[UP]
[1][TOP] >UniRef100_B1PBX8 Putative uncharacterized protein (Fragment) n=1 Tax=Arabidopsis lyrata subsp. petraea RepID=B1PBX8_ARALP Length = 172 Score = 92.4 bits (228), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 130 AAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 172 [2][TOP] >UniRef100_Q9SEI4 26S protease regulatory subunit 6B homolog n=2 Tax=Arabidopsis thaliana RepID=PRS6B_ARATH Length = 408 Score = 92.4 bits (228), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 366 AAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408 [3][TOP] >UniRef100_UPI000198342A PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI000198342A Length = 573 Score = 90.9 bits (224), Expect = 4e-17 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK Sbjct: 531 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 573 [4][TOP] >UniRef100_B9SCE5 26S protease regulatory subunit 6b, putative n=1 Tax=Ricinus communis RepID=B9SCE5_RICCO Length = 415 Score = 90.9 bits (224), Expect = 4e-17 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK Sbjct: 373 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 415 [5][TOP] >UniRef100_B9HDS7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HDS7_POPTR Length = 412 Score = 90.9 bits (224), Expect = 4e-17 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK Sbjct: 370 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 412 [6][TOP] >UniRef100_A7NXZ6 Chromosome chr6 scaffold_3, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7NXZ6_VITVI Length = 418 Score = 90.9 bits (224), Expect = 4e-17 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK Sbjct: 376 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 [7][TOP] >UniRef100_Q42235 TAT-binding protein homolog (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q42235_ARATH Length = 66 Score = 90.5 bits (223), Expect = 5e-17 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK Sbjct: 24 AAICQEAGMHAVRKNRYVILPKDFEKGYRPNVKKPDTDFEFYK 66 [8][TOP] >UniRef100_O65750 26S protease regulatory subunit 6 (Fragment) n=1 Tax=Cicer arietinum RepID=O65750_CICAR Length = 177 Score = 89.7 bits (221), Expect = 9e-17 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +AICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK Sbjct: 135 SAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 177 [9][TOP] >UniRef100_B1PJP1 Putative 26S proteasome regulatory complex protein (Fragment) n=1 Tax=Sandersonia aurantiaca RepID=B1PJP1_SANAU Length = 71 Score = 89.7 bits (221), Expect = 9e-17 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 29 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFDFYK 71 [10][TOP] >UniRef100_B9IHJ0 Predicted protein n=2 Tax=Populus RepID=B9IHJ0_POPTR Length = 412 Score = 89.4 bits (220), Expect = 1e-16 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK Sbjct: 371 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 412 [11][TOP] >UniRef100_A9PGI7 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9PGI7_POPTR Length = 412 Score = 89.4 bits (220), Expect = 1e-16 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK Sbjct: 371 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 412 [12][TOP] >UniRef100_P54778 26S protease regulatory subunit 6B homolog n=1 Tax=Solanum tuberosum RepID=PRS6B_SOLTU Length = 413 Score = 89.4 bits (220), Expect = 1e-16 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK Sbjct: 372 AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 413 [13][TOP] >UniRef100_Q8W3N9 26S proteasome regulatory particle triple-A ATPase subunit3 (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=Q8W3N9_ORYSJ Length = 368 Score = 88.2 bits (217), Expect = 3e-16 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKP+TDF+FYK Sbjct: 326 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPETDFDFYK 368 [14][TOP] >UniRef100_Q6Z875 Os02g0325100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z875_ORYSJ Length = 419 Score = 88.2 bits (217), Expect = 3e-16 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKP+TDF+FYK Sbjct: 377 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPETDFDFYK 419 [15][TOP] >UniRef100_Q6QP36 26S proteasome regulatory complex ATPase RPT3 n=1 Tax=Zea mays RepID=Q6QP36_MAIZE Length = 348 Score = 88.2 bits (217), Expect = 3e-16 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKP+TDF+FYK Sbjct: 306 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPETDFDFYK 348 [16][TOP] >UniRef100_C5WR90 Putative uncharacterized protein Sb01g013750 n=1 Tax=Sorghum bicolor RepID=C5WR90_SORBI Length = 420 Score = 88.2 bits (217), Expect = 3e-16 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKP+TDF+FYK Sbjct: 378 