPPPPPPPPPPPPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 492 [160][TOP] >UniRef100_UPI0001B7A6BC enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6BC Length = 808 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 290 PP+ P P PPPPPPPPPPP PP PP PP S +A P P S PS++ Sbjct: 441 PPTSGPAAP-PPPPPPPPPPPPPPPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 496 [161][TOP] >UniRef100_UPI0001B7A6A7 enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6A7 Length = 823 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 290 PP+ P P PPPPPPPPPPP PP PP PP S +A P P S PS++ Sbjct: 456 PPTSGPAAP-PPPPPPPPPPPPPPPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 511 [162][TOP] >UniRef100_UPI0000DC0B78 similar to Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (LOC307738), mRNA n=1 Tax=Rattus norvegicus RepID=UPI0000DC0B78 Length = 387 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/53 (49%), Positives = 32/53 (60%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 +PP P PP PPPP PPPPP P LPP+PP L +S + + P+ PS P Sbjct: 2 SPPPSSPPPPSPPPPLTPPPPP--PSLPPSPPPLLSSPPSPPSPPRPSSPSPP 52 [163][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2294 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [164][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2324 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [165][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2294 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [166][TOP] >UniRef100_UPI0001951250 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Canis lupus familiaris RepID=UPI0001951250 Length = 1052 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/47 (55%), Positives = 29/47 (61%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP G + + A P P PSA Sbjct: 509 PPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLPP-PPPPSA 554 Score = 53.9 bits (128), Expect = 7e-06 Identities = 27/57 (47%), Positives = 28/57 (49%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 287 N P P PP PPPPPPPPPPP PP PP P + A P PS P G Sbjct: 504 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLPPPPP-PSAPPLPG 559 [167][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/56 (46%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -3 Query: 454 PPSVCPCPPLP-----PPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSL 302 PP + P PP P PPPPPPPPPP PP PP PP + + D P PS+ Sbjct: 791 PPPLPPAPPQPAPAPTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVSLDLPLFPSI 846 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/52 (48%), Positives = 28/52 (53%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPS 296 P+ P PP PPPPPPPPPPP PP P PP++ D LP PS Sbjct: 801 PAPAPTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVSLD-------LPLFPS 845 [168][TOP] >UniRef100_UPI000179CB3D inverted formin 2 isoform 1 n=1 Tax=Bos taurus RepID=UPI000179CB3D Length = 1211 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/74 (44%), Positives = 34/74 (45%), Gaps = 11/74 (14%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPL-----------PPNPPKLGTSTKADRADDNPNLPS 305 P+ P PP PPPPPPPPPPP PPL PP PP L S A P P Sbjct: 429 PTTAPRPPPPPPPPPPPPPPPPPPLPGMRAAFPSPPPPPPPPLPNSAITIPAPPPPP-PP 487 Query: 304 LPSAEGWFTLTPLP 263 LP G PLP Sbjct: 488 LPGLGGPPPPPPLP 501 [169][TOP] >UniRef100_UPI0000ECBAD6 inverted formin 2 isoform 1 n=1 Tax=Gallus gallus RepID=UPI0000ECBAD6 Length = 1049 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/93 (35%), Positives = 38/93 (40%), Gaps = 12/93 (12%) Frame = -3 Query: 505 SFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP------------LPPNPP 362 S S L + +S S PP+ P P PPPPPPPPPPP LP LPP PP Sbjct: 405 SSSQLSACFTSPQTSNPPPNAAPALPPPPPPPPPPPPPPLPSGPAAMPPTASVNLPPAPP 464 Query: 361 KLGTSTKADRADDNPNLPSLPSAEGWFTLTPLP 263 G +P P G + P P Sbjct: 465 LPGIPPPPPPLPGMAVIPPPPPLPGMAVIPPPP 497 [170][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 311 PP P PP PPPPPPPPPPP PP PP P K+ D N L Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDPKSAAKDINAEL 91 [171][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 311 PP P PP PPPPPPPPPPP PP PP P K+ D N L Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDPKSAAKDINAEL 91 [172][TOP] >UniRef100_Q00X46 Chromosome 13 contig 1, DNA sequence n=1 Tax=Ostreococcus tauri RepID=Q00X46_OSTTA Length = 1990 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL 311 PPS P PP P PPPP PPPP PP P PP AD+ PNL Sbjct: 819 PPSPSPSPPPPSPPPPSPPPPSPPPPSPFPPPAPPPPSPPPADECPNL 866 [173][TOP] >UniRef100_C1E4Y1 Putative uncharacterized protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E4Y1_9CHLO Length = 1031 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 PS P PP PPPPPPPPPPPR P PPNPPK Sbjct: 463 PSRPPPPPPPPPPPPPPPPPR--PPPPNPPK 491 [174][TOP] >UniRef100_A9RV94 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RV94_PHYPA Length = 462 Score = 55.5 bits (132), Expect = 2e-06 Identities = 37/98 (37%), Positives = 43/98 (43%) Frame = +3 Query: 162 RPTLRTARTALVVRAHASQPSSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSSALSA 341 RP RT++ A +S+ S S+ Q SS G GK G Sbjct: 188 RPNQRTSKVAFGFGGFSSRSSLSSAGFQHRSSSGG--------------GKGG------- 226 Query: 342 FVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 GG GG GG GGGGGGGGGGG GG G + GG Sbjct: 227 ------GGGGGGGGGGGGGGGGGGGGGGGGGGGSSGGG 258 [175][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/56 (46%), Positives = 29/56 (51%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 290 +PP P PP PPPPPPP PPP PP PP PP +P P LP A+ Sbjct: 248 SPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPP------PPPPPSPSPPPPELPPAQ 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/55 (47%), Positives = 29/55 (52%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 290 PPS P PP PPPPPPPPPPP P PP P T A + P P P ++ Sbjct: 264 PPSPPPPPPPPPPPPPPPPPPSPSPPPPELPPAQPVTPARKRPPPPAPPPPPRSD 318 [176][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKL 356 PP P PP PPPPPPPPPPP PP PP P KL Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVKL 77 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 NP P PP PPPPPPPPPPP PP PP PP Sbjct: 42 NPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -3 Query: 448 SVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +V P PP PPPPPPPPPPP PP PP PP Sbjct: 40 AVNPAPPPPPPPPPPPPPPPPPPPPPPPP 68 [177][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 9/52 (17%) Frame = -3 Query: 487 SSASS*SGSGNPPSVCPCPPL---------PPPPPPPPPPPRLPPLPPNPPK 359 +SA S S S PP P PP PPPPPPPPPPP PP PP PPK Sbjct: 1511 ASAGSGSNSSPPPPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPPPPPPK 1562 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Frame = -3 Query: 484 SASS*SGSGNPPSVCPCPPLPP-------PPPPPPPPPRLPPLPPNPP 362 SAS+ SGS + P P PP PP PPPPPPPPP PP PP PP Sbjct: 1510 SASAGSGSNSSPPPPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPP 1557 [178][TOP] >UniRef100_Q5CHW4 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis RepID=Q5CHW4_CRYHO Length = 1042 Score = 55.5 bits (132), Expect = 2e-06 Identities = 41/107 (38%), Positives = 53/107 (49%), Gaps = 8/107 (7%) Frame = +3 Query: 210 ASQPSSSNHAEQ---QECSSSGSGVSVNQPSALGRLGKFGLSSALSAFVLVPNFGGFG-- 374 +S PSS+ A + ++ GS S + PS G LG G SA S+ G G Sbjct: 361 SSTPSSTGSAPTGAGKVSTTGGSSSSPSAPSGTGSLGGIG-GSATSSGAGGSGSGAGGSS 419 Query: 375 ---GNGGNRGGGGGGGGGGGSGGQGQTDGGLPLPLYELAEESSDEKE 506 G GG RGGGGGGGGGGG +G+ DG EE S++K+ Sbjct: 420 GGRGGGGRRGGGGGGGGGGGRRRRGRGDG---------KEEGSEDKD 457 [179][TOP] >UniRef100_C5K7W2 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5K7W2_9ALVE Length = 1971 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/64 (42%), Positives = 34/64 (53%) Frame = -3 Query: 493 LDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPN 314 + SS S + P+ P P PPPPPPPPPPP PP P +G +T +A+D P Sbjct: 1584 IPSSRSPATPKAKSPATSPPPVSPPPPPPPPPPP-----PPQEPPVGETTPPRQANDTPA 1638 Query: 313 LPSL 302 P L Sbjct: 1639 PPKL 1642 [180][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPPPPPPPPP PP PP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 341 PP P PP PPPPPPPPPPP PP PP P +L S + Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRR 48 [181][TOP] >UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA Length = 688 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/69 (40%), Positives = 33/69 (47%), Gaps = 5/69 (7%) Frame = -3 Query: 454 PPSVCPCPPLPPPP-----PPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 290 PP+ P PP PPPP PPPPPPP+ P PP PP + K P P P+A Sbjct: 207 PPAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPPTPPPTTPPPPTAP 266 Query: 289 GWFTLTPLP 263 P+P Sbjct: 267 PPPPSVPIP 275 [182][TOP] >UniRef100_B4MPK7 GK21581 n=1 Tax=Drosophila willistoni RepID=B4MPK7_DROWI Length = 106 