[UP]
[1][TOP] >UniRef100_Q9SL23 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9SL23_ARATH Length = 154 Score = 168 bits (425), Expect = 2e-40 Identities = 78/78 (100%), Positives = 78/78 (100%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDGYGGG 251 HGGHNGGGGHGLDGYGGG Sbjct: 61 HGGHNGGGGHGLDGYGGG 78 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH--GHGGHNGGGGHGLD 236 G GGGHGG G +GGGGG G GGH+GGGGHGL+ Sbjct: 112 GGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHGLN 145 [2][TOP] >UniRef100_Q8S8J7 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q8S8J7_ARATH Length = 127 Score = 168 bits (425), Expect = 2e-40 Identities = 78/78 (100%), Positives = 78/78 (100%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDGYGGG 251 HGGHNGGGGHGLDGYGGG Sbjct: 61 HGGHNGGGGHGLDGYGGG 78 [3][TOP] >UniRef100_Q2V4A2 AT2G05440 protein n=1 Tax=Arabidopsis thaliana RepID=Q2V4A2_ARATH Length = 131 Score = 168 bits (425), Expect = 2e-40 Identities = 78/78 (100%), Positives = 78/78 (100%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDGYGGG 251 HGGHNGGGGHGLDGYGGG Sbjct: 61 HGGHNGGGGHGLDGYGGG 78 [4][TOP] >UniRef100_Q2V4A1 Putative uncharacterized protein At2g05440.4 n=1 Tax=Arabidopsis thaliana RepID=Q2V4A1_ARATH Length = 147 Score = 168 bits (425), Expect = 2e-40 Identities = 78/78 (100%), Positives = 78/78 (100%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDGYGGG 251 HGGHNGGGGHGLDGYGGG Sbjct: 61 HGGHNGGGGHGLDGYGGG 78 [5][TOP] >UniRef100_Q2V4A0 Putative uncharacterized protein At2g05440.5 n=1 Tax=Arabidopsis thaliana RepID=Q2V4A0_ARATH Length = 140 Score = 168 bits (425), Expect = 2e-40 Identities = 78/78 (100%), Positives = 78/78 (100%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDGYGGG 251 HGGHNGGGGHGLDGYGGG Sbjct: 61 HGGHNGGGGHGLDGYGGG 78 [6][TOP] >UniRef100_Q2V499 Putative uncharacterized protein At2g05440.6 n=1 Tax=Arabidopsis thaliana RepID=Q2V499_ARATH Length = 113 Score = 168 bits (425), Expect = 2e-40 Identities = 78/78 (100%), Positives = 78/78 (100%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDGYGGG 251 HGGHNGGGGHGLDGYGGG Sbjct: 61 HGGHNGGGGHGLDGYGGG 78 [7][TOP] >UniRef100_Q2V498 Putative uncharacterized protein At2g05440.7 n=1 Tax=Arabidopsis thaliana RepID=Q2V498_ARATH Length = 133 Score = 168 bits (425), Expect = 2e-40 Identities = 78/78 (100%), Positives = 78/78 (100%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDGYGGG 251 HGGHNGGGGHGLDGYGGG Sbjct: 61 HGGHNGGGGHGLDGYGGG 78 [8][TOP] >UniRef100_Q2V497 Putative uncharacterized protein At2g05440.8 n=1 Tax=Arabidopsis thaliana RepID=Q2V497_ARATH Length = 114 Score = 168 bits (425), Expect = 2e-40 Identities = 78/78 (100%), Positives = 78/78 (100%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDGYGGG 251 HGGHNGGGGHGLDGYGGG Sbjct: 61 HGGHNGGGGHGLDGYGGG 78 [9][TOP] >UniRef100_Q8LGC0 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q8LGC0_ARATH Length = 127 Score = 167 bits (422), Expect = 4e-40 Identities = 77/78 (98%), Positives = 78/78 (100%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVS+ARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSSARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDGYGGG 251 HGGHNGGGGHGLDGYGGG Sbjct: 61 HGGHNGGGGHGLDGYGGG 78 [10][TOP] >UniRef100_Q9SL16 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9SL16_ARATH Length = 127 Score = 152 bits (385), Expect = 8e-36 Identities = 73/80 (91%), Positives = 75/80 (93%), Gaps = 2/80 (2%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGH--GGHGGGGG 191 MASKALILLGLF++LLVVSEVSAARQSGMVKPESE TVQPEGY GGHGGH GGH GGGG Sbjct: 1 MASKALILLGLFAILLVVSEVSAARQSGMVKPESEATVQPEGYHGGHGGHGGGGHYGGGG 60 Query: 192 HGHGGHNGGGGHGLDGYGGG 251 HGHGGHNGGGGHGLDGYGGG Sbjct: 61 HGHGGHNGGGGHGLDGYGGG 80 [11][TOP] >UniRef100_C0Z2B7 AT2G05440 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2B7_ARATH Length = 101 Score = 151 bits (381), Expect = 2e-35 Identities = 74/80 (92%), Positives = 74/80 (92%), Gaps = 2/80 (2%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGG--GHGLDGYGGG 251 HGGH GGG G G GYGGG Sbjct: 61 HGGHGGGGHYGGGGGGYGGG 80 [12][TOP] >UniRef100_C0Z2J8 AT2G05440 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2J8_ARATH Length = 109 Score = 150 bits (379), Expect = 4e-35 Identities = 74/81 (91%), Positives = 74/81 (91%), Gaps = 3/81 (3%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDG---YGGG 251 HGGH GGGG G G YGGG Sbjct: 61 HGGHYGGGGGGHGGGGHYGGG 81 [13][TOP] >UniRef100_C0Z2P2 AT2G05440 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2P2_ARATH Length = 137 Score = 147 bits (372), Expect = 3e-34 Identities = 73/82 (89%), Positives = 73/82 (89%), Gaps = 4/82 (4%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG Sbjct: 1 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 60 Query: 198 HGGHNGGGGHGLDG----YGGG 251 HGGH GGGG G YGGG Sbjct: 61 HGGHYGGGGGHYGGGGGHYGGG 82 [14][TOP] >UniRef100_B3H726 Uncharacterized protein At2g05510.5 n=1 Tax=Arabidopsis thaliana RepID=B3H726_ARATH Length = 101 Score = 142 bits (358), Expect = 1e-32 Identities = 71/81 (87%), Positives = 73/81 (90%), Gaps = 3/81 (3%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGH--GGHGGGGG 191 MASKALILLGLF++LLVVSEVSAARQSGMVKPESE TVQPEGY GGHGGH GGH GGGG Sbjct: 1 MASKALILLGLFAILLVVSEVSAARQSGMVKPESEATVQPEGYHGGHGGHGGGGHYGGGG 60 Query: 192 HGHGGHNGGGGHGLDG-YGGG 251 HGHGGHNGGGGHG G YGGG Sbjct: 61 HGHGGHNGGGGHGGGGHYGGG 81 [15][TOP] >UniRef100_Q2V496 Putative uncharacterized protein At2g05510.2 n=1 Tax=Arabidopsis thaliana RepID=Q2V496_ARATH Length = 104 Score = 138 bits (347), Expect = 2e-31 Identities = 69/80 (86%), Positives = 72/80 (90%), Gaps = 2/80 (2%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGH--GGHGGGGG 191 MASKALILLGLF++LLVVSEVSAARQSGMVKPESE TVQPEGY GGHGGH GGH GGGG Sbjct: 1 MASKALILLGLFAILLVVSEVSAARQSGMVKPESEATVQPEGYHGGHGGHGGGGHYGGGG 60 Query: 192 HGHGGHNGGGGHGLDGYGGG 251 HGHGGHNGGGG G G+GGG Sbjct: 61 HGHGGHNGGGGGG--GHGGG 78 [16][TOP] >UniRef100_Q9FR52 Antimicrobial peptide shep-GRP n=1 Tax=Capsella bursa-pastoris RepID=Q9FR52_CAPBU Length = 120 Score = 137 bits (344), Expect = 5e-31 Identities = 68/80 (85%), Positives = 71/80 (88%), Gaps = 2/80 (2%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYG--GGHGGHGGHGGGGG 191 MASK LILLGLF++LLVVSEVSAAR+SGMVKPESEETVQPEGYG GGHGGHGGHGG GG Sbjct: 1 MASKTLILLGLFAILLVVSEVSAARESGMVKPESEETVQPEGYGGHGGHGGHGGHGGHGG 60 Query: 192 HGHGGHNGGGGHGLDGYGGG 251 HGH GGGGHGLDGY GG Sbjct: 61 HGH----GGGGHGLDGYHGG 76 [17][TOP] >UniRef100_Q2V2S2 Putative uncharacterized protein At2g05510.3 n=1 Tax=Arabidopsis thaliana RepID=Q2V2S2_ARATH Length = 90 Score = 129 bits (325), Expect = 8e-29 Identities = 66/80 (82%), Positives = 69/80 (86%), Gaps = 2/80 (2%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGH--GGHGGGGG 191 MASKALILLGLF++LLVVSEVSAARQSGMVKPESE TVQPEGY GGHGGH GGH GGGG Sbjct: 1 MASKALILLGLFAILLVVSEVSAARQSGMVKPESEATVQPEGYHGGHGGHGGGGHYGGGG 60 Query: 192 HGHGGHNGGGGHGLDGYGGG 251 HG GGH GGGGH +GGG Sbjct: 61 HGGGGHYGGGGH----HGGG 76 [18][TOP] >UniRef100_B3H6I3 Uncharacterized protein At2g05510.6 n=1 