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPETDFDFYK 420 [17][TOP] >UniRef100_B9F5D5 Putative uncharacterized protein n=2 Tax=Oryza sativa RepID=B9F5D5_ORYSJ Length = 442 Score = 88.2 bits (217), Expect = 3e-16 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKP+TDF+FYK Sbjct: 400 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPETDFDFYK 442 [18][TOP] >UniRef100_B6TRH7 26S protease regulatory subunit 6B n=1 Tax=Zea mays RepID=B6TRH7_MAIZE Length = 420 Score = 88.2 bits (217), Expect = 3e-16 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKP+TDF+FYK Sbjct: 378 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPETDFDFYK 420 [19][TOP] >UniRef100_B6TDT1 26S protease regulatory subunit 6B n=1 Tax=Zea mays RepID=B6TDT1_MAIZE Length = 420 Score = 88.2 bits (217), Expect = 3e-16 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGMHAVRKNRYVILPKDFEKGYR NVKKP+TDF+FYK Sbjct: 378 AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPETDFDFYK 420 [20][TOP] >UniRef100_A9TJC3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TJC3_PHYPA Length = 416 Score = 85.9 bits (211), Expect = 1e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +AICQ+AGMHAVRKNRYVILPKDFEKGYR+NVKK DTDFEFY+ Sbjct: 374 SAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKSDTDFEFYR 416 [21][TOP] >UniRef100_A9T0R6 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9T0R6_PHYPA Length = 412 Score = 85.9 bits (211), Expect = 1e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +AICQ+AGMHAVRKNRYVILPKDFEKGYR+NVKK DTDFEFY+ Sbjct: 370 SAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKSDTDFEFYR 412 [22][TOP] >UniRef100_A9SHI2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SHI2_PHYPA Length = 387 Score = 85.9 bits (211), Expect = 1e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +AICQ+AGMHAVRKNRYVILPKDFEKGYR+NVKK DTDFEFY+ Sbjct: 345 SAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKSDTDFEFYR 387 [23][TOP] >UniRef100_A9RYX6 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RYX6_PHYPA Length = 412 Score = 84.7 bits (208), Expect = 3e-15 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +AICQ+AGMHAVRKNRYVILPKDFEKGYR+NV+K DTDFEFY+ Sbjct: 370 SAICQEAGMHAVRKNRYVILPKDFEKGYRSNVRKSDTDFEFYR 412 [24][TOP] >UniRef100_B9HDS6 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HDS6_POPTR Length = 462 Score = 75.9 bits (185), Expect = 1e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAICQ+AGM AVRKNRYVIL K+FEKGYR NVKKP TDF+FY Sbjct: 403 AAICQEAGMLAVRKNRYVILHKNFEKGYRTNVKKPQTDFDFY 444 [25][TOP] >UniRef100_Q1HQC6 26S protease regulatory subunit 6B n=1 Tax=Bombyx mori RepID=Q1HQC6_BOMMO Length = 415 Score = 75.9 bits (185), Expect = 1e-12 Identities = 30/42 (71%), Positives = 40/42 (95%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++LPKDFEKGY+ N+KK ++++EFYK Sbjct: 374 AICQEAGMHAVRENRYIVLPKDFEKGYKNNIKKDESEYEFYK 415 [26][TOP] >UniRef100_UPI00017916C0 PREDICTED: similar to 26S protease regulatory subunit 6B n=1 Tax=Acyrthosiphon pisum RepID=UPI00017916C0 Length = 414 Score = 74.3 bits (181), Expect = 4e-12 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++LPKDFEKGY+ N+KK +++ EFYK Sbjct: 373 AICQEAGMHAVRENRYIVLPKDFEKGYKNNIKKDESEHEFYK 414 [27][TOP] >UniRef100_UPI0000D55D76 PREDICTED: similar to Rpt3 CG16916-PA n=1 Tax=Tribolium castaneum RepID=UPI0000D55D76 Length = 409 Score = 74.3 bits (181), Expect = 4e-12 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++LPKDFEKGY+ N+KK +++ EFYK Sbjct: 368 AICQEAGMHAVRENRYIVLPKDFEKGYKNNIKKDESEHEFYK 409 [28][TOP] >UniRef100_Q011N6 26S proteasome AAA-ATPase subunit RPT3 (ISS) n=1 Tax=Ostreococcus tauri RepID=Q011N6_OSTTA Length = 370 Score = 73.9 bits (180), Expect = 5e-12 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AG+ AVRKNRYV+LPKDFE Y+ NV+KPD DFEFYK Sbjct: 329 SICQEAGLQAVRKNRYVVLPKDFEVAYKINVRKPDNDFEFYK 370 [29][TOP] >UniRef100_C1MUS2 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MUS2_9CHLO Length = 422 Score = 73.9 bits (180), Expect = 5e-12 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AG+ AVRKNRYV++PKDFEKGY+++V+KP DFEFYK Sbjct: 381 SICQEAGLQAVRKNRYVVMPKDFEKGYKSSVRKPGDDFEFYK 422 [30][TOP] >UniRef100_A4S2N3 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S2N3_OSTLU Length = 417 Score = 73.2 bits (178), Expect = 8e-12 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AG+ AVRKNRYV+LPKDFE Y+ NV+KPD DFEFY+ Sbjct: 376 SICQEAGLQAVRKNRYVVLPKDFEVAYKTNVRKPDNDFEFYR 417 [31][TOP] >UniRef100_P46507 26S protease regulatory subunit 6B n=1 Tax=Manduca sexta RepID=PRS6B_MANSE Length = 415 Score = 73.2 bits (178), Expect = 8e-12 Identities = 29/42 (69%), Positives = 40/42 (95%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGM+AVR+NRY++LPKDFEKGY+ N+KK ++++EFYK Sbjct: 374 AICQEAGMNAVRENRYIVLPKDFEKGYKNNIKKDESEYEFYK 415 [32][TOP] >UniRef100_Q7PGR3 AGAP003008-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=Q7PGR3_ANOGA Length = 380 Score = 72.8 bits (177), Expect = 1e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK +T+ EFYK Sbjct: 339 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDETEHEFYK 380 [33][TOP] >UniRef100_Q172T1 26S protease regulatory subunit 6b n=1 Tax=Aedes aegypti RepID=Q172T1_AEDAE Length = 460 Score = 72.8 bits (177), Expect = 1e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK +T+ EFYK Sbjct: 419 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDETEHEFYK 460 [34][TOP] >UniRef100_B6KJ96 26S protease regulatory subunit 6b, putative n=3 Tax=Toxoplasma gondii RepID=B6KJ96_TOXGO Length = 409 Score = 72.8 bits (177), Expect = 1e-11 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAICQ+AGM AVRKNRYVILPKDFEKG++A+V+K + DF+FY Sbjct: 366 AAICQEAGMQAVRKNRYVILPKDFEKGWKAHVRKHERDFDFY 407 [35][TOP] >UniRef100_B0WDD3 26S protease regulatory subunit 6B n=1 Tax=Culex quinquefasciatus RepID=B0WDD3_CULQU Length = 409 Score = 72.8 bits (177), Expect = 1e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK +T+ EFYK Sbjct: 368 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDETEHEFYK 409 [36][TOP] >UniRef100_C1BU61 26S protease regulatory subunit 6B n=1 Tax=Lepeophtheirus salmonis RepID=C1BU61_9MAXI Length = 410 Score = 72.0 bits (175), Expect = 2e-11 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGM A+R+NRY++LPKDFEKGY+ N+KK + ++EFYK Sbjct: 369 AICQEAGMQAIRENRYIVLPKDFEKGYKNNIKKTENEYEFYK 410 [37][TOP] >UniRef100_P34123 26S protease regulatory subunit 6B homolog n=1 Tax=Dictyostelium discoideum RepID=PRS6B_DICDI Length = 403 Score = 71.6 bits (174), Expect = 2e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 +ICQ+AGMHA+RKNRYVILPKDFEKGY+A++KK +F FY Sbjct: 362 SICQEAGMHAIRKNRYVILPKDFEKGYKASIKKNTHEFNFY 402 [38][TOP] >UniRef100_UPI000186DAB8 26S protease regulatory subunit 6B, putative n=1 Tax=Pediculus humanus corporis RepID=UPI000186DAB8 Length = 417 Score = 71.2 bits (173), Expect = 3e-11 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK +++ EFYK Sbjct: 376 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKEESEHEFYK 417 [39][TOP] >UniRef100_UPI00015B5E3F PREDICTED: similar to 26S protease regulatory subunit 6b n=1 Tax=Nasonia vitripennis RepID=UPI00015B5E3F Length = 415 Score = 71.2 bits (173), Expect = 3e-11 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK +++ EFYK Sbjct: 374 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDESEHEFYK 415 [40][TOP] >UniRef100_UPI00005158CF PREDICTED: similar to Rpt3 CG16916-PA n=1 Tax=Apis mellifera RepID=UPI00005158CF Length = 415 Score = 71.2 bits (173), Expect = 3e-11 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK +++ EFYK Sbjct: 374 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDESEHEFYK 415 [41][TOP] >UniRef100_Q9V405 GH06151p n=1 Tax=Drosophila melanogaster RepID=Q9V405_DROME Length = 413 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK + + EFYK Sbjct: 372 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEHEFYK 413 [42][TOP] >UniRef100_B4PYF6 GE15910 n=1 Tax=Drosophila yakuba RepID=B4PYF6_DROYA Length = 413 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK + + EFYK Sbjct: 372 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEHEFYK 413 [43][TOP] >UniRef100_B4N1U7 GK16371 n=1 Tax=Drosophila willistoni RepID=B4N1U7_DROWI Length = 413 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK + + EFYK Sbjct: 372 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEHEFYK 413 [44][TOP] >UniRef100_B4MAZ0 GJ15572 n=1 Tax=Drosophila virilis RepID=B4MAZ0_DROVI Length = 408 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK + + EFYK Sbjct: 367 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEHEFYK 408 [45][TOP] >UniRef100_B4L5E3 GI21710 n=1 Tax=Drosophila mojavensis RepID=B4L5E3_DROMO Length = 393 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK + + EFYK Sbjct: 352 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEHEFYK 393 [46][TOP] >UniRef100_B4JNF2 GH24150 n=1 Tax=Drosophila grimshawi RepID=B4JNF2_DROGR Length = 408 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK + + EFYK Sbjct: 367 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEHEFYK 408 [47][TOP] >UniRef100_B4IDY0 GM11458 n=1 Tax=Drosophila sechellia RepID=B4IDY0_DROSE Length = 858 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK + + EFYK Sbjct: 817 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEHEFYK 858 [48][TOP] >UniRef100_Q29IU3 GA14216 n=2 Tax=pseudoobscura subgroup