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 GG GG GG GGGGGGGGGGGSGGQG GG Sbjct: 12 GGQGGKGGGGGGGGGGGGGGGSGGQGGKGGG 42 [183][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/50 (52%), Positives = 28/50 (56%) Frame = -3 Query: 448 SVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 S+ P PP PPPPPPPPPPP PP PP PP L + P LP P Sbjct: 839 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVG-ETSNLQPPPPLPPPP 887 [184][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/50 (52%), Positives = 28/50 (56%) Frame = -3 Query: 448 SVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 S+ P PP PPPPPPPPPPP PP PP PP L + P LP P Sbjct: 917 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVG-ETSNLQPPPPLPPPP 965 [185][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/50 (52%), Positives = 28/50 (56%) Frame = -3 Query: 448 SVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 S+ P PP PPPPPPPPPPP PP PP PP L + P LP P Sbjct: 917 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVG-ETSNLQPPPPLPPPP 965 [186][TOP] >UniRef100_Q9QYX7-2 Isoform 2 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-2 Length = 4833 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2294 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [187][TOP] >UniRef100_Q9QYX7-3 Isoform 3 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-3 Length = 4981 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2324 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [188][TOP] >UniRef100_Q9QYX7-4 Isoform 4 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-4 Length = 5177 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2324 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [189][TOP] >UniRef100_Q9QYX7 Protein piccolo n=1 Tax=Mus musculus RepID=PCLO_MOUSE Length = 5038 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPP-LPPNPP 362 F SSLD SA PP P PP PPPPPPPPPPP LPP P PP Sbjct: 2294 FRSSSLDISAQ-------PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [190][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 55.5 bits (132), Expect = 2e-06 Identities = 35/92 (38%), Positives = 40/92 (43%), Gaps = 3/92 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPP--PPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE-GW 284 PP P PP PP PPP PPPPP P PP+PP S A P P+LP + G Sbjct: 156 PPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPPPPPALPYPQCGI 215 Query: 283 FTLTPLPLLEHSCCSAWLLLEG*DAWARTTSA 188 + CCS W W TT+A Sbjct: 216 KKGGGKCIKTGECCSIW-------GWCGTTNA 240 [191][TOP] >UniRef100_UPI000194C8B0 PREDICTED: dishevelled associated activator of morphogenesis 1 isoform 3 n=1 Tax=Taeniopygia guttata RepID=UPI000194C8B0 Length = 1074 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/47 (61%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -3 Query: 484 SASS*SGSGNPPSVCPCPPLP---PPPPPPPPPPRLPPLPPNPPKLG 353 S S GS PP P PPLP PPPPPPPPPP PP PP PP LG Sbjct: 547 SPSPTPGSLLPPP--PPPPLPGVCPPPPPPPPPPGGPPPPPGPPPLG 591 [192][TOP] >UniRef100_UPI000194C8AF PREDICTED: dishevelled associated activator of morphogenesis 1 isoform 2 n=1 Tax=Taeniopygia guttata RepID=UPI000194C8AF Length = 1064 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/47 (61%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -3 Query: 484 SASS*SGSGNPPSVCPCPPLP---PPPPPPPPPPRLPPLPPNPPKLG 353 S S GS PP P PPLP PPPPPPPPPP PP PP PP LG Sbjct: 538 SPSPTPGSLLPPP--PPPPLPGVCPPPPPPPPPPGGPPPPPGPPPLG 582 [193][TOP] >UniRef100_UPI000194C8AE PREDICTED: dishevelled associated activator of morphogenesis 1 isoform 1 n=1 Tax=Taeniopygia guttata RepID=UPI000194C8AE Length = 1084 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/47 (61%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -3 Query: 484 SASS*SGSGNPPSVCPCPPLP---PPPPPPPPPPRLPPLPPNPPKLG 353 S S GS PP P PPLP PPPPPPPPPP PP PP PP LG Sbjct: 547 SPSPTPGSLLPPP--PPPPLPGVCPPPPPPPPPPGGPPPPPGPPPLG 591 [194][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 PPS P P PPPPPPPPPPPR PP PP P Sbjct: 477 PPSRPPSSPSPPPPPPPPPPPRPPPPPPPP 506 [195][TOP] >UniRef100_UPI0000F2B170 PREDICTED: similar to hCG2004723, n=1 Tax=Monodelphis domestica RepID=UPI0000F2B170 Length = 803 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/55 (47%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = -3 Query: 460 GNPPSVCPCP----PLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 