Tax=Arabidopsis thaliana RepID=B3H6I3_ARATH Length = 93 Score = 127 bits (320), Expect = 3e-28 Identities = 64/84 (76%), Positives = 69/84 (82%), Gaps = 11/84 (13%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGH---------- 167 MASKALILLGLF++LLVVSEVSAARQSGMVKPESE TVQPEGY GGHGGH Sbjct: 1 MASKALILLGLFAILLVVSEVSAARQSGMVKPESEATVQPEGYHGGHGGHYGGGGGHYGG 60 Query: 168 -GGHGGGGGHGHGGHNGGGGHGLD 236 GGHGGGG +G GGH+GGGGHGL+ Sbjct: 61 GGGHGGGGHYGGGGHHGGGGHGLN 84 [19][TOP] >UniRef100_Q9SL14 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9SL14_ARATH Length = 115 Score = 107 bits (266), Expect = 5e-22 Identities = 55/79 (69%), Positives = 64/79 (81%), Gaps = 1/79 (1%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGH- 194 MASKAL+L GLF+VLLVV+EV+AA SG VK ES ETVQP+ Y GGHGG+GG+ GGGG+ Sbjct: 1 MASKALVLFGLFAVLLVVTEVAAA--SGTVKSESGETVQPDQYNGGHGGNGGYNGGGGYN 58 Query: 195 GHGGHNGGGGHGLDGYGGG 251 G GGHNGGG +G GY GG Sbjct: 59 GGGGHNGGGYNGGGGYNGG 77 [20][TOP] >UniRef100_A8MQZ5 Uncharacterized protein At2g05510.4 n=1 Tax=Arabidopsis thaliana RepID=A8MQZ5_ARATH Length = 99 Score = 107 bits (266), Expect = 5e-22 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +3 Query: 102 MVKPESEETVQPEGYGGGHGGHGG--HGGGGGHGHGGHNGGGGHGLDGYGGG 251 MVKPESE TVQPEGY GGHGGHGG H GGGGHGHGGHNGGGGHGLDGYGGG Sbjct: 1 MVKPESEATVQPEGYHGGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGG 52 [21][TOP] >UniRef100_Q8W157 Glycine-rich protein n=1 Tax=Brassica oleracea RepID=Q8W157_BRAOL Length = 124 Score = 94.0 bits (232), Expect = 5e-18 Identities = 46/78 (58%), Positives = 59/78 (75%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKAL+LLGLF++L V+SEV+A + +K ESE+T+QP+ GG GG G +GGGG +G Sbjct: 1 MASKALVLLGLFALLFVISEVAATSEGQSLKSESEDTLQPDHSGG--GGQGYNGGGGYNG 58 Query: 198 HGGHNGGGGHGLDGYGGG 251 GG+NGGG HG GY GG Sbjct: 59 RGGYNGGGHHGGGGYNGG 76 [22][TOP] >UniRef100_Q9ZSJ6 Glycine-rich protein 3 short isoform n=1 Tax=Arabidopsis thaliana RepID=Q9ZSJ6_ARATH Length = 116 Score = 89.0 bits (219), Expect = 2e-16 Identities = 49/79 (62%), Positives = 57/79 (72%), Gaps = 1/79 (1%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKAL+LLGLF+ L +VSE++AA G VK ESEETV+PE +GGG G +GG GG G Sbjct: 1 MASKALLLLGLFAFLFIVSEMAAA---GTVKSESEETVKPEQHGGGFGDNGGGRYQGGGG 57 Query: 198 HGGHNGGGGHGLDG-YGGG 251 HGGH GGG G G Y GG Sbjct: 58 HGGHGGGGYQGGGGRYQGG 76 [23][TOP] >UniRef100_Q9SHT6 Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q9SHT6_ARATH Length = 116 Score = 87.4 bits (215), Expect = 4e-16 Identities = 48/79 (60%), Positives = 56/79 (70%), Gaps = 1/79 (1%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASK L+LLGLF+ L +VSE++AA G VK ESEETV+PE +GGG G +GG GG G Sbjct: 1 MASKTLLLLGLFAFLFIVSEMAAA---GTVKSESEETVKPEQHGGGFGDNGGGRYQGGGG 57 Query: 198 HGGHNGGGGHGLDG-YGGG 251 HGGH GGG G G Y GG Sbjct: 58 HGGHGGGGYQGGGGRYQGG 76 [24][TOP] >UniRef100_Q8L5Z5 Putative uncharacterized protein At2g05380 n=1 Tax=Arabidopsis thaliana RepID=Q8L5Z5_ARATH Length = 116 Score = 87.4 bits (215), Expect = 4e-16 Identities = 48/79 (60%), Positives = 56/79 (70%), Gaps = 1/79 (1%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASK L+LLGLF+ L +VSE++AA G VK ESEETV+PE +GGG G +GG GG G Sbjct: 1 MASKTLLLLGLFAFLFIVSEMAAA---GTVKSESEETVKPEQHGGGFGDNGGGRYQGGGG 57 Query: 198 HGGHNGGGGHGLDG-YGGG 251 HGGH GGG G G Y GG Sbjct: 58 HGGHGGGGYQGGGGRYQGG 76 [25][TOP] >UniRef100_C0Z2S1 AT2G05380 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2S1_ARATH Length = 102 Score = 78.6 bits (192), Expect = 2e-13 Identities = 49/87 (56%), Positives = 58/87 (66%), Gaps = 10/87 (11%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGG--HGGGGG 191 MASK L+LLGLF+ L +VSE++AA G VK ESEETV+PE +GGG G +GG + GGGG Sbjct: 1 MASKTLLLLGLFAFLFIVSEMAAA---GTVKSESEETVKPEQHGGGFGDNGGGRYQGGGG 57 Query: 192 --HGHGGHNGGGG----HG--LDGYGG 248 G GG GGGG HG GY G Sbjct: 58 RYQGGGGRQGGGGSYCRHGCCYKGYHG 84 [26][TOP] >UniRef100_Q9SL15 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9SL15_ARATH Length = 145 Score = 77.4 bits (189), Expect = 5e-13 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 7/84 (8%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPE--GY---GGGHGGHGGHGG 182 MASKAL+LLGLF+VLLVVSEV+AA S V ES+ETV+P+ GY GG + GG+ G Sbjct: 1 MASKALVLLGLFAVLLVVSEVAAA-SSATVNSESKETVKPDQRGYGDNGGNYNNGGGYQG 59 Query: 183 GGGH--GHGGHNGGGGHGLDGYGG 248 GGG+ G GG+ GGG G GG Sbjct: 60 GGGNYQGGGGNYQGGGGNYQGGGG 83 [27][TOP] >UniRef100_Q41189 Glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q41189_ARATH Length = 145 Score = 77.4 bits (189), Expect = 5e-13 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 7/84 (8%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPE--GY---GGGHGGHGGHGG 182 MASKAL+LLGLF+VLLVVSEV+AA S V ES+ETV+P+ GY GG + GG+ G Sbjct: 1 MASKALVLLGLFAVLLVVSEVAAA-SSATVNSESKETVKPDQRGYGDNGGNYNNGGGYQG 59 Query: 183 GGGH--GHGGHNGGGGHGLDGYGG 248 GGG+ G GG+ GGG G GG Sbjct: 60 GGGNYQGGGGNYQGGGGNYQGGGG 83 [28][TOP] >UniRef100_C0Z2F8 AT2G05520 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2F8_ARATH Length = 112 Score = 77.4 bits (189), Expect = 5e-13 Identities = 46/81 (56%), Positives = 54/81 (66%), Gaps = 3/81 (3%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKAL+LLGLF+VLLVVSEV+AA S V ES+ETV+P+ G G G G + GGGG Sbjct: 1 MASKALVLLGLFAVLLVVSEVAAA-SSATVNSESKETVKPDQRGYGDNGGGRYQGGGGRY 59 Query: 198 HGG---HNGGGGHGLDGYGGG 251 GG + GGGG G GG Sbjct: 60 QGGGGRYQGGGGRQGGGGSGG 80 [29][TOP] >UniRef100_Q2V495 Putative uncharacterized protein At2g05520.2 n=1 Tax=Arabidopsis thaliana RepID=Q2V495_ARATH Length = 138 Score = 77.0 bits (188), Expect = 6e-13 Identities = 44/77 (57%), Positives = 52/77 (67%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKAL+LLGLF+VLLVVSEV+AA S V ES+ETV+P+ G G G + GGG G Sbjct: 1 MASKALVLLGLFAVLLVVSEVAAA-SSATVNSESKETVKPDQRGYGDNGGNYNNGGGYQG 59 Query: 198 HGGHNGGGGHGLDGYGG 248 GG+ GGG G GG Sbjct: 60 GGGNYQGGGGNYQGGGG 76 [30][TOP] >UniRef100_B6EUC6 Putative uncharacterized protein At2g05520.6 n=1 Tax=Arabidopsis thaliana RepID=B6EUC6_ARATH Length = 117 Score = 77.0 bits (188), Expect = 6e-13 Identities = 48/86 (55%), Positives = 58/86 (67%), Gaps = 8/86 (9%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPE--GY---GGGHGGHGGHGG 182 MASKAL+LLGLF+VLLVVSEV+AA S V ES+ETV+P+ GY GG + GG+ G Sbjct: 1 MASKALVLLGLFAVLLVVSEVAAA-SSATVNSESKETVKPDQRGYGDNGGNYNNGGGYQG 59 Query: 183 GGGHGHGG---HNGGGGHGLDGYGGG 251 GGG+ GG + GGGG G GG Sbjct: 60 GGGNYQGGGGRYQGGGGRQGGGGSGG 85 [31][TOP] >UniRef100_Q8H799 Putative uncharacterized protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q8H799_ARATH Length = 82 Score = 76.3 bits (186), Expect = 1e-12 Identities = 46/76 (60%), Positives = 55/76 (72%), Gaps = 7/76 (9%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPE--GY---GGGHGGHGGHGG 182 MASKAL+LLGLF+VLLVVSEV+AA S V ES+ETV+P+ GY GG + GG+ G Sbjct: 1 MASKALVLLGLFAVLLVVSEVAAA-SSATVNSESKETVKPDQRGYGDNGGNYNNGGGYQG 59 Query: 183 GGGH--GHGGHNGGGG 224 GGG+ G GG GGGG Sbjct: 60 GGGNYQGGGGRQGGGG 75 [32][TOP] >UniRef100_Q2V494 Putative uncharacterized protein At2g05520.3 n=1 Tax=Arabidopsis thaliana RepID=Q2V494_ARATH Length = 125 Score = 76.3 