RepID=Q29IU3_DROPS Length = 413 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK + + EFYK Sbjct: 372 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEHEFYK 413 [49][TOP] >UniRef100_B3NVA7 GG18392 n=1 Tax=Drosophila erecta RepID=B3NVA7_DROER Length = 410 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK + + EFYK Sbjct: 369 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEHEFYK 410 [50][TOP] >UniRef100_B3MQ78 GF20295 n=1 Tax=Drosophila ananassae RepID=B3MQ78_DROAN Length = 413 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGMHAVR+NRY++L KDFEKGY+ N+KK + + EFYK Sbjct: 372 AICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEHEFYK 413 [51][TOP] >UniRef100_C1E6M9 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E6M9_9CHLO Length = 420 Score = 70.1 bits (170), Expect = 7e-11 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AG+ AVRKNRYV++PKDFEKGY+++V+KP +F FY+ Sbjct: 379 AICQEAGLQAVRKNRYVVMPKDFEKGYKSSVRKPGDEFSFYQ 420 [52][TOP] >UniRef100_Q5CR10 26S proteasome regulatory subunit 26b like AAA ATpase n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CR10_CRYPV Length = 401 Score = 70.1 bits (170), Expect = 7e-11 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAI Q+AGM AVRKNRYVILPKDFEKG++ +VKK D DF+FY Sbjct: 358 AAISQEAGMQAVRKNRYVILPKDFEKGWKIHVKKSDRDFDFY 399 [53][TOP] >UniRef100_Q5CLA4 26S proteasome AAA-ATPase subunit RPT3 n=1 Tax=Cryptosporidium hominis RepID=Q5CLA4_CRYHO Length = 401 Score = 70.1 bits (170), Expect = 7e-11 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAI Q+AGM AVRKNRYVILPKDFEKG++ +VKK D DF+FY Sbjct: 358 AAISQEAGMQAVRKNRYVILPKDFEKGWKIHVKKSDRDFDFY 399 [54][TOP] >UniRef100_B6ACZ9 26S proteasome regulatory subunit 6b, putative n=1 Tax=Cryptosporidium muris RN66 RepID=B6ACZ9_9CRYT Length = 397 Score = 70.1 bits (170), Expect = 7e-11 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAICQ+AGM AVRKNRYVILPKDFE G++ ++K+ + DFEFY Sbjct: 354 AAICQEAGMQAVRKNRYVILPKDFENGWKTHIKRNERDFEFY 395 [55][TOP] >UniRef100_Q5C3E0 Putative uncharacterized protein n=1 Tax=Schistosoma japonicum RepID=Q5C3E0_SCHJA Length = 123 Score = 68.9 bits (167), Expect = 2e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGM AVR+NRYV+L KDFEKGY+ N+KK D + EFYK Sbjct: 82 AICQEAGMQAVRENRYVVLAKDFEKGYKNNLKKDDQELEFYK 123 [56][TOP] >UniRef100_A7RYL2 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RYL2_NEMVE Length = 417 Score = 67.8 bits (164), Expect = 4e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 A+CQ+AGM AVR+NRY+IL KDFEKGY+ NVKK + + EFYK Sbjct: 376 AVCQEAGMQAVRENRYIILAKDFEKGYKNNVKKDEQEHEFYK 417 [57][TOP] >UniRef100_C5L6H7 26S protease regulatory subunit 6B, putative n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5L6H7_9ALVE Length = 414 Score = 67.4 bits (163), Expect = 5e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAICQ+AGM AVR+NRYV+ KDFEKG++ +V+K D DFEFY Sbjct: 371 AAICQEAGMQAVRRNRYVVTQKDFEKGWKEHVRKKDRDFEFY 412 [58][TOP] >UniRef100_C5KS82 26S protease regulatory subunit 6B, putative n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KS82_9ALVE Length = 410 Score = 67.4 bits (163), Expect = 5e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAICQ+AGM AVR+NRYV+ KDFEKG++ +V+K D DFEFY Sbjct: 367 AAICQEAGMQAVRRNRYVVTQKDFEKGWKEHVRKKDRDFEFY 408 [59][TOP] >UniRef100_C5KE85 26S protease regulatory subunit 6B, putative n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KE85_9ALVE Length = 206 Score = 67.4 bits (163), Expect = 5e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAICQ+AGM AVR+NRYV+ KDFEKG++ +V+K D DFEFY Sbjct: 163 AAICQEAGMQAVRRNRYVVTQKDFEKGWKEHVRKKDRDFEFY 204 [60][TOP] >UniRef100_C4QGS3 26S protease regulatory subunit 6b, putative n=1 Tax=Schistosoma mansoni RepID=C4QGS3_SCHMA Length = 415 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGM AVR+NRYV+L KDFEKGY+ ++KK + + EFYK Sbjct: 374 AICQEAGMQAVRENRYVVLAKDFEKGYKNSLKKDEQELEFYK 415 [61][TOP] >UniRef100_B4JV76 GH14249 n=1 Tax=Drosophila grimshawi RepID=B4JV76_DROGR Length = 392 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRY++ KDFEKGY+ +VKK D+ EFY Sbjct: 351 AICQEAGMHAVRENRYIVHAKDFEKGYKTSVKKDDSVHEFY 391 [62][TOP] >UniRef100_B3MTY1 GF23193 n=1 Tax=Drosophila ananassae RepID=B3MTY1_DROAN Length = 405 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRYV+ KDFEKGY+ +V+K +T EFY Sbjct: 364 AICQEAGMHAVRENRYVVNFKDFEKGYKTSVRKDETQHEFY 404 [63][TOP] >UniRef100_UPI00019253B8 PREDICTED: similar to predicted protein n=1 Tax=Hydra magnipapillata RepID=UPI00019253B8 Length = 395 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AI Q+AGM AVR+NRYV+L KDFEKGY++N+KK + + +FYK Sbjct: 354 AIVQEAGMQAVRENRYVVLAKDFEKGYKSNIKKDEQEHDFYK 395 [64][TOP] >UniRef100_Q9VH79 