[UP]
[1][TOP] >UniRef100_Q9LLC1 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=BCCP2_ARATH Length = 255 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP Sbjct: 224 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 255 [2][TOP] >UniRef100_Q6QIW2 Biotin carboxyl carrier protein n=1 Tax=Brassica napus RepID=Q6QIW2_BRANA Length = 260 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEAEKSGTI ELLAEDGKPVSVDTPLF IAP Sbjct: 229 EIEAEKSGTITELLAEDGKPVSVDTPLFTIAP 260 [3][TOP] >UniRef100_Q39350 Biotin carboxyl carrier protein n=1 Tax=Brassica napus RepID=Q39350_BRANA Length = 251 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEAEKSGTI ELLAEDGKPVSVDTPLF IAP Sbjct: 220 EIEAEKSGTITELLAEDGKPVSVDTPLFTIAP 251 [4][TOP] >UniRef100_Q39351 Biotin carboxyl carrier protein (Fragment) n=1 Tax=Brassica napus RepID=Q39351_BRANA Length = 144 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEAEKSGTI ELLAEDGKPVSVDTPLF I P Sbjct: 113 EIEAEKSGTITELLAEDGKPVSVDTPLFTIVP 144 [5][TOP] >UniRef100_Q39349 Biotin carboxyl carrier protein n=1 Tax=Brassica napus RepID=Q39349_BRANA Length = 256 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEAEKSGTI ELLAEDGKPVSVDTPLF I P Sbjct: 225 EIEAEKSGTITELLAEDGKPVSVDTPLFTIVP 256 [6][TOP] >UniRef100_Q39348 Biotin carboxyl carrier protein n=1 Tax=Brassica napus RepID=Q39348_BRANA Length = 162 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEAEKSGTI ELLAEDGKPVSVDTPLF I P Sbjct: 131 EIEAEKSGTITELLAEDGKPVSVDTPLFTIVP 162 [7][TOP] >UniRef100_B9SJD0 Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP2) n=1 Tax=Ricinus communis RepID=B9SJD0_RICCO Length = 260 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI E+LAEDGKPVSVDTPLFVI P Sbjct: 229 EIEADQSGTITEVLAEDGKPVSVDTPLFVIVP 260 [8][TOP] >UniRef100_Q84T86 Biotin carboxylase carrier protein n=1 Tax=Solanum lycopersicum RepID=Q84T86_SOLLC Length = 285 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI+E++AEDGKPVSVDTPLFVI P Sbjct: 254 EIEADRSGTIVEVVAEDGKPVSVDTPLFVIKP 285 [9][TOP] >UniRef100_B9IQ25 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IQ25_POPTR Length = 284 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA+++GTI+E+LAEDGKPVSVDTPLFVI P Sbjct: 253 EIEADQTGTIVEILAEDGKPVSVDTPLFVIEP 284 [10][TOP] >UniRef100_UPI0001984CD3 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984CD3 Length = 270 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI E+LAEDGKPVS+DTPL VIAP Sbjct: 239 EIEADQSGTIAEILAEDGKPVSIDTPLLVIAP 270 [11][TOP] >UniRef100_Q9GE06 Biotin carboxyl carrier protein subunit n=1 Tax=Glycine max RepID=Q9GE06_SOYBN Length = 284 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGT+ E++AEDGKPVSVDTPLFVI P Sbjct: 253 EIEADQSGTVAEVVAEDGKPVSVDTPLFVIVP 284 [12][TOP] >UniRef100_Q9FQ74 Biotin carboxyl carrier protein subunit n=1 Tax=Glycine max RepID=Q9FQ74_SOYBN Length = 284 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGT+ E++AEDGKPVSVDTPLFVI P Sbjct: 253 EIEADQSGTVAEVVAEDGKPVSVDTPLFVIVP 284 [13][TOP] >UniRef100_B9H0J2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H0J2_POPTR Length = 281 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI E++A DGKPVSVDTPLFVIAP Sbjct: 250 EIEADQSGTITEIVAADGKPVSVDTPLFVIAP 281 [14][TOP] >UniRef100_B5LAS8 Putative biotin carboxyl carrier protein 2 n=1 Tax=Capsicum annuum RepID=B5LAS8_CAPAN Length = 263 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA +SGTI+E++AEDGKPVSVDTPLFVI P Sbjct: 232 EIEANQSGTIVEVVAEDGKPVSVDTPLFVIKP 263 [15][TOP] >UniRef100_A9PBA1 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9PBA1_POPTR Length = 251 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI E++A DGKPVSVDTPLFVIAP Sbjct: 220 EIEADQSGTITEIVAADGKPVSVDTPLFVIAP 251 [16][TOP] >UniRef100_C6TK92 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TK92_SOYBN Length = 280 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI E+LAEDGKPVSVD PLFVI P Sbjct: 249 EIEADQSGTIAEVLAEDGKPVSVDMPLFVIVP 280 [17][TOP] >UniRef100_B9RM56 Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) n=1 Tax=Ricinus communis RepID=B9RM56_RICCO Length = 315 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI+E L EDGKPVSVDTPLFVI P Sbjct: 284 EIEADQSGTIVEALLEDGKPVSVDTPLFVIEP 315 [18][TOP] >UniRef100_C7E2U1 Biotin carboxyl carrier protein subunit n=1 Tax=Jatropha curcas RepID=C7E2U1_9ROSI Length = 270 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA+++GTI E+L EDGKPVSVD PLFVIAP Sbjct: 239 EIEADQAGTIAEILVEDGKPVSVDMPLFVIAP 270 [19][TOP] >UniRef100_C0LLW0 Acetyl-coenzyme A carboxylase (Fragment) n=1 Tax=Suaeda salsa RepID=C0LLW0_SUASA Length = 257 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI+E+LA+DGKPVSVD PLFVI P Sbjct: 226 EIEADQSGTIVEILAKDGKPVSVDMPLFVIEP 257 [20][TOP] >UniRef100_A9RL79 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RL79_PHYPA Length = 71 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI+E+LAEDGKPVS+++PLFVI P Sbjct: 40 EIEADQSGTIVEILAEDGKPVSMESPLFVIKP 71 [21][TOP] >UniRef100_B9IK64 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IK64_POPTR Length = 284 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI E+ AEDGKPVSVD+PLFVI P Sbjct: 253 EIEADQSGTITEIPAEDGKPVSVDSPLFVIVP 284 [22][TOP] >UniRef100_A9P0L3 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9P0L3_PICSI Length = 309 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 475 EIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 380 EIEA++SGTI+E+L EDGKPV+VD PLFVI P Sbjct: 278 EIEADRSGTIVEILVEDGKPVAVDMPLFVIKP 309