308 G+PP P P PPPPPPPPPP PP PP PP L + + DD+ LP Sbjct: 629 GDPPHPEPSKELNLPPAPPPPPPPPPPPPPPPPPLPPHLSSHLRTPEKDDDQPLP 683 [196][TOP] >UniRef100_UPI0000E1F764 PREDICTED: formin-like 2 isoform 6 n=1 Tax=Pan troglodytes RepID=UPI0000E1F764 Length = 1032 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -3 Query: 469 SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTK 341 +G PP P PP PPPPPPPPPPP PPLP + G S K Sbjct: 513 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETGPSVK 555 [197][TOP] >UniRef100_UPI0000DA2269 PREDICTED: similar to Formin-1 isoform IV (Limb deformity protein) n=1 Tax=Rattus norvegicus RepID=UPI0000DA2269 Length = 1085 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = -3 Query: 439 PCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNL-PSLPSAEGWFT 278 P PP PPPPPPPPPPP L P PP G S+ + + P + PS P ++T Sbjct: 648 PAPPTPPPPPPPPPPPGLAPPPPPGLSFGLSSSSSQCPRKPAIEPSCPMKPLYWT 702 [198][TOP] >UniRef100_UPI0000DA1CBA PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA1CBA Length = 200 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 GG GG+GG GGGGGGGGGGG GG+G DGG Sbjct: 91 GGGGGDGGGGGGGGGGGGGGGDGGRGGGDGG 121 [199][TOP] >UniRef100_UPI00004296C7 SET binding protein 1 n=2 Tax=Mus musculus RepID=UPI00004296C7 Length = 1582 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 32/57 (56%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTLTPLP 263 PPLPPPPPPP PPP PP PP PP L + + + P P+ P+ T PLP Sbjct: 1509 PPLPPPPPPPLPPP--PPPPPPPPPLPKTARGGKRKHRPQPPAQPAQP---TPQPLP 1560 [200][TOP] >UniRef100_UPI000024DCC5 zinc finger homeodomain 4 n=1 Tax=Mus musculus RepID=UPI000024DCC5 Length = 3581 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSL 302 PP PPPPPPPPPPP PP PP PP + + D P PS+ Sbjct: 2009 PPTPPPPPPPPPPPPPPPPPPPPPSAPQQVQLPVSLDLPLFPSI 2052 [201][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA 329 +PP P PP PPPP PPP PP PP PP PP L T DRA Sbjct: 1251 SPPPPTPPPPAPPPPTPPPSPP--PPTPPPPPPLAPFTCEDRA 1291 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/65 (46%), Positives = 30/65 (46%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 275 PPS P PP P PPPP PPPP PP PP P T NP PS P Sbjct: 773 PPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP-------- 824 Query: 274 TPLPL 260 PLPL Sbjct: 825 PPLPL 829 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/65 (46%), Positives = 30/65 (46%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 275 PPS P PP P PPPP PPPP PP PP P T NP PS P Sbjct: 864 PPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP-------- 915 Query: 274 TPLPL 260 PLPL Sbjct: 916 PPLPL 920 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/65 (46%), Positives = 30/65 (46%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 275 PPS P PP P PPPP PPPP PP PP P T NP PS P Sbjct: 1042 PPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP-------- 1093 Query: 274 TPLPL 260 PLPL Sbjct: 1094 PPLPL 1098 Score = 53.9 bits (128), Expect = 7e-06 Identities = 31/66 (46%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = -3 Query: 454 PPSVCPCPPLPPPP-PPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFT 278 PP P PPLPPPP PPP PPP PP PP P T NP PS P Sbjct: 950 PPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP------- 1002 Query: 277 LTPLPL 260 PLPL Sbjct: 1003 -PPLPL 1007 Score = 53.9 bits (128), Expect = 7e-06 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 PPS P PP P PPPP PPPP PP PP P T NP PS P Sbjct: 1133 PPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 1184 Score = 53.5 bits (127), Expect = 9e-06 Identities = 27/65 (41%), Positives = 28/65 (43%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFT 278 +PP P PP PPPP PPP PP PP P PP P LP PS Sbjct: 1139 SPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLP 1198 Query: 277 LTPLP 263 PLP Sbjct: 1199 PPPLP 1203 [202][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 S P P PP PPPPPPPPPPP PP PP PP Sbjct: 54 SAAPAQARPTPPPPPPPPPPPPPPPPPPPPPPPP 87 [203][TOP] >UniRef100_Q7XHB6 Transposon protein, putative, CACTA, En/Spm sub-class n=2 Tax=Oryza sativa RepID=Q7XHB6_ORYSJ Length = 773 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/66 (42%), Positives = 31/66 (46%), Gaps = 19/66 (28%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPP---------PPPPPRLPPLPPNPPKLGT----------STKADR 332 PP P PP PPPPPP PPPPP PP PP PPK + +TK D+ Sbjct: 432 PPPPAPSPPAPPPPPPPPAPSPPAPPPPPPPPPPCPPAPPKTRSRQAPPPASTRATKKDK 491 Query: 331 ADDNPN 314 D N Sbjct: 492 VDTTKN 497 [204][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PP P PP PPPP PPPPPPR PP PP PP Sbjct: 435 PPPPPPPPPPPPPPTPPPPPPRPPPPPPPPP 465 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/45 (53%), Positives = 26/45 (57%) Frame = -3 Query: 496 SLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +L S + S PP P PP PPPPP PPPPP PP PP PP Sbjct: 420 NLQRSETEIFASTPPPPPPPPPPPPPPPPTPPPPPPRPPPPPPPP 464 [205][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/53 (47%), Positives = 27/53 (50%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLP 299 +PP P PP PPPPPPP PPP PP PP PP + P PS P Sbjct: 417 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 469 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +PP P PP PPPPPPP PPP PP PP PP Sbjct: 262 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +PP P PP PPPPPPP PPP PP PP PP Sbjct: 319 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +PP P PP PPPPPPP PPP PP PP PP Sbjct: 363 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +PP P PP PPPPPPP PPP PP PP PP Sbjct: 477 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 508 [206][TOP] >UniRef100_B9SMV7 Vegetative cell wall protein gp1, putative n=1 Tax=Ricinus communis RepID=B9SMV7_RICCO Length = 479 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 +PP CP PP PPPP PPPP P PPL P+PP Sbjct: 200 SPPPPCPPPPSPPPPSPPPPSPPPPPLVPSPP 231 [207][TOP] >UniRef100_A8ITW8 Dicer-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8ITW8_CHLRE Length = 3556 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 9/42 (21%) Frame = -3 Query: 454 PPSVCPCPPLPPPP---------PPPPPPPRLPPLPPNPPKL 356 PP + P PPLPPPP PPPPPPP LPP PP PP L Sbjct: 2515 PPPLPPPPPLPPPPPLPPHLTHQPPPPPPPPLPPPPPLPPPL 2556 [208][TOP] >UniRef100_Q7Q751 AGAP005505-PA n=1 Tax=Anopheles gambiae RepID=Q7Q751_ANOGA Length = 511 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 357 NFGGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 NFGGF G GG GGGGGGGGGGG GG G GG Sbjct: 222 NFGGFVGGGGGGGGGGGGGGGGGGGGGGGGAGG 254 [209][TOP] >UniRef100_Q5CKJ5 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis RepID=Q5CKJ5_CRYHO Length = 996 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/55 (52%), Positives = 33/55 (60%), Gaps = 6/55 (10%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPP----LPPNP--PKLGTSTKADRADDNPNL 311 +PP P PP PPPPPPPPPPP LPP LPP P P G S +D ++P L Sbjct: 408 SPP---PPPPPPPPPPPPPPPPPLPPSQHLLPPPPPLPLSGDSKVSDMQKEDPTL 459 [210][TOP] >UniRef100_Q16U10 Putative uncharacterized protein n=1 Tax=Aedes aegypti RepID=Q16U10_AEDAE Length = 1808 Score = 55.1 bits (131), Expect = 3e-06 Identities = 31/71 (43%), Positives = 36/71 (50%), Gaps = 6/71 (8%) Frame = -3 Query: 487 SSASS*SGSGNPPSV--CPCPPLPPPPP----PPPPPPRLPPLPPNPPKLGTSTKADRAD 326 +S SS + +PPS+ P PP PPPPP PPPPPP P PP PP G A Sbjct: 349 NSTSSTHSTTSPPSITGAPAPPPPPPPPNLAPPPPPPPPCAPPPPPPPMAG----GPSAR 404 Query: 325 DNPNLPSLPSA 293 P +P P A Sbjct: 405 GGPPVPPAPPA 415 [211][TOP] >UniRef100_B3MC79 GF12825 n=1 Tax=Drosophila ananassae RepID=B3MC79_DROAN Length = 503 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/54 (46%), Positives = 27/54 (50%) Frame = -3 Query: 469 SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP 308 SG G PP PP PPPPPPPPPP PP+PP T +PN P Sbjct: 329 SGVGVPPPSALPPPPPPPPPPPPPPQPQTKKPPSPPPFPTKGAVKPLSPSPNTP 382 [212][TOP] >UniRef100_B2KTD4 Minicollagen 1 n=1 Tax=Clytia hemisphaerica RepID=B2KTD4_9CNID Length = 149 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/53 (49%), Positives = 26/53 (49%) Frame = -3 Query: 445 VCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 287 VC PP PPPPPPPPPPP PP PP PP NP P P G Sbjct: 48 VCCAPPPPPPPPPPPPPPPPPPPPPPPPA--------PIPGNPGPPGRPGPPG 92 Score = 53.5 bits (127), Expect = 9e-06 Identities = 27/58 (46%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLP--PNPPKLGTSTKADRADDNPNLPSLPSAEG 287 PP P PP PPPPPPPPPPP P+P P PP A P LP P G Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPAPIPGNPGPPGRPGPPGAPGPAGPPGLPGPPGIPG 110 [213][TOP] >UniRef100_Q9Z180 SET-binding protein n=1 Tax=Mus musculus RepID=SETBP_MOUSE Length = 1535 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 32/57 (56%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTLTPLP 263 