Rpt3R, isoform A n=1 Tax=Drosophila melanogaster RepID=Q9VH79_DROME Length = 421 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRYV+ KDFEKGY+ +V+K + EFY Sbjct: 380 AICQEAGMHAVRENRYVVNAKDFEKGYKTSVRKDEAQHEFY 420 [65][TOP] >UniRef100_Q8INN2 Rpt3R, isoform B n=1 Tax=Drosophila melanogaster RepID=Q8INN2_DROME Length = 389 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRYV+ KDFEKGY+ +V+K + EFY Sbjct: 348 AICQEAGMHAVRENRYVVNAKDFEKGYKTSVRKDEAQHEFY 388 [66][TOP] >UniRef100_Q5U157 RE01104p n=1 Tax=Drosophila melanogaster RepID=Q5U157_DROME Length = 405 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRYV+ KDFEKGY+ +V+K + EFY Sbjct: 364 AICQEAGMHAVRENRYVVNAKDFEKGYKTSVRKDEAQHEFY 404 [67][TOP] >UniRef100_B4QVZ0 GD20762 n=1 Tax=Drosophila simulans RepID=B4QVZ0_DROSI Length = 389 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRYV+ KDFEKGY+ +V+K + EFY Sbjct: 348 AICQEAGMHAVRENRYVVNAKDFEKGYKTSVRKDEAQHEFY 388 [68][TOP] >UniRef100_B4PVE4 GE24735 n=1 Tax=Drosophila yakuba RepID=B4PVE4_DROYA Length = 389 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRYV+ KDFEKGY+ +V+K + EFY Sbjct: 348 AICQEAGMHAVRENRYVVNAKDFEKGYKTSVRKDEAQHEFY 388 [69][TOP] >UniRef100_B4HJT8 GM26216 n=1 Tax=Drosophila sechellia RepID=B4HJT8_DROSE Length = 389 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRYV+ KDFEKGY+ +V+K + EFY Sbjct: 348 AICQEAGMHAVRENRYVVNAKDFEKGYKTSVRKDEAQHEFY 388 [70][TOP] >UniRef100_B3P4R5 GG17330 n=1 Tax=Drosophila erecta RepID=B3P4R5_DROER Length = 389 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRYV+ KDFEKGY+ +V+K + EFY Sbjct: 348 AICQEAGMHAVRENRYVVNAKDFEKGYKTSVRKDEAQHEFY 388 [71][TOP] >UniRef100_A0EEN9 Chromosome undetermined scaffold_92, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0EEN9_PARTE Length = 393 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGM AVRKNRYV++ KDF+K Y+ V+K + +F FYK Sbjct: 351 AAICQEAGMQAVRKNRYVVIQKDFDKAYKIVVRKTEKEFNFYK 393 [72][TOP] >UniRef100_A0EE66 Chromosome undetermined scaffold_91, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0EE66_PARTE Length = 393 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AAICQ+AGM AVRKNRYV++ KDF+K Y+ V+K + +F FYK Sbjct: 351 AAICQEAGMQAVRKNRYVVIQKDFDKAYKIVVRKTEKEFNFYK 393 [73][TOP] >UniRef100_Q299G9 GA21817 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=Q299G9_DROPS Length = 386 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRYV+ KD EKGY+A+V+K + EFY Sbjct: 345 AICQEAGMHAVRENRYVVNAKDLEKGYKASVRKDEAQHEFY 385 [74][TOP] >UniRef100_B4G558 GL23235 n=1 Tax=Drosophila persimilis RepID=B4G558_DROPE Length = 386 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRYV+ KD EKGY+A+V+K + EFY Sbjct: 345 AICQEAGMHAVRENRYVVNAKDLEKGYKASVRKDEAQHEFY 385 [75][TOP] >UniRef100_B0EHZ5 26S protease regulatory subunit 6B, putative n=2 Tax=Entamoeba RepID=B0EHZ5_ENTDI Length = 389 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 A+ICQ+AGMHAVRKNRY+ILP DFEK Y+ V+K +FY+ Sbjct: 347 ASICQEAGMHAVRKNRYIILPADFEKAYKKVVRKQTQAMDFYR 389 [76][TOP] >UniRef100_A2G7J0 Proteasome endopeptidase complex, putative n=1 Tax=Trichomonas vaginalis G3 RepID=A2G7J0_TRIVA Length = 388 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 +AIC +AGMHAVR+NRYV+LPKDFE+ Y V+KPD+ Y Sbjct: 346 SAICMEAGMHAVRRNRYVVLPKDFERAYEKTVRKPDSVLSSY 387 [77][TOP] >UniRef100_UPI00006A3713 PREDICTED: similar to proteasome 26S ATPase subunit 4 n=1 Tax=Ciona intestinalis RepID=UPI00006A3713 Length = 416 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGM AVR+NRYV+L KDFEK Y+ +KK + + EFYK Sbjct: 375 AICQEAGMLAVRENRYVVLSKDFEKAYKTQMKKDEQEMEFYK 416 [78][TOP] >UniRef100_A8X7S9 C. briggsae CBR-RPT-3 protein n=1 Tax=Caenorhabditis briggsae RepID=A8X7S9_CAEBR Length = 417 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AGM AVR+NRYV+L KD EK Y+ VKK DFEFYK Sbjct: 376 SICQEAGMQAVRENRYVVLTKDLEKAYKNVVKKDTNDFEFYK 417 [79][TOP] >UniRef100_P46502 Probable 26S protease regulatory subunit 6B n=1 Tax=Caenorhabditis elegans RepID=PRS6B_CAEEL Length = 414 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AGM AVR+NRYV+L KD EK Y+ VKK DFEFYK Sbjct: 373 SICQEAGMQAVRENRYVVLTKDLEKAYKNVVKKDTNDFEFYK 414 [80][TOP] >UniRef100_UPI0000123580 Hypothetical protein CBG04772 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000123580 Length = 411 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGM AVR+NRYV+L KD EK Y+ VKK +FEFYK Sbjct: 370 AICQEAGMQAVRENRYVVLTKDLEKAYKNVVKKDTNEFEFYK 411 [81][TOP] >UniRef100_B4LYW5 GJ24517 n=1 Tax=Drosophila virilis RepID=B4LYW5_DROVI Length = 384 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRY+ KDFEKGY+ +V+K + EFY Sbjct: 343 AICQEAGMHAVRENRYIAHAKDFEKGYKTSVRKDEAQHEFY 383 [82][TOP] >UniRef100_B4K8U2 GI24873 n=1 Tax=Drosophila