[UP]
[1][TOP] >UniRef100_A8IS22 Ribosomal protein S26 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8IS22_CHLRE Length = 101 Score = 73.6 bits (179), Expect(2) = 3e-16 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 168 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR 272 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR Sbjct: 65 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR 99 Score = 35.0 bits (79), Expect(2) = 3e-16 Identities = 27/58 (46%), Positives = 32/58 (55%), Gaps = 11/58 (18%) Frame = +1 Query: 34 GDAKHGRGHDGAR--ESSGARCPRT-AMRYCNVRG----SPMR----GCVVDNYARPR 174 G AKHGRGH ESSGA P+ A++ VR S +R CVVDNYA P+ Sbjct: 9 GRAKHGRGHVNRVRCESSGAMVPKDKAIKRYIVRNIVDASALRDMQEACVVDNYALPK 66 [2][TOP] >UniRef100_A4RSE1 Ribosomal protein S26, component of cytosolic 80S ribosome and 40S small subunit n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RSE1_OSTLU Length = 114 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 168 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR 272 PK+YRK YYSISAAIHS+VVRVR+ + RR REPPR Sbjct: 67 PKLYRKAYYSISAAIHSKVVRVRSREARRIREPPR 101 [3][TOP] >UniRef100_Q01E61 Ribosomal protein S26, cytosolic (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01E61_OSTTA Length = 221 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +3 Query: 168 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR 272 PK+YRKVYYSISAAIHS+VVRVR+ + RR R+PP+ Sbjct: 174 PKLYRKVYYSISAAIHSKVVRVRSREARRIRDPPK 208 [4][TOP] >UniRef100_C1MWE5 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MWE5_9CHLO Length = 116 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 168 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR 272 PK+YRKVYY ISAAIHS+VVRVR+ + RR REPP+ Sbjct: 67 PKLYRKVYYCISAAIHSKVVRVRSVEARRIREPPK 101 [5][TOP] >UniRef100_C1EBI3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EBI3_9CHLO Length = 113 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 168 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR 272 PK+YRKVYY ISAAIHS+VVRVR+ + RR REPP+ Sbjct: 67 PKLYRKVYYCISAAIHSKVVRVRSVEARRIREPPK 101 [6][TOP] >UniRef100_B9S2T1 40S ribosomal protein S26, putative n=1 Tax=Ricinus communis RepID=B9S2T1_RICCO Length = 132 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 168 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR 272 PK+Y K+ Y +S AIHSRVVRVR+ ERRNREPP+ Sbjct: 65 PKLYVKMQYCVSCAIHSRVVRVRSRSERRNREPPK 99 [7][TOP] >UniRef100_B9S4D5 40S ribosomal protein S26, putative n=1 Tax=Ricinus communis RepID=B9S4D5_RICCO Length = 132 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 168 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR 272 PK+Y K+ Y +S AIHSRVVRVR+ ERRNREPP+ Sbjct: 65 PKLYVKMQYCVSCAIHSRVVRVRSRSERRNREPPQ 99 [8][TOP] >UniRef100_A9P8L6 Predicted protein n=2 Tax=Populus RepID=A9P8L6_POPTR Length = 132 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 168 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR 272 PK+Y K+ Y +S AIHSRVVRVR+ ERRNREPP+ Sbjct: 65 PKLYVKMQYCVSCAIHSRVVRVRSRSERRNREPPQ 99 [9][TOP] >UniRef100_B9T7A0 40S ribosomal protein S26, putative n=1 Tax=Ricinus communis RepID=B9T7A0_RICCO Length = 132 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +3 Query: 168 PKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPR 272 PK+Y K+ Y +S AIHSRVVRVR+ ERRNR+PP+ Sbjct: 65 PKLYVKMQYCVSCAIHSRVVRVRSRSERRNRQPPQ 99