PPLPPPPPPP PPP PP PP PP L + + + P P+ P+ T PLP Sbjct: 1462 PPLPPPPPPPLPPP--PPPPPPPPPLPKTARGGKRKHRPQPPAQPAQP---TPQPLP 1513 [214][TOP] >UniRef100_Q03173-5 Isoform 4 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-5 Length = 787 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 290 PP+ P P PPPPPPPPPPP P PP PP S +A P P S PS++ Sbjct: 419 PPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 475 [215][TOP] >UniRef100_Q03173-2 Isoform 1 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-2 Length = 390 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 290 PP+ P P PPPPPPPPPPP P PP PP S +A P P S PS++ Sbjct: 22 PPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 78 [216][TOP] >UniRef100_Q03173-4 Isoform 3 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-4 Length = 783 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 290 PP+ P P PPPPPPPPPPP P PP PP S +A P P S PS++ Sbjct: 415 PPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 471 [217][TOP] >UniRef100_Q03173 Protein enabled homolog n=1 Tax=Mus musculus RepID=ENAH_MOUSE Length = 802 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLP--SLPSAE 290 PP+ P P PPPPPPPPPPP P PP PP S +A P P S PS++ Sbjct: 434 PPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSK 490 [218][TOP] >UniRef100_UPI00017F09BE PREDICTED: similar to KIAA1902 protein, partial n=1 Tax=Sus scrofa RepID=UPI00017F09BE Length = 734 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/47 (55%), Positives = 28/47 (59%) Frame = -3 Query: 433 PPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+PPPPPPPPPPP PP PP PP G + A P P PSA Sbjct: 258 PPMPPPPPPPPPPPPPPPPPPPPPLPGPAADTVPAPPLPP-PPPPSA 303 Score = 53.9 bits (128), Expect = 7e-06 Identities = 27/57 (47%), Positives = 28/57 (49%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEG 287 N P P PP PPPPPPPPPPP PP PP P + A P PS P G Sbjct: 253 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAADTVPAPPLPPPPP-PSAPPLPG 308 [219][TOP] >UniRef100_UPI0001796833 PREDICTED: similar to Vasodilator-stimulated phosphoprotein (VASP) n=1 Tax=Equus caballus RepID=UPI0001796833 Length = 441 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/61 (44%), Positives = 33/61 (54%) Frame = -3 Query: 469 SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAE 290 S +G PP+ P PPPPP PPPPP PP P PP G++ P P LP+A+ Sbjct: 218 SNAGGPPT--PLAGGPPPPPGPPPPPGPPPPPGLPPSGGSTAGHGAGGGPPPAPPLPTAQ 275 Query: 289 G 287 G Sbjct: 276 G 276 [220][TOP] >UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI000155382B Length = 492 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 GG GG+GG RGGGGGGGGGGG GG G GG Sbjct: 220 GGGGGDGGGRGGGGGGGGGGGGGGDGGGGGG 250 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 GG GG GG RGGGGGGGGGGG GG G GG Sbjct: 201 GGGGGGGGGRGGGGGGGGGGGGGGDGGGRGG 231 [221][TOP] >UniRef100_UPI0000F2E472 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2E472 Length = 551 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 PPS P PPPPPPPPPPP + PLPP PP Sbjct: 417 PPSPAAPSPPPPPPPPPPPPPHMSPLPPPPP 447 [222][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 F SSLD SA PP P PP PPPPPPPPPPP PP P P Sbjct: 2332 FRSSSLDISAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 2373 [223][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 F SSLD SA PP P PP PPPPPPPPPPP PP P P Sbjct: 1270 FRSSSLDISAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 1311 [224][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 F SSLD SA PP P PP PPPPPPPPPPP PP P P Sbjct: 2332 FRSSSLDISAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 2373 [225][TOP] >UniRef100_UPI0000DA45DC PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA45DC Length = 92 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/46 (58%), Positives = 27/46 (58%) Frame = +3 Query: 318 GLSSALSAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 GL S LS GG GG GG GGGGGGGGGGG GG G GG Sbjct: 16 GLESELSDSTACGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61 [226][TOP] >UniRef100_UPI0000DA3D7B PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3D7B Length = 211 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 GG GG GG GGGGGGGGGGG GG G+ DGG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGRGDGG 171 [227][TOP] >UniRef100_UPI0000DA32FB PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA32FB Length = 236 Score = 54.7 bits (130), Expect = 4e-06 Identities = 31/78 (39%), Positives = 37/78 (47%) Frame = +3 Query: 222 SSSNHAEQQECSSSGSGVSVNQPSALGRLGKFGLSSALSAFVLVPNFGGFGGNGGNRGGG 401 + +N A+ + SS GV +G G+ G GG GG GG GGG Sbjct: 51 ADANAAKPMKISSDKGGVGGGVGGGVGGRGRVG--------------GGGGGGGGGGGGG 96 Query: 402 GGGGGGGGSGGQGQTDGG 455 GGGGGGGG GG G GG Sbjct: 97 GGGGGGGGGGGGGGGGGG 114 [228][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/48 (54%), Positives = 28/48 (58%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 F SS+D+SA PP P PP PPPPPPPPPPP PP P P Sbjct: 2335 FRSSSVDASAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 2376 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = -3 Query: 481 ASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 +SS S PP P PP PPPPPPPPPPP LP PP PK Sbjct: 2337 SSSVDASAQPPPPPPPPPPPPPPPPPPPPPPLP--PPTSPK 2375 [229][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 F SSLD SA PP P PP PPPPPPPPPPP PP P P Sbjct: 2394 FRSSSLDISAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 2435 [230][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -3 Query: 508 FSFSSLDSSASS*SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP 365 F SSLD SA PP P PP PPPPPPPPPPP PP P P Sbjct: 2394 FRSSSLDISAQP------PPPPPPPPPPPPPPPPPPPPPLPPPTSPKP 2435 [231][TOP] >UniRef100_UPI00016E37F5 UPI00016E37F5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F5 Length = 399 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGGLP 461 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 392 [232][TOP] >UniRef100_UPI00016E37F4 UPI00016E37F4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F4 Length = 421 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGGLP 461 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 362 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 394 [233][TOP] >UniRef100_UPI00016E37F3 UPI00016E37F3 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F3 Length = 418 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGGLP 461 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 357 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 389 [234][TOP] >UniRef100_UPI00016E37F2 UPI00016E37F2 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F2 Length = 397 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGGLP 461 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 336 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 368 [235][TOP] >UniRef100_UPI00016E37F1 UPI00016E37F1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F1 Length = 401 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGGLP 461 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 339 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 371 [236][TOP] >UniRef100_UPI00016E37F0 UPI00016E37F0 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E37F0 Length = 418 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGGLP 461 GG GG GG GGGGGGGGGGGSGG G GG P Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGSGGGGSGGGGNP 384 [237][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/54 (48%), Positives = 29/54 (53%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP+ P PP PPPPPPPPPPP PP P PP + A P P+ P A Sbjct: 615 PPAPAP-PPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPA 667 [238][TOP] >UniRef100_Q6GQB0 MGC80202 protein n=1 Tax=Xenopus laevis RepID=Q6GQB0_XENLA Length = 386 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/49 (51%), Positives = 25/49 (51%) Frame = -3 Query: 451 PSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPS 305 P P PP PPPPP PPPPP PP PP PP G P LPS Sbjct: 162 PPAPPAPPGPPPPPGPPPPPGGPPAPPAPPGGGPPPSGGGPPPPPPLPS 210 [239][TOP] >UniRef100_Q4RSI9 Chromosome 13 SCAF15000, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4RSI9_TETNG Length = 307 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/70 (42%), Positives = 35/70 (50%), Gaps = 6/70 (8%) Frame = -3 Query: 454 PPSVCPCPPLP------PPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSA 293 PP P PP P PPPPPPPPPP PP PP+PP + P+ P LP Sbjct: 173 PPPPLPPPPFPLFPLFPPPPPPPPPPPFSPPPPPSPPP-SLFSPPPFFSPPPSFPPLPPP 231 Query: 292 EGWFTLTPLP 263 +F+ PLP Sbjct: 232 P-YFSPLPLP 240 [240][TOP] >UniRef100_Q6IMV8 Transposase n=1 Tax=Oryza sativa Indica Group RepID=Q6IMV8_ORYSI Length = 361 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/57 (45%), Positives = 29/57 (50%), Gaps = 7/57 (12%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPN-------PPKLGTSTKADRADDNPN 314 + PP P PP PPPPPPPPPPP PP PP PP +TK + D N Sbjct: 102 ASQPPPPAPSPPAPPPPPPPPPPP-CPPAPPKTRSRQALPPARTRATKKAKVDVTKN 157 [241][TOP] >UniRef100_Q5VR02 Hydroxyproline-rich glycoprotein-like n=1 Tax=Oryza sativa Japonica Group RepID=Q5VR02_ORYSJ Length = 1026 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPK 359 +PP+ P PP P PP PPPPPP PP PP PPK Sbjct: 554 SPPAPLPPPPAPSPPAPPPPPPPPPPCPPAPPK 586 [242][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/81 (37%), Positives = 35/81 (43%), Gaps = 1/81 (1%) Frame = -3 Query: 457 NPPSVCPCPPLPPPPPPPPPPPRLPPLPPNP-PKLGTSTKADRADDNPNLPSLPSAEGWF 281 +PP P PP PPPPPPP PPP PP PP P P + +P P PS Sbjct: 190 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPS 249 Query: 280 TLTPLPLLEHSCCSAWLLLEG 218 P P C+ W + G Sbjct: 250 PPPPSPPPPCKVCATWEAIAG 270 [243][TOP] >UniRef100_C0PGT8 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PGT8_MAIZE Length = 787 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = -3 Query: 430 PLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNP 317 P PPPPPPPPPPP PP PP PP+L + ++ NP Sbjct: 429 PPPPPPPPPPPPPPTPPPPPPPPRLPSPPPVEKVTVNP 466 [244][TOP] >UniRef100_B9RLU7 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RLU7_RICCO Length = 1550 Score = 54.7 bits (130), Expect = 4e-06 Identities = 29/70 (41%), Positives = 31/70 (44%), Gaps = 15/70 (21%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPP---------------PRLPPLPPNPPKLGTSTKADRA 329 S P SV PPLPPPPPPPPPP P PP PP PP +G + R Sbjct: 783 SSVPASVSSAPPLPPPPPPPPPPLVNASTVPKVGGIKIPTAPPPPPPPPPMGGTMLPPRP 842 Query: 328 DDNPNLPSLP 299 P P P Sbjct: 843 PPPPPPPPPP 852 [245][TOP] >UniRef100_B9HE50 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HE50_POPTR Length = 604 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/68 (44%), Positives = 35/68 (51%) Frame = -3 Query: 454 PPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADDNPNLPSLPSAEGWFTL 275 PP P PP PP PPPPPPPP P PP PPK+G + P +P ++G L Sbjct: 352 PPGRTPAPP-PPRPPPPPPPPVAAPRPPVPPKVGRA------------PPVPPSKG--KL 396 Query: 274 TPLPLLEH 251 P PL H Sbjct: 397 KPSPLGPH 404 [246][TOP] >UniRef100_Q5CS67 Signal peptide containing large protein with proline stretches n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CS67_CRYPV Length = 1884 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -3 Query: 469 SGSGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPP 362 SGS PP P PP PPPPPPPPPPP PP PP P Sbjct: 1540 SGSSAPPP--PPPPPPPPPPPPPPPPSPPPSPPPSP 1573 [247][TOP] >UniRef100_Q4DB88 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi RepID=Q4DB88_TRYCR Length = 301 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 363 GGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 GG GG GG GGGGGGGGGGG GG+G DGG Sbjct: 244 GGGGGGGGGGGGGGGGGGGGGGGGRGGFDGG 274 [248][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -3 Query: 448 SVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTS 347 S+ P PP PPPPPPPPPPP PP PP PP G++ Sbjct: 97 SLQPPPPPPPPPPPPPPPPPPPPPPPPPPPPGSA 130 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/37 (59%), Positives = 24/37 (64%) Frame = -3 Query: 439 PCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRA 329 P PP PPPPPPPPPPP PP PP PP + + D A Sbjct: 102 PPPPPPPPPPPPPPPPPPPPPPPPPPGSAEALQTDEA 138 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/47 (51%), Positives = 29/47 (61%) Frame = -3 Query: 463 SGNPPSVCPCPPLPPPPPPPPPPPRLPPLPPNPPKLGTSTKADRADD 323 +G+ S PP PPPPPPPPPPP PP PP PP S +A + D+ Sbjct: 91 NGDGVSSLQPPPPPPPPPPPPPPPPPPPPPPPPPPPPGSAEALQTDE 137 [249][TOP] >UniRef100_C3ZSY2 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3ZSY2_BRAFL Length = 2637 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = -3 Query: 466 GSGNPPSVCPCPPLPPPP---PPPPPPPRLPPLPPNPPKLGTST 344 GSG PP PP PPPP PPPPPPP PP PP P L TST Sbjct: 712 GSGGPP-----PPPPPPPGGGPPPPPPPGAPPPPPGAPLLHTST 750 [250][TOP] >UniRef100_B7QMH8 H/ACA ribonucleoprotein complex protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QMH8_IXOSC Length = 121 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = +3 Query: 336 SAFVLVPNFGGFGGNGGNRGGGGGGGGGGGSGGQGQTDGG 455 SA +P GG GG GG GGGGGGGGGGG GG G GG Sbjct: 43 SALTPMPGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82