mojavensis RepID=B4K8U2_DROMO Length = 392 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AICQ+AGMHAVR+NRY+ KDFEKGY+ +V+K ++ EFY Sbjct: 351 AICQEAGMHAVRENRYIAHAKDFEKGYKTSVRKNESQHEFY 391 [83][TOP] >UniRef100_A8WYF6 Putative uncharacterized protein n=1 Tax=Caenorhabditis briggsae RepID=A8WYF6_CAEBR Length = 426 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 AICQ+AGM AVR+NRYV+L KD EK Y+ VKK +FEFYK Sbjct: 385 AICQEAGMQAVRENRYVVLTKDLEKAYKNVVKKDTNEFEFYK 426 [84][TOP] >UniRef100_UPI00006CF327 26S proteasome subunit P45 family protein n=1 Tax=Tetrahymena thermophila RepID=UPI00006CF327 Length = 441 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +AICQ+AGM AVRKNRYV+ KDF+K Y+ ++K + +F FYK Sbjct: 399 SAICQEAGMQAVRKNRYVVTQKDFDKAYKIVIRKSEREFNFYK 441 [85][TOP] >UniRef100_B3RW83 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RW83_TRIAD Length = 392 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++ M A+R+NRYVIL KDFEKGYR V K + + EFYK Sbjct: 351 SICQESAMQAIRENRYVILAKDFEKGYRTTVTKDEMEHEFYK 392 [86][TOP] >UniRef100_UPI00016E2E8F UPI00016E2E8F related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E2E8F Length = 420 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AGM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 379 SICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 420 [87][TOP] >UniRef100_Q7SXX0 Proteasome (Prosome, macropain) 26S subunit, ATPase, 4 n=1 Tax=Danio rerio RepID=Q7SXX0_DANRE Length = 418 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AGM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [88][TOP] >UniRef100_Q6PAD3 Psmc4 protein n=1 Tax=Xenopus laevis RepID=Q6PAD3_XENLA Length = 420 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AGM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 379 SICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 420 [89][TOP] >UniRef100_C1BLE5 26S protease regulatory subunit 6B n=1 Tax=Osmerus mordax RepID=C1BLE5_OSMMO Length = 418 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AGM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [90][TOP] >UniRef100_B9EPF8 26S protease regulatory subunit 6B n=1 Tax=Salmo salar RepID=B9EPF8_SALSA Length = 418 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AGM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [91][TOP] >UniRef100_B0R1D0 Novel protein (Zgc:63709) n=1 Tax=Danio rerio RepID=B0R1D0_DANRE Length = 418 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AGM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [92][TOP] >UniRef100_A8E565 Proteasome (Prosome, macropain) 26S subunit, ATPase, 4 n=2 Tax=Euteleostomi RepID=A8E565_DANRE Length = 418 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+AGM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [93][TOP] >UniRef100_A7AU36 26s proteasome aaa-ATPase subunit Rpt3, putative n=1 Tax=Babesia bovis RepID=A7AU36_BABBO Length = 399 Score = 60.1 bits (144), Expect = 7e-08 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAICQ+AG+ A+RKNRYV+ +DFEKG++ +++K D D+ FY Sbjct: 356 AAICQEAGIQAIRKNRYVVTNRDFEKGWKRHIRKHDRDYIFY 397 [94][TOP] >UniRef100_Q8I1V1 26S proteasome AAA-ATPase subunit RPT3, putative n=1 Tax=Plasmodium falciparum 3D7 RepID=Q8I1V1_PLAF7 Length = 392 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAI Q+AGM A+RKNRY+I DFE+GYR +V+K D+EFY Sbjct: 349 AAIAQEAGMQAIRKNRYIITANDFEQGYRTHVRKQLRDYEFY 390 [95][TOP] >UniRef100_B3L1F4 26s proteasome aaa-atpase subunit rpt3,putative n=1 Tax=Plasmodium knowlesi strain H RepID=B3L1F4_PLAKH Length = 392 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAI Q+AGM A+RKNRY+I DFE+GYR +V+K D+EFY Sbjct: 349 AAIAQEAGMQAIRKNRYIITANDFEQGYRTHVRKQLRDYEFY 390 [96][TOP] >UniRef100_A5K5V6 26S protease regulatory subunit 6B homolog, putative n=1 Tax=Plasmodium vivax RepID=A5K5V6_PLAVI Length = 392 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAI Q+AGM A+RKNRY+I DFE+GYR +V+K D+EFY Sbjct: 349 AAIAQEAGMQAIRKNRYIITANDFEQGYRTHVRKQLRDYEFY 390 [97][TOP] >UniRef100_UPI000155EF38 PREDICTED: proteasome (prosome, macropain) 26S subunit, ATPase, 4 isoform 2 n=1 Tax=Equus caballus RepID=UPI000155EF38 Length = 387 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 346 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 387 [98][TOP] >UniRef100_UPI000155EF37 PREDICTED: proteasome (prosome, macropain) 26S subunit, ATPase, 4 isoform 1 n=1 Tax=Equus caballus RepID=UPI000155EF37 Length = 418 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [99][TOP] >UniRef100_UPI0000E251BB PREDICTED: proteasome 26S ATPase subunit 4 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E251BB Length = 422 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 381 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 422 [100][TOP] >UniRef100_UPI0000D9EBFE PREDICTED: proteasome 26S ATPase subunit 4 isoform 2 n=1 Tax=Macaca mulatta RepID=UPI0000D9EBFE Length = 415 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 374 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 415 [101][TOP] >UniRef100_UPI0000D9EBFD PREDICTED: proteasome 26S ATPase subunit 4 isoform 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9EBFD Length = 422 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 381 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 422 [102][TOP] >UniRef100_UPI00006C1E5A PREDICTED: similar to proteasome 26S ATPase subunit 4 n=1 Tax=Homo sapiens RepID=UPI00006C1E5A Length = 414 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 373 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 414 [103][TOP] >UniRef100_UPI000059FEB1 PREDICTED: similar to 26S protease regulatory subunit 6B (MIP224) (MB67 interacting protein) (TAT-binding protein-7) (TBP-7) isoform 4 n=1 Tax=Canis lupus familiaris RepID=UPI000059FEB1 Length = 419 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 378 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 419 [104][TOP] >UniRef100_UPI000059FEB0 PREDICTED: similar to 26S protease regulatory subunit 6B (MIP224) (MB67 interacting protein) (TAT-binding protein-7) (TBP-7) isoform 3 n=1 Tax=Canis lupus familiaris RepID=UPI000059FEB0 Length = 433 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 392 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 433 [105][TOP] >UniRef100_UPI000179D732 26S protease regulatory subunit 6B (Proteasome 26S subunit ATPase 4). n=1 Tax=Bos taurus RepID=UPI000179D732 Length = 188 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 147 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 188 [106][TOP] >UniRef100_UPI000179D731 26S protease regulatory subunit 6B (Proteasome 26S subunit ATPase 4). n=1 Tax=Bos taurus RepID=UPI000179D731 Length = 416 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 375 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 416 [107][TOP] >UniRef100_Q8BKU2 Putative uncharacterized protein n=1 Tax=Mus musculus RepID=Q8BKU2_MOUSE Length = 418 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [108][TOP] >UniRef100_Q569X4 Proteasome (Prosome, macropain) 26S subunit, ATPase, 4 n=1 Tax=Mus musculus RepID=Q569X4_MOUSE Length = 418 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [109][TOP] >UniRef100_Q52L53 Psmc4 protein (Fragment) n=1 Tax=Mus musculus RepID=Q52L53_MOUSE Length = 215 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 174 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 215 [110][TOP] >UniRef100_Q3TJ97 Putative uncharacterized protein n=1 Tax=Mus musculus RepID=Q3TJ97_MOUSE Length = 418 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [111][TOP] >UniRef100_Q3TFA5 Putative uncharacterized protein n=1 Tax=Mus musculus RepID=Q3TFA5_MOUSE Length = 418 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [112][TOP] >UniRef100_C3Y5L7 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3Y5L7_BRAFL Length = 417 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +I Q+AGM AVR+NRY++L KDFEK Y+ +KK +T+ EFYK Sbjct: 376 SIVQEAGMLAVRENRYIVLAKDFEKAYKTAIKKDETEHEFYK 417 [113][TOP] >UniRef100_Q63570 26S protease regulatory subunit 6B n=2 Tax=Murinae RepID=PRS6B_RAT Length = 418 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [114][TOP] >UniRef100_P43686-2 Isoform 2 of 26S protease regulatory subunit 6B n=1 Tax=Homo sapiens RepID=P43686-2 Length = 387 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 346 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 387 [115][TOP] >UniRef100_P43686 26S protease regulatory subunit 6B n=4 Tax=Eutheria RepID=PRS6B_HUMAN Length = 418 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 418 [116][TOP] >UniRef100_Q66JJ6 OTTXETP00000006803 n=1 Tax=Xenopus (Silurana) tropicalis RepID=Q66JJ6_XENTR Length = 420 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ+ GM AVR+NRY++L KDFEK Y+ +KK + + EFYK Sbjct: 379 SICQEGGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 420 [117][TOP] >UniRef100_Q7RS22 26S proteasome ATPase n=1 Tax=Plasmodium yoelii yoelii RepID=Q7RS22_PLAYO Length = 636 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAI Q++GM A+RKNRY+I DFE+GYR +V+K D+EFY Sbjct: 593 AAIAQESGMQAIRKNRYIITASDFEQGYRTHVRKQLRDYEFY 634 [118][TOP] >UniRef100_Q4Z0S5 26s proteasome aaa-ATPase subunit Rpt3, putative (Fragment) n=1 Tax=Plasmodium berghei RepID=Q4Z0S5_PLABE Length = 198 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAI Q++GM A+RKNRY+I DFE+GYR +V+K D+EFY Sbjct: 155 AAIAQESGMQAIRKNRYIITASDFEQGYRTHVRKQLRDYEFY 196 [119][TOP] >UniRef100_Q4X5T6 Putative uncharacterized protein (Fragment) n=1 Tax=Plasmodium chabaudi RepID=Q4X5T6_PLACH Length = 102 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAI Q++GM A+RKNRY+I DFE+GYR +V+K D+EFY Sbjct: 59 AAIAQESGMQAIRKNRYIITANDFEQGYRTHVRKQLRDYEFY 100 [120][TOP] >UniRef100_B4N7Z7 GK11127 n=1 Tax=Drosophila willistoni RepID=B4N7Z7_DROWI Length = 389 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 +ICQ+AGMHAVR NRY++ KDFEKGY+ +V D EFY Sbjct: 348 SICQEAGMHAVRDNRYIVTFKDFEKGYKTSVPNDDAVHEFY 388 [121][TOP] >UniRef100_Q3TUN5 Putative uncharacterized protein n=1 Tax=Mus musculus RepID=Q3TUN5_MOUSE Length = 418 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/42 (54%), Positives = 34/42 (80%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 +ICQ++GM AVR+NRY+++ KDFEK Y+ +KK + + EFYK Sbjct: 377 SICQESGMLAVRENRYIVMAKDFEKAYKTVIKKDEQEHEFYK 418 [122][TOP] >UniRef100_Q5KLV5 Endopeptidase, putative n=1 Tax=Filobasidiella neoformans RepID=Q5KLV5_CRYNE Length = 414 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 A+ICQ AG+ AVRKNRYVILP DFE+ +++ VK+ D EFY+ Sbjct: 372 ASICQAAGLQAVRKNRYVILPIDFEEAWKSVVKRNDETHEFYR 414 [123][TOP] >UniRef100_Q2A769 26S protease regulatory subunit 6 n=1 Tax=Ustilago hordei RepID=Q2A769_USTHO Length = 386 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/44 (59%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKP-DTDFEFYK 157 A+ICQ AG+ AVRKNRYVI+P+DFE+ ++ VKKP D+ +FY+ Sbjct: 343 ASICQAAGLQAVRKNRYVIMPEDFEEAWKQIVKKPDDSKMDFYQ 386 [124][TOP] >UniRef100_Q4UAQ2 26s protease regulatory subunit, putative n=1 Tax=Theileria annulata RepID=Q4UAQ2_THEAN Length = 396 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAIC +AG+ A+RKNRYV+ KDFE+G++ VKK D D FY Sbjct: 353 AAICLEAGLQAIRKNRYVVTTKDFEQGWKRIVKKHDQDHPFY 394 [125][TOP] >UniRef100_Q4N3F6 26S proteasome aaa-ATPase subunit Rpt3, putative n=1 Tax=Theileria parva RepID=Q4N3F6_THEPA Length = 396 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 AAIC +AG+ A+RKNRYV+ KDFE+G++ VKK D D FY Sbjct: 353 AAICLEAGLQAIRKNRYVVTTKDFEQGWKRIVKKHDKDHPFY 394 [126][TOP] >UniRef100_A9V486 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V486_MONBE Length = 427 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 ++ICQ+AGM AVRKNRYVIL KDFE+ Y+ + K + + FYK Sbjct: 385 SSICQEAGMLAVRKNRYVILSKDFEEAYKNVIHKDEDEHTFYK 427 [127][TOP] >UniRef100_Q4QGS2 Proteasome regulatory ATPase subunittcc1l8.3, putative n=1 Tax=Leishmania major RepID=Q4QGS2_LEIMA Length = 411 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKP-DTDFEFY 160 +ICQ+AGM AVRKNRYVILP+D E YR +KK D ++FY Sbjct: 369 SICQEAGMLAVRKNRYVILPRDIENAYRTVIKKTGDETYDFY 410 [128][TOP] >UniRef100_A4HV63 Proteasome regulatory ATPase subunitt cc1l8.3, putative n=1 Tax=Leishmania infantum RepID=A4HV63_LEIIN Length = 411 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKP-DTDFEFY 160 +ICQ+AGM AVRKNRYVILP+D E YR +KK D ++FY Sbjct: 369 SICQEAGMLAVRKNRYVILPRDIENAYRTVIKKTGDETYDFY 410 [129][TOP] >UniRef100_Q8T2Y8 Proteasome regulatory ATPase subunit 3, putative n=1 Tax=Trypanosoma cruzi RepID=Q8T2Y8_TRYCR Length = 403 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKP-DTDFEFY 160 AICQ+AGM AVRKNRYV+LPKD E YR ++K D ++FY Sbjct: 361 AICQEAGMLAVRKNRYVVLPKDLEGAYRTVIRKTGDERYDFY 402 [130][TOP] >UniRef100_Q4E0K2 Proteasome regulatory ATPase subunit 3, putative n=1 Tax=Trypanosoma cruzi RepID=Q4E0K2_TRYCR Length = 403 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKP-DTDFEFY 160 AICQ+AGM AVRKNRYV+LPKD E YR ++K D ++FY Sbjct: 361 AICQEAGMLAVRKNRYVVLPKDLEGAYRTVIRKTGDERYDFY 402 [131][TOP] >UniRef100_A8NH22 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NH22_COPC7 Length = 406 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 157 A+I Q AG+ AVRKNRYVILP DFE+ ++ VK+ D EFY+ Sbjct: 364 ASIVQAAGLQAVRKNRYVILPIDFEEAWKQTVKRTDDTHEFYR 406 [132][TOP] >UniRef100_A4H6T6 Proteasome regulatory ATPase subunittcc1l8.3,putative n=1 Tax=Leishmania braziliensis RepID=A4H6T6_LEIBR Length = 361 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/42 (59%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -1 Query: 282 AICQQAGMHAVRKNRYVILPKDFEKGYRANVKKP-DTDFEFY 160 +ICQ+AGM AVRKNRYVILP+D E YR +KK + ++FY Sbjct: 319 SICQEAGMLAVRKNRYVILPRDIENAYRTVIKKTGEETYDFY 360 [133][TOP] >UniRef100_B8CAA1 26S proteasome ATPase regulatory subunit n=1 Tax=Thalassiosira pseudonana CCMP1335 RepID=B8CAA1_THAPS Length = 374 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = -1 Query: 285 AAICQQAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFY 160 A+IC +AG+ AVR+NRYV+LPKDF+K Y+ V + + FY Sbjct: 331 ASICAEAGLQAVRENRYVVLPKDFDKAYKRAVSNREKELLFY 372