bits (186), Expect = 1e-12 Identities = 45/78 (57%), Positives = 54/78 (69%), Gaps = 1/78 (1%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYG-GGHGGHGGHGGGGGH 194 MASKAL+LLGLF+VLLVVSEV+AA S V ES+ETV+P+ G G +GG+ +GGG Sbjct: 1 MASKALVLLGLFAVLLVVSEVAAA-SSATVNSESKETVKPDQRGYGDNGGNYNNGGGNYQ 59 Query: 195 GHGGHNGGGGHGLDGYGG 248 G GG GGG G GG Sbjct: 60 GGGGRYQGGGGRYQGGGG 77 [33][TOP] >UniRef100_B3H766 Uncharacterized protein At2g05520.4 n=1 Tax=Arabidopsis thaliana RepID=B3H766_ARATH Length = 124 Score = 76.3 bits (186), Expect = 1e-12 Identities = 44/77 (57%), Positives = 52/77 (67%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKAL+LLGLF+VLLVVSEV+AA S V ES+ETV+P+ G G G + GGG G Sbjct: 1 MASKALVLLGLFAVLLVVSEVAAA-SSATVNSESKETVKPDQRGYGDNGGNYNNGGGYQG 59 Query: 198 HGGHNGGGGHGLDGYGG 248 GG+ GGG G GG Sbjct: 60 GGGNYQGGGGRYQGGGG 76 [34][TOP] >UniRef100_UPI00005DBFDC GRP-3 (GLYCINE-RICH PROTEIN 3) n=1 Tax=Arabidopsis thaliana RepID=UPI00005DBFDC Length = 111 Score = 75.1 bits (183), Expect = 2e-12 Identities = 48/79 (60%), Positives = 57/79 (72%), Gaps = 8/79 (10%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPE--GYG--GGHGGHGG--HG 179 MASKAL+LLGLF+VLLVVSEV+AA S V ES+ETV+P+ GYG GG+ +GG + Sbjct: 1 MASKALVLLGLFAVLLVVSEVAAA-SSATVNSESKETVKPDQRGYGDNGGNYNNGGGRYQ 59 Query: 180 GGGG--HGHGGHNGGGGHG 230 GGGG G GG GGGG G Sbjct: 60 GGGGRYQGGGGRQGGGGSG 78 [35][TOP] >UniRef100_Q2PF07 Putative uncharacterized protein (Fragment) n=1 Tax=Trifolium pratense RepID=Q2PF07_TRIPR Length = 149 Score = 72.8 bits (177), Expect = 1e-11 Identities = 42/76 (55%), Positives = 50/76 (65%), Gaps = 2/76 (2%) Frame = +3 Query: 27 KALILLGLFS-VLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGH-GH 200 K +++LGL + VLL+ SEVSA + E V +GG HGGHGGHGG GGH GH Sbjct: 5 KTMLILGLLAMVLLISSEVSARDLTNKEAVEETNDVNDAKFGG-HGGHGGHGGHGGHGGH 63 Query: 201 GGHNGGGGHGLDGYGG 248 GGH GGGGHG G+GG Sbjct: 64 GGH-GGGGHG--GHGG 76 [36][TOP] >UniRef100_A7Y7I2 Putative glycine-rich protein (Fragment) n=1 Tax=Prunus dulcis RepID=A7Y7I2_PRUDU Length = 113 Score = 72.0 bits (175), Expect = 2e-11 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 5/85 (5%) Frame = +3 Query: 12 QKMAS-KALILLGL-FSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGG 185 Q MAS KA +LLGL F+VLL+ SEVSA P E V +G+G HGG+G GG Sbjct: 22 QNMASSKAFLLLGLVFAVLLISSEVSAT-------PTQESIVNGDGHG--HGGYGHGHGG 72 Query: 186 GGHGHGGH---NGGGGHGLDGYGGG 251 GHGHGGH +GG GHG GYG G Sbjct: 73 YGHGHGGHSHGHGGYGHGHGGYGHG 97 [37][TOP] >UniRef100_UPI0001792203 PREDICTED: similar to eukaryotic translation initiation factor 3 subunit 8 n=1 Tax=Acyrthosiphon pisum RepID=UPI0001792203 Length = 911 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGG 248 GGGHGGHGGHGG GGHGHGGH G GGHG G+GG Sbjct: 866 GGGHGGHGGHGGHGGHGHGGHGGHGGHG--GHGG 897 [38][TOP] >UniRef100_B9SSP9 Glycine-rich protein DC7.1, putative n=1 Tax=Ricinus communis RepID=B9SSP9_RICCO Length = 91 Score = 68.9 bits (167), Expect = 2e-10 Identities = 39/81 (48%), Positives = 51/81 (62%), Gaps = 6/81 (7%) Frame = +3 Query: 24 SKALILLGL-FSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGG-GHG 197 SK +LLGL F+V+L++S +AR+ +++E + EGYG GHG GHG GG GHG Sbjct: 4 SKTFLLLGLAFAVVLLISSQVSARELAETV-QAQENAEVEGYGHGHGHGHGHGHGGYGHG 62 Query: 198 HGG----HNGGGGHGLDGYGG 248 HGG H GG HG G+GG Sbjct: 63 HGGYGKGHGHGGRHGKPGHGG 83 [39][TOP] >UniRef100_Q39754 GRPF1 n=1 Tax=Fagus sylvatica RepID=Q39754_FAGSY Length = 156 Score = 66.6 bits (161), Expect = 8e-10 Identities = 41/82 (50%), Positives = 45/82 (54%), Gaps = 4/82 (4%) Frame = +3 Query: 18 MASKALILLGLF--SVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGH--GGHGGG 185 M S+A I L L SVLL+ S V+ KPE V YGG +GGH GGHGGG Sbjct: 1 MNSRAFIFLALLFASVLLISSAVATKTSKDEEKPEESNPVDDTKYGG-YGGHYGGGHGGG 59 Query: 186 GGHGHGGHNGGGGHGLDGYGGG 251 G GHGG GGG G G GGG Sbjct: 60 YGGGHGGGYGGGHGGRGGGGGG 81 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGG 224 GYGGGHGGHGGHGGG G GHGG GGGG Sbjct: 108 GYGGGHGGHGGHGGGHGGGHGG--GGGG 133 [40][TOP] >UniRef100_A9VAA3 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VAA3_MONBE Length = 948 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+GG HGGHGGHGG GGHG G+ GGGG+G GYGGG Sbjct: 812 GHGGHHGGHGGHGGHGGHGGHGNYGGGGYGGGGYGGG 848 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 5/42 (11%) Frame = +3 Query: 141 GYGGGHGGHGGHGG--GGGHGHGGHNGGGGHGL---DGYGGG 251 G+GGG+GGHGGHGG GG GHGGH G GGHG GYGGG Sbjct: 802 GHGGGYGGHGGHGGHHGGHGGHGGHGGHGGHGNYGGGGYGGG 843 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/42 (57%), Positives = 28/42 (66%), Gaps = 5/42 (11%) Frame = +3 Query: 141 GYGGGHGGHGGHG-----GGGGHGHGGHNGGGGHGLDGYGGG 251 G GGHGGHGGHG GGGG+G GG+ GG G+ +GGG Sbjct: 818 GGHGGHGGHGGHGGHGNYGGGGYGGGGYGGGSGYSNSNFGGG 859 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/44 (63%), Positives = 29/44 (65%), Gaps = 7/44 (15%) Frame = +3 Query: 141 GYGGGH----GGHGGHGGGGGH--GHGGHNGGGGHGLDG-YGGG 251 GY G GG+GGHGG GGH GHGGH G GGHG G YGGG Sbjct: 795 GYAGAMRGHGGGYGGHGGHGGHHGGHGGHGGHGGHGGHGNYGGG 838 [41][TOP] >UniRef100_Q5Z4P8 cDNA clone:001-103-C11, full insert sequence n=1 Tax=Oryza sativa Japonica Group RepID=Q5Z4P8_ORYSJ Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 15/93 (16%) Frame = +3 Query: 18 MASKALILLGLF--SVLLVVSEVSAARQSGM--------VKPESEETVQPEGYGGGHGG- 164 MA K L+LLG+F ++L +V+ AR+ VKP V+ + +GG HGG Sbjct: 1 MARKNLLLLGVFLSALLFFFLDVAHARELAEASESEGKNVKPTGRSGVEDQKWGGAHGGG 60 Query: 165 --HGGHGGGGGHGHGGHNG--GGGHGLDGYGGG 251 +GG GGGG+GH G+ G GGG+G GYGGG Sbjct: 61 YGYGGGYGGGGYGHPGYGGGYGGGYGHPGYGGG 93 [42][TOP] >UniRef100_Q5Z4P7 Os06g0317200 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5Z4P7_ORYSJ Length = 136 Score = 65.9 bits (159), Expect = 1e-09 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 15/93 (16%) Frame = +3 Query: 18 MASKALILLGLF--SVLLVVSEVSAARQSGM--------VKPESEETVQPEGYGGGHGG- 164 MA K L+LLG+F ++L +V+ AR+ VKP V+ + +GG HGG Sbjct: 1 MARKNLLLLGVFLSALLFFFLDVAHARELAEASESEGKNVKPTGRSGVEDQKWGGAHGGG 60 Query: 165 --HGGHGGGGGHGHGGHNG--GGGHGLDGYGGG 251 +GG GGGG+GH G+ G GGG+G GYGGG Sbjct: 61 YGYGGGYGGGGYGHPGYGGGYGGGYGHPGYGGG 93 [43][TOP] >UniRef100_Q5Z4P5 Os06g0317400 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5Z4P5_ORYSJ Length = 153 Score = 65.9 bits (159), Expect = 1e-09 Identities = 44/115 (38%), Positives = 58/115 (50%), Gaps = 37/115 (32%) Frame = +3 Query: 18 MASKALILLGLF--SVLLVVSEVSAARQSGMVKPESEETVQPE----------------- 140 MASK+L+LL + S+LLV EV+AAR+ + ++PE Sbjct: 1 MASKSLLLLSVVVASLLLVAQEVAAARELTEANEAKGKNMEPEVVHVPQDEKIAYHGDGY 60 Query: 141 ----GYGGGHG-------------GHGGHGGGGGHGHGGHNGGGGH-GLDGYGGG 251 GYGGG+G G+GG+GGG G G+GG GGGG+ G GYGGG Sbjct: 61 GHGGGYGGGYGSGYGGGNGGGYGGGYGGYGGGYGGGYGGGGGGGGYGGYGGYGGG 115 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/41 (60%), Positives = 30/41 (73%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGG----GHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG+GG+GGGG G G+GG GGGG+G GY GG Sbjct: 101 GGGGGYGGYGGYGGGGYEGYGRGYGGGGGGGGYGGGGYPGG 141 [44][TOP] >UniRef100_A2R295 Putative uncharacterized protein n=1 Tax=Aspergillus niger CBS 513.88 RepID=A2R295_ASPNC Length = 294 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/39 (76%), Positives = 30/39 (76%), Gaps = 5/39 (12%) Frame = +3 Query: 150 GGHGGHGGHGGGGGHG-HGGHNG----GGGHGLDGYGGG 251 GGHGGHGGHGG GGHG HGGH G GGGHG DG GGG Sbjct: 248 GGHGGHGGHGGHGGHGGHGGHGGDGGHGGGHGGDGGGGG 286 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/37 (75%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGHGGHGGHGG GGHG GGH G GG G DG GGG Sbjct: 257 GGHGGHGGHGGHGGDGGHG-GGHGGDGGGGGDGGGGG 292 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGG 248 G GGHGGHGG GG GG GHGG GGGG G G GG Sbjct: 260 GGHGGHGGHGGDGGHGG-GHGGDGGGGGDGGGGGGG 294 [45][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP CPP P PPPPP PPCPP PPP P Sbjct: 291 PPPCPPPP-PPPPPCPPPPPPPPPPPPPCPPPPPPPP 326 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PPCP P PPP PPCPP PPP P Sbjct: 266 PPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPP 302 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPC-PPWPPP*PSGC 131 PPP P P PPPP PPCP PPPPP PPC PP PPP P C Sbjct: 301 PPPCPPPPPPPPPPPPPCPPPPPPP-PPCPPPCPPPCPPPC 340 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPP-CPWPPPPP*PPCPPWPPP*PSGC 131 PPP P P P PP CPP CP PPPPP PP PP PPP P C Sbjct: 243 PPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPC 283 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 8/45 (17%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPP--------CPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP CPP CP PPPPP PPCPP PPP P Sbjct: 269 PPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPP-PPCPPPPPPPP 312 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PPCP PPPPP PP PP PPP P Sbjct: 289 PPPPPCPPPPPPP--PPCPPPPPPPPPPPPPCPPPPP 323 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/56 (50%), Positives = 29/56 (51%), Gaps = 14/56 (25%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPC------PWPPPP--------P*PPCPPWPPP*PSGCTV 125 PPP P P PPPP PPC P PPPP P PPCPP PPP P C + Sbjct: 315 PPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPPCPPPPPPCPPACPI 370 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*-PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PPCPP PPP P Sbjct: 258 PPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCP 295 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGC 131 PPP P PPPP CPP P PPPPP PP PP PPP P C Sbjct: 280 PPPCPPPCPPPPPPCPPPP-PPPPPCPPPPPPPPPPPPPC 318 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGC 131 PPP P P PPP PP P PPPPP PP PP PPP P C Sbjct: 248 PPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPC 287 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGC 131 PP P P PPPP PP P PPPPP PPCPP PP P C Sbjct: 255 PPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPC 294 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPP-PPP*PPCPPWPPP*PSGC 131 PPP P P PPPP PP P PP PPP PP PP PPP P C Sbjct: 296 PPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPC 336 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPC-PPWPPP*P 140 PPP P P PPPP CPP P PPPP PPC PP PPP P Sbjct: 305 PPPPPPPP-PPPPPCPPPPPPPPPCPPPCPPPCPPPCP 341 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWP-PPPP*PPCPPWPPP*P 140 PPP P P PPPP PPCP P PPP PPCPP PPP P Sbjct: 312 PPPPPPCP-PPPPPPPPCPPPCPPPCPPPCPPPPPPCP 348 Score = 53.9 bits (128), Expect = 5e-06 Identities = 32/68 (47%), Positives = 34/68 (50%), Gaps = 6/68 (8%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPP--CPWPP-PPP*PPCP---PWPPP*PSGCTVSSLSGFTMPDCL 89 PPP P PPPP CPP CP PP PPP PPCP P PPP V + S T Sbjct: 333 PPPCPPPCPPPPPPCPPPPCPPPPCPPPPPPCPPACPIPPPPMETTEVETQSETTTETGT 392 Query: 88 AADTSETT 65 TS +T Sbjct: 393 GTKTSTST 400 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 5/42 (11%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*-----PPCPPWPPP*P 140 PPP P P P PP CPP P PPPPP PP PP PPP P Sbjct: 247 PPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCP 288 [46][TOP] >UniRef100_UPI000179202A PREDICTED: similar to cuticular protein CPG12 n=1 Tax=Acyrthosiphon pisum RepID=UPI000179202A Length = 499 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 GGGHGG GGHGGGGGH G GG+ GGGGHG G+G G Sbjct: 215 GGGHGGGGGHGGGGGHGGGGGYGGGGGHGGGGFGAG 250 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGGHGG GGHGGGGG+G GG +GGGG G G+G G Sbjct: 219 GGGGGHGGGGGHGGGGGYGGGGGHGGGGFGAGGFGSG 255 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG G GGHGGGGGHG GG +GGGG GYGGG Sbjct: 207 GYGGGGFGGGGHGGGGGHGGGGGHGGGG----GYGGG 239 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGG-GHGLDGYGGG 251 G GGGHGG GG+GGGGGHG GG GG G G GYG G Sbjct: 225 GGGGGHGGGGGYGGGGGHGGGGFGAGGFGSGGHGYGHG 262 [47][TOP] >UniRef100_Q42448 Abscisic acid-and environmental stress-inducible protein protein (Fragment) n=1 Tax=Medicago sativa RepID=Q42448_MEDSA Length = 191 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGG 248 GY G GGHGGHGG GGHG GG+NGGGGHG G+GG Sbjct: 66 GYNHGGGGHGGHGGHGGHGGGGYNGGGGHG--GHGG 99 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = +3 Query: 150 GGHGGHGGHGGGG--GHGHGGHNGGGGHGLDGYGG 248 GGHGG G +GGGG GHG GG+NGGGGHG G+GG Sbjct: 2 GGHGGGGYNGGGGHGGHGGGGYNGGGGHG--GHGG 34 [48][TOP] >UniRef100_Q0E7L3 Putative glycine rich protein n=1 Tax=Pisum sativum RepID=Q0E7L3_PEA Length = 171 Score = 63.9 bits (154), Expect = 5e-09 Identities = 44/95 (46%), Positives = 54/95 (56%), Gaps = 24/95 (25%) Frame = +3 Query: 36 ILLGLFSVLLVV-SEVSA---ARQSGMVKPE----SEETVQPEGYGGGHG---GHG---- 170 ++LGL +++LV+ SEVSA A S K E S E + YGGG+G GHG Sbjct: 8 LILGLLAMVLVISSEVSARELAETSTNAKEEVAEKSNEVNDAKYYGGGYGHGYGHGYGHG 67 Query: 171 ----GHGGGGGHGHG-----GHNGGGGHGLDGYGG 248 GHGGGGG+GHG GH GGGG+G G GG Sbjct: 68 HGGYGHGGGGGYGHGGGGGYGHGGGGGYGHGGGGG 102 [49][TOP] >UniRef100_A2YC94 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YC94_ORYSI Length = 88 Score = 63.9 bits (154), Expect = 5e-09 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 2/80 (2%) Frame = +3 Query: 18 MASKALILLG--LFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGG 191 MA+K+LIL G L S+LLV +V AAR+ P GYGGG G GG+GGG G Sbjct: 1 MAAKSLILFGVLLASLLLVSQDVVAARELTEAHGYGGRYGSP-GYGGGSGYGGGYGGGYG 59 Query: 192 HGHGGHNGGGGHGLDGYGGG 251 G+GG +G GG G GYGGG Sbjct: 60 GGYGGGSGYGGGG--GYGGG 77 [50][TOP] >UniRef100_B0KTL4 Putative uncharacterized protein n=1 Tax=Pseudomonas putida GB-1 RepID=B0KTL4_PSEPG Length = 208 Score = 63.2 bits (152), Expect = 9e-09 Identities = 35/80 (43%), Positives = 41/80 (51%) Frame = +3 Query: 9 LQKMASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGG 188 L K A A + G+ S +V+ S S + G GGGHGG GG GGGG Sbjct: 6 LFKKALLAAAVAGVLSTSIVLIPDSITHGSSAYAKDGGGGGGGHGGGGGHGGGGGSGGGG 65 Query: 189 GHGHGGHNGGGGHGLDGYGG 248 GHG GG +GGGGHG G G Sbjct: 66 GHGGGGGSGGGGHGGGGGSG 85 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 6/43 (13%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNG------GGGHGLDGYGGG 251 G GGG GG GGHGGGGG G GGH G GGGHG G GGG Sbjct: 56 GGGGGSGGGGGHGGGGGSGGGGHGGGGGSGSGGGHGSGGDGGG 98 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/76 (42%), Positives = 38/76 (50%), Gaps = 8/76 (10%) Frame = +3 Query: 48 LFSVLLVVSEVSAARQSGMVKPESEETVQPEGYG-GGHGGHGGHGGGGGH-------GHG 203 LF L+ + V+ + +V T Y G GG GGHGGGGGH G G Sbjct: 6 LFKKALLAAAVAGVLSTSIVLIPDSITHGSSAYAKDGGGGGGGHGGGGGHGGGGGSGGGG 65 Query: 204 GHNGGGGHGLDGYGGG 251 GH GGGG G G+GGG Sbjct: 66 GHGGGGGSGGGGHGGG 81 [51][TOP] >UniRef100_Q5Z4P9 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5Z4P9_ORYSJ Length = 102 Score = 63.2 bits (152), Expect = 9e-09 Identities = 41/96 (42%), Positives = 55/96 (57%), Gaps = 18/96 (18%) Frame = +3 Query: 18 MASKALILLGLF--SVLLVVSEVSAARQSGM--------VKPESEETVQPEGYGGGHGG- 164 MA K L+LLG+F ++L +V+ AR+ VKP V+ + +GG HGG Sbjct: 1 MARKNLLLLGVFLSALLFFFLDVAHARELAEASESEGKNVKPTGRSGVEDQKWGGAHGGG 60 Query: 165 --HGGHGGGGGHGH----GGHNGGGGH-GLDGYGGG 251 +GG GGGG+GH GG+ GGGG+ G GYGGG Sbjct: 61 YGYGGGYGGGGYGHPGYGGGYGGGGGYGGGGGYGGG 96 [52][TOP] >UniRef100_B8B140 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B140_ORYSI Length = 136 Score = 63.2 bits (152), Expect = 9e-09 Identities = 40/93 (43%), Positives = 53/93 (56%), Gaps = 15/93 (16%) Frame = +3 Query: 18 MASKALILLG--LFSVLLVVSEVSAARQSGM--------VKPESEETVQPEGYGGGHGG- 164 MA K L+LLG L ++L +V+ AR+ VKP V+ + +GG HGG Sbjct: 1 MARKNLLLLGVLLSALLFFFLDVAHARELAEASESEGKNVKPTGGSGVEDQKWGGAHGGG 60 Query: 165 --HGGHGGGGGHGHGGHNG--GGGHGLDGYGGG 251 +GG GGGG+GH G+ G GGG+G GYGGG Sbjct: 61 YGYGGGYGGGGYGHPGYGGGYGGGYGHPGYGGG 93 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG+GG G G GGG+ H GH GG G G GYGGG Sbjct: 89 GYGGGYGGGYGQGYGGGYSHPGHGGGYGGG-GGYGGG 124 [53][TOP] >UniRef100_B4FTV4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FTV4_MAIZE Length = 196 Score = 63.2 bits (152), Expect = 9e-09 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 2/70 (2%) Frame = +3 Query: 48 LFSVLLVVSEVSAARQSGMVKPE--SEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGG 221 L +VL++V S S ++ + +E+ GYGGG GG+GG+GGGGG G GG+ GGG Sbjct: 7 LVAVLILVGVASRCSGSRGLQGDHVAEQKFGGGGYGGG-GGYGGYGGGGGGGGGGYGGGG 65 Query: 222 GHGLDGYGGG 251 G G GYGGG Sbjct: 66 GGGGGGYGGG 75 [54][TOP] >UniRef100_C1MZL6 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MZL6_9CHLO Length = 281 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GGG GGHGG GGGGG GHGG GGGGHG G GGG Sbjct: 223 GGGGGGHGGGGGGGGGGHGGGGGGGGHGGAGGGGG 257 [55][TOP] >UniRef100_UPI0000E127A2 Os06g0317400 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E127A2 Length = 160 Score = 62.4 bits (150), Expect = 2e-08 Identities = 47/122 (38%), Positives = 62/122 (50%), Gaps = 44/122 (36%) Frame = +3 Query: 18 MASKALILLGLF--SVLLVVSEVSAARQ----SGM-----------VKPESEETVQPE-- 140 MASK+L+LL + S+LLV EV+AAR+ +G+ ++PE Q E Sbjct: 1 MASKSLLLLSVVVASLLLVAQEVAAARELTEANGLQLLSDSSKGKNMEPEVVHVPQDEKI 60 Query: 141 -----------GYGGGHG-------------GHGGHGGGGGHGHGGHNGGGGH-GLDGYG 245 GYGGG+G G+GG+GGG G G+GG GGGG+ G GYG Sbjct: 61 AYHGDGYGHGGGYGGGYGSGYGGGNGGGYGGGYGGYGGGYGGGYGGGGGGGGYGGYGGYG 120 Query: 246 GG 251 GG Sbjct: 121 GG 122 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/41 (60%), Positives = 30/41 (73%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGG----GHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG+GG+GGGG G G+GG GGGG+G GY GG Sbjct: 108 GGGGGYGGYGGYGGGGYEGYGRGYGGGGGGGGYGGGGYPGG 148 [56][TOP] >UniRef100_Q7Y087 GBR5 n=1 Tax=Panax ginseng RepID=Q7Y087_PANGI Length = 123 Score = 62.4 bits (150), Expect = 2e-08 Identities = 44/96 (45%), Positives = 53/96 (55%), Gaps = 19/96 (19%) Frame = +3 Query: 21 ASKALILLGLFS--VLLVVSEVSA-----ARQSGMVKPESEETVQPE----GYGGG---- 155 ++KA +LLGL VLL+ SEV+A A+ + K TV GYGGG Sbjct: 3 SNKAFLLLGLSLAIVLLISSEVAARELAEAQTTTTNKNTEAATVDGRSGYNGYGGGGYHG 62 Query: 156 ----HGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 HGG G HGGGG HG GG++GGGGHG GGG Sbjct: 63 GGGYHGGGGYHGGGGYHGGGGYHGGGGHG----GGG 94 [57][TOP] >UniRef100_B3SW92 Glycine-rich protein 1 n=1 Tax=Boea hygrometrica RepID=B3SW92_9LAMI Length = 131 Score = 62.4 bits (150), Expect = 2e-08 Identities = 47/114 (41%), Positives = 54/114 (47%), Gaps = 36/114 (31%) Frame = +3 Query: 18 MASKALILLGLFS--VLLVVSEVSA---ARQSGMVKPESEETVQPEG------------- 143 M KA++ LGLF VLL+ SEV A A + + E E +G Sbjct: 1 MGYKAIVFLGLFVAIVLLISSEVGARELAETTDAIDAEKETEATEDGRGGYNGYGGGRGG 60 Query: 144 ---YGGGHGG-----------HGGHGGGG----GHGHGGHNGGGGHGLDGYGGG 251 YGGG GG HGG+GGGG G G GGH GGGGHG GYGGG Sbjct: 61 YGGYGGGRGGYGRGRGGYGGGHGGYGGGGHGGYGRGRGGH-GGGGHG--GYGGG 111 [58][TOP] >UniRef100_A4S5W2 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S5W2_OSTLU Length = 722 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGG-HGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+GGG GG HGGHGGG G GHGGH GG G G G+GGG Sbjct: 45 GHGGGQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGG 82 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/38 (76%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGH-GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+GGGH GGHGGHGGG G GHGGH GGGHG DG GG Sbjct: 56 GHGGGHGGGHGGHGGGQGGGHGGH--GGGHGGDGGTGG 91 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GG GGHGGHGGG G GHGGH GG G G G+GGG Sbjct: 37 GGQGGGHGGHGGGQGGGHGGHGGGHGGGHGGHGGG 71 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 5/42 (11%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNG-----GGGHGLDGYGGG 251 G+GGGHGGHGG GGG GHGG +G GGGHG DG GG Sbjct: 60 GHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGG 101 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGG-GGHGHGGHNGGGGHGLDGYGGG 251 G GGGHGG GG GGG GG+G GG GGGG G G GGG Sbjct: 88 GTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGG 125 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/41 (68%), Positives = 29/41 (70%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGH-GGHGGGG--GHGHGGHNG-GGGHGLDGYGGG 251 G GGGHGGH GGHGG G G GHGG G GGG G +G GGG Sbjct: 71 GQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGG 111 [59][TOP] >UniRef100_UPI000180C26D PREDICTED: hypothetical protein n=1 Tax=Ciona intestinalis RepID=UPI000180C26D Length = 762 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 150 GGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 GGHGG+GGHGG GGH GHGGH G GGHG G GG Sbjct: 106 GGHGGNGGHGGNGGHGGHGGHGGNGGHGGHGGNGG 140 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH----GHGGHNGGGGHGLDGYGGG 251 G GGHGG+GGHGG GGH GHGGH G GGHG +G GG Sbjct: 109 GGNGGHGGNGGHGGHGGHGGNGGHGGHGGNGGHGGNGGFGG 149 [60][TOP] >UniRef100_B9SSQ0 Glycine-rich protein DC7.1, putative n=1 Tax=Ricinus communis RepID=B9SSQ0_RICCO Length = 78 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 1/70 (1%) Frame = +3 Query: 24 SKALILLGL-FSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHGH 200 SK +LLGL F+V+L++S ++AR+ +++E Q G+G GHG HGG+G G HGH Sbjct: 4 SKTFLLLGLAFAVVLLLSSQASARELAETV-QTQENAQVHGHGDGHG-HGGYGHG--HGH 59 Query: 201 GGHNGGGGHG 230 GGH G GHG Sbjct: 60 GGHRGKPGHG 69 [61][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVS 122 PPP P P PPPP PP P PPPPP PP PP PPP P C S Sbjct: 371 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPAS 413 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLS 113 PPP P SP PPPP PP P PPPPP PP PP PPP P + S S Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTS 418 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 362 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 398 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 401 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 396 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P P PPP PP PP PPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 394 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP P P PPPPP PP PP PPP P Sbjct: 363 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPP PP P PPPPP PP PP PPP P Sbjct: 367 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PP P PP P PPPPP PP PP PPP P Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 [62][TOP] >UniRef100_UPI00017916EE PREDICTED: hypothetical protein n=1 Tax=Acyrthosiphon pisum RepID=UPI00017916EE Length = 205 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/44 (70%), Positives = 32/44 (72%), Gaps = 8/44 (18%) Frame = +3 Query: 141 GYGGGHGG-HGGHGGGG----GHGHGGH-NG--GGGHGLDGYGG 248 GY GGHGG HGGHG GG GHGHGGH NG GGGHG G+GG Sbjct: 148 GYNGGHGGGHGGHGNGGYGNSGHGHGGHGNGGYGGGHGSGGHGG 191 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/52 (55%), Positives = 31/52 (59%), Gaps = 15/52 (28%) Frame = +3 Query: 141 GYGGGHGGHG---------GHGG------GGGHGHGGHNGGGGHGLDGYGGG 251 G+GGGHGGHG GHGG GGGHG GGH G GGHG G+G G Sbjct: 152 GHGGGHGGHGNGGYGNSGHGHGGHGNGGYGGGHGSGGHGGHGGHGSYGHGHG 203 Score = 55.1 bits (131), Expect = 2e-06 Identities = 37/84 (44%), Positives = 48/84 (57%), Gaps = 13/84 (15%) Frame = +3 Query: 39 LLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGG--GGH--GHGG 206 +L L V+LV+++ + + + +P GYGGG+ +GGHGGG GGH GHGG Sbjct: 104 ILALCLVVLVMTQQATSEPAP--EPAKSGHHNNGGYGGGY--NGGHGGGYNGGHGGGHGG 159 Query: 207 H-NGG--------GGHGLDGYGGG 251 H NGG GGHG GYGGG Sbjct: 160 HGNGGYGNSGHGHGGHGNGGYGGG 183 [63][TOP] >UniRef100_O22612 Dormancy-associated protein n=1 Tax=Pisum sativum RepID=O22612_PEA Length = 129 Score = 61.6 bits (148), Expect = 3e-08 Identities = 40/79 (50%), Positives = 50/79 (63%), Gaps = 4/79 (5%) Frame = +3 Query: 27 KALILLGLFS-VLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGH-GH 200 KA+++LGL + VLL+ SEVSA + V +S+E V YGG G G H GGG H G Sbjct: 5 KAMLILGLLAMVLLISSEVSARELTEEVVEKSDE-VNDAKYGGYGRGGGYHNGGGYHNGG 63 Query: 201 GGHNGGGGH--GLDGYGGG 251 GG+NGGGG+ G GY GG Sbjct: 64 GGYNGGGGYHNGGGGYNGG 82 [64][TOP] >UniRef100_C4WUK3 ACYPI005604 protein n=1 Tax=Acyrthosiphon pisum RepID=C4WUK3_ACYPI Length = 108 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/44 (70%), Positives = 32/44 (72%), Gaps = 8/44 (18%) Frame = +3 Query: 141 GYGGGHGG-HGGHGGGG----GHGHGGH-NG--GGGHGLDGYGG 248 GY GGHGG HGGHG GG GHGHGGH NG GGGHG G+GG Sbjct: 51 GYNGGHGGGHGGHGNGGYGNSGHGHGGHGNGGYGGGHGSGGHGG 94 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/52 (55%), Positives = 31/52 (59%), Gaps = 15/52 (28%) Frame = +3 Query: 141 GYGGGHGGHG---------GHGG------GGGHGHGGHNGGGGHGLDGYGGG 251 G+GGGHGGHG GHGG GGGHG GGH G GGHG G+G G Sbjct: 55 GHGGGHGGHGNGGYGNSGHGHGGHGNGGYGGGHGSGGHGGHGGHGSYGHGHG 106 Score = 55.1 bits (131), Expect = 2e-06 Identities = 37/84 (44%), Positives = 48/84 (57%), Gaps = 13/84 (15%) Frame = +3 Query: 39 LLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGG--GGH--GHGG 206 +L L V+LV+++ + + + +P GYGGG+ +GGHGGG GGH GHGG Sbjct: 7 ILALCLVVLVMTQQATSEPAP--EPAKSGHHNNGGYGGGY--NGGHGGGYNGGHGGGHGG 62 Query: 207 H-NGG--------GGHGLDGYGGG 251 H NGG GGHG GYGGG Sbjct: 63 HGNGGYGNSGHGHGGHGNGGYGGG 86 [65][TOP] >UniRef100_B8ESL3 Putative uncharacterized protein n=1 Tax=Methylocella silvestris BL2 RepID=B8ESL3_METSB Length = 169 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GGGHGG G HGGGGGHG GGH GGGGHG G+GGG Sbjct: 134 GGGHGG-GWHGGGGGHGGGGH-GGGGHGGGGHGGG 166 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G G HGG GG GGGGHG G H GGGGHG G+GGG Sbjct: 120 GGGNWHGGGGGWHGGGGHGGGWHGGGGGHGGGGHGGG 156 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/37 (67%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +3 Query: 144 YGGGHGGHGGHGGGGG-HGHGGHNGGGGHGLDGYGGG 251 +GGG G HGG G GGG HG GG +GGGGHG G+GGG Sbjct: 125 HGGGGGWHGGGGHGGGWHGGGGGHGGGGHGGGGHGGG 161 [66][TOP] >UniRef100_Q5ZAB3 Os06g0317600 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5ZAB3_ORYSJ Length = 132 Score = 61.2 bits (147), Expect = 3e-08 Identities = 41/99 (41%), Positives = 52/99 (52%), Gaps = 21/99 (21%) Frame = +3 Query: 18 MASKALILLG--LFSVLLVVSEVSAARQSGMVKPESEETVQPE----------------- 140 MASK+L LLG L S+LLV +VSAAR+ + ++ E Sbjct: 1 MASKSLFLLGAVLASLLLVAQDVSAARELAEANEAKGKNMKQEVAYGPQDEKLAHHADGY 60 Query: 141 GYGGGHGGH--GGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+GGG+GG G+GGG G G+GG GG G GYGGG Sbjct: 61 GHGGGYGGGYGSGYGGGNGGGYGGGYGGYGGYNKGYGGG 99 [67][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 61.2 bits (147), Expect = 3e-08 Identities = 36/78 (46%), Positives = 42/78 (53%), Gaps = 6/78 (7%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSS---LSGF---TMPDCL 89 PPP P P PPPP PP P PPPPP PP PP PPP P T+S L G+ + CL Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRRWLLGWRDAELQRCL 63 Query: 88 AADTSETTRRTEKRPNRI 35 TRR E +P+ + Sbjct: 64 -------TRRAESQPSSL 74 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 [68][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 60.8 bits (146), Expect = 4e-08 Identities = 34/73 (46%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS--GCTVSSLSGFTMPDCLAADT 77 PPP P P PPPP PP P PPPPP P PP PPP PS + GF DC Sbjct: 244 PPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPPFVPGFF--DCELCFA 301 Query: 76 SETTRRTEKRPNR 38 +E T T+ P R Sbjct: 302 AELTPPTDSAPYR 314 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP PS P PPPP PP P PPPPP P PP PPP PS Sbjct: 235 PPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPS 272 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPW-PPPPP*PPCPPWPPP*PS 137 PPP PS P PPPP PP P PPPPP PP PP PPP PS Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPS 261 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP PS P PPPP PP P PPPPP PP PP PPP P Sbjct: 211 PPPPPSPPPPPPP--PPPPSPPPPPPPPPPPSPPPPP 245 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 P P P P PPPP PP P PPPPP PP PP PPP PS Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 240 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 P P P P PPPP PP P PPPPP PP PP PPP PS Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 252 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PP P P PPPP PP P PPPPP P PP PPP PS Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPS 263 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -2 Query: 250 PPPYPSSPW-PPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P PPPPP PP P PPP PS Sbjct: 232 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPS 270 [69][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLS 113 PPP P P PPPP PP P PPPPP PP PP PPP P T S+S Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMS 536 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/69 (43%), Positives = 35/69 (50%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLSGFTMPDCLAADTSE 71 PPP P P PPPP PP P PPPPP PP PP PPP P S+ ++P + S Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLIEEAQSS 547 Query: 70 TTRRTEKRP 44 +RP Sbjct: 548 PALGGCRRP 556 [70][TOP] >UniRef100_Q6C5H5 YALI0E18007p n=1 Tax=Yarrowia lipolytica RepID=Q6C5H5_YARLI Length = 254 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 4/40 (10%) Frame = +3 Query: 141 GYGGGHGGH----GGHGGGGGHGHGGHNGGGGHGLDGYGG 248 GYGGGHGGH GGHGGGGG G GG GGGG G G GG Sbjct: 214 GYGGGHGGHGDGGGGHGGGGGDGGGGGGGGGGDGGGGGGG 253 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHG-GGGGHGHGGHNGGGGHGLDGYGGG 251 G GG GGHGGHG GGGGHG GG +GGGG G G GG Sbjct: 211 GGGGYGGGHGGHGDGGGGHGGGGGDGGGGGGGGGGDGG 248 [71][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P SP PPPP PP P PPPPP PP PP PPP P Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPP 523 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/44 (65%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*-PPCPPWPPP*PSGCTVS 122 PPP PS P PPPP PP P PPPPP PP PP PPP PS T S Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPS 542 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PP PP PP PP PPP P Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 496 PPPPPPPPSPPPPP-PPSPPPPPPPPPPPPPPPPPPP 531 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P P PPP PP PP PPP P Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PP P PP P PPPPP PP PP PPP P Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 [72][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCT 128 PPP P P PPPP PP P PPPPP PP PP PPP P C+ Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCS 66 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 [73][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/48 (60%), Positives = 29/48 (60%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLSGF 107 PPP P P PPPP PP P PPPPP PP PP PPP P T SL F Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHITKISLPFF 67 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLS 113 PPP P P PPPP PP P PPPPP PP PP PPP P ++ +S Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHITKIS 63 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 [74][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 60.1 bits (144), Expect = 7e-08 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP PS P PPPP PP P PPPPP PP PP PPP P Sbjct: 160 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P SP PPPP PP P PPPPP PP PP PPP Sbjct: 167 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP PS P PPPP PP P PPPPP PP PP PPP Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 202 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP PS P PPPP PP P PPPPP P PP PPP P Sbjct: 146 PPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPP 182 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP PS P PP P PP P PPPPP PP PP PPP P Sbjct: 154 PPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 190 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PP P PP P PPPPP PP PP PPP P Sbjct: 134 PPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPP 170 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PP P PP P PPPPP PP PP PPP P Sbjct: 148 PPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPP 184 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPP PP P PPPPP PP PP PPP P Sbjct: 156 PPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 192 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PP P PP P PPPPP PP PP PPP P Sbjct: 162 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 198 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P SP PPPP PP PPP P PP PP PPP PS Sbjct: 131 PPPPPPSPPPPPPPSPP---PPPSPPPPPPPSPPPPPS 165 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP PS P PP P PP P PPPPP PP PP P P P Sbjct: 140 PPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPP 176 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P SP PPPP PP P P PPP PP PP PPP P Sbjct: 153 PPPPPPSP-PPPPSPPPPPPPSPPPPPPPPPPPPPPP 188 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPP PP P PPP P PP PP PPP P Sbjct: 142 PPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPP 178 [75][TOP] >UniRef100_UPI0000DB74DD PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB74DD Length = 406 Score = 60.1 bits (144), Expect = 7e-08 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 4/42 (9%) Frame = +3 Query: 138 EGYGGGHGGHGGHGGGGGH----GHGGHNGGGGHGLDGYGGG 251 +G GGHGGHG HGG GGH GHGGH+G GGHG G GG Sbjct: 262 QGGHGGHGGHGEHGGHGGHDEHGGHGGHDGHGGHGGHGKHGG 303 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 3/41 (7%) Frame = +3 Query: 138 EGYGG--GHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 +G+GG GHG HGGHGG G H GHGGH G GGHG G GG Sbjct: 290 DGHGGHGGHGKHGGHGGHGEHGGHGGHGGHGGHGEHGGHGG 330 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 G GGHGGHG HGG GGH GHGGH GGHG G GG Sbjct: 299 GKHGGHGGHGEHGGHGGHGGHGGHGEHGGHGGHGRHGG 336 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 G GGHG HGGHGG GGH GHG H G GGHG G GG Sbjct: 302 GGHGGHGEHGGHGGHGGHGGHGEHGGHGGHGRHGGHGG 339 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGGG 251 G GGHGGHGGHGG G HG HGGH GGHG G GG Sbjct: 308 GEHGGHGGHGGHGGHGEHGGHGGHGRHGGHGGHGEHGG 345 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGGG 251 G GGHGGHG HGG GGHG HGGH G G HG G GG Sbjct: 314 GGHGGHGGHGEHGGHGGHGRHGGHGGHGEHGGHGKHGG 351 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +3 Query: 150 GGHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGGG 251 GGHGGH GHGG GGHG HGGH G G HG G GG Sbjct: 284 GGHGGHDGHGGHGGHGKHGGHGGHGEHGGHGGHGG 318 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGGG 251 G GGHGGHG HGG GGHG HGGH GGHG G GG Sbjct: 323 GEHGGHGGHGRHGGHGGHGEHGGHGKHGGHGGHGELGG 360 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 3/39 (7%) Frame = +3 Query: 141 GYGG--GHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGG 248 G+GG GHGGHGGHG GGHG HG H G GGHG G+GG Sbjct: 285 GHGGHDGHGGHGGHGKHGGHGGHGEHGGHGGHG--GHGG 321 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGG 248 G GGHGGHGGHG GGHG HG H G GGHG G G Sbjct: 311 GGHGGHGGHGGHGEHGGHGGHGRHGGHGGHGEHGGHG 347 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGG--HGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 G+GG HGGHGGH G GGH GHG H G GGHG G GG Sbjct: 276 GHGGHDEHGGHGGHDGHGGHGGHGKHGGHGGHGEHGGHGG 315 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGG 248 G GGHGGH HGG GGH GHGGH G G HG G+GG Sbjct: 272 GEHGGHGGHDEHGGHGGHDGHGGHGGHGKHG--GHGG 306 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/39 (61%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +3 Query: 135 PEGYGGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGG 248 PE +GG HG HG GG GGHG HGGH GGHG G G Sbjct: 116 PEQHGGAHGEHGWQGGHGGHGKHGGHGEQGGHGKHGGHG 154 [76][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 60.1 bits (144), Expect = 7e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGC 131 PPP P P PPPP PP P PPPPP PP PP PPP P C Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPC 67 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PCPP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPP 75 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PCP PPPPP PP PP PPP P Sbjct: 50 PPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPP 86 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPP CPP P PPPPP PP PP PPP P Sbjct: 53 PPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 59 PPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 62 PPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 104 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/53 (52%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPP--P*PSGCTVSSLSGFTMP 98 PPP P P PPPP PP P PPPPP PCPP PP P P C G P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLPEP 129 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P PPPPP PP P PPP P+ Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPA 111 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PP P PP P PPPPP PP PP PPP P Sbjct: 54 PPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P P PPPP PP P PPPPP PP PP PPP P Sbjct: 64 PRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPP P PP PP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPP 78 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P P PPP PP PP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPP 82 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP P P P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCP 106 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP P P P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPP 108 [77][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P SP PPPP PP P PPPPP PP PP PPP Sbjct: 672 PPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P P PPPPL PP P PPPPP PP PP PPP P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPPL P P PPPPP PP PP PPP P Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = -2 Query: 250 PPPYPSSPWPP----PPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P SP PP PP PP P PPPPP PP PP PPP P Sbjct: 217 PPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPP 257 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P SP PP P PP P PPPPP PP PP PPP P Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/53 (52%), Positives = 29/53 (54%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLSGFTMPDC 92 PPP P P PPPP PP P PPPPP PP PP PPP P + L P C Sbjct: 670 PPPPPLPPSPPPP--PPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPPSC 720 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P PPPPP PP PP PP PS Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PP P Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PP PP PP PP PPP P Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPP PP PP PPP P Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPP PP PP PPP P Sbjct: 215 PPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPP 251 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP PS P PPP PP P PPPPP PP PP PPP P Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPP 259 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P P PPPP PP P PPPPP PP PP PPP P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP P P PPPPP PP PP PPP P Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P P PP P PP P PPPPP PP PP PPP Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PP P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PP PP PP PP PPP P Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P SP PPPP PP PPPPP PP PP PPP P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPP 258 [78][TOP] >UniRef100_Q20BN3 GBR5-like protein n=1 Tax=Panax ginseng RepID=Q20BN3_PANGI Length = 129 Score = 60.1 bits (144), Expect = 7e-08 Identities = 44/102 (43%), Positives = 53/102 (51%), Gaps = 25/102 (24%) Frame = +3 Query: 21 ASKALILLGLFS--VLLVVSEVSA-----ARQSGMVKPESEETVQPE----GYGGG---- 155 ++KA +LLGL VLL+ SEV+A A+ + K TV GYGGG Sbjct: 3 SNKAFLLLGLSLAIVLLISSEVAARELAEAQTTTTNKNTEAATVDGRSGYNGYGGGGYHG 62 Query: 156 ----------HGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 HGG G HGGGG HG GG++GGGGHG GGG Sbjct: 63 GGGYHGGGGYHGGGGYHGGGGYHGGGGYHGGGGHG----GGG 100 [79][TOP] >UniRef100_B9SYZ2 Glycine-rich protein DC7.1, putative n=1 Tax=Ricinus communis RepID=B9SYZ2_RICCO Length = 108 Score = 60.1 bits (144), Expect = 7e-08 Identities = 41/93 (44%), Positives = 46/93 (49%), Gaps = 18/93 (19%) Frame = +3 Query: 24 SKALILLGLFS--VLLVVSEVSAARQSGMVKPESEETVQPEG------------YGGGHG 161 SK LLGL VLLV SEVSA + + E G YG G G Sbjct: 4 SKTFFLLGLAFAVVLLVASEVSARDLVETAQTKETENADKGGGYDKGNGYGNGGYGNGGG 63 Query: 162 GHGGHGGGGGHG----HGGHNGGGGHGLDGYGG 248 GHGG+G GGGHG GG+ GGGHG G+GG Sbjct: 64 GHGGYGKGGGHGGYGKEGGYGKGGGHG-RGHGG 95 [80][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 60.1 bits (144), Expect = 7e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGC 131 PPP P P PPPP PP P PPPPP PP PP PPP P C Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTC 117 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGC 131 PPP P P PPPP PP P PPPPP PP PP PPP C Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPC 119 [81][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 60.1 bits (144), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSG 134 PPP P P PPPP PP P PPPPP PP PP PPP P G Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGG 81 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSG 134 PPP P P PPPP PP P PPPPP PP PP PPP P G Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 80 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 [82][TOP] >UniRef100_A0NFR5 AGAP009636-PA n=1 Tax=Anopheles gambiae RepID=A0NFR5_ANOGA Length = 98 Score = 60.1 bits (144), Expect = 7e-08 Identities = 34/83 (40%), Positives = 49/83 (59%), Gaps = 9/83 (10%) Frame = +3 Query: 27 KALILLGLFSVLLVVSEVSAARQS--------GMVKPESEETVQPEGYGG-GHGGHGGHG 179 K ++LLG+ +V+L ++ V G++ P S YGG G+GG+GG+G Sbjct: 2 KCVVLLGILTVILSLNVVPTQSNPVPQIGFGIGLIGPYSR-------YGGLGYGGYGGYG 54 Query: 180 GGGGHGHGGHNGGGGHGLDGYGG 248 GG GHG+GG+ G GG+G GYGG Sbjct: 55 GGYGHGYGGYGGYGGYG--GYGG 75 [83][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSG 134 PPP P P PPPP PP P PPPPP PP PP PPP P G Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 963 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PP P Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP P PPP P Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPP 969 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PP P Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAP 965 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P P PPPP PP P PPPPP P PP PPP Sbjct: 936 PPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPP 970 [84][TOP] >UniRef100_C5Z1M8 Putative uncharacterized protein Sb10g012110 n=1 Tax=Sorghum bicolor RepID=C5Z1M8_SORBI Length = 171 Score = 59.7 bits (143), Expect = 1e-07 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 9/87 (10%) Frame = +3 Query: 18 MASKALILLGL-FSVLLVVSEVSAARQ--------SGMVKPESEETVQPEGYGGGHGGHG 170 MA K L+LL + + L+V EV+ AR+ VK ++ E +GGG+ G Sbjct: 1 MAVKFLVLLSVVLASLIVFQEVAYARELTEANETEGKNVKQGGAPELKDEKWGGGYNGGY 60 Query: 171 GHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GHGGG G G+G + GGG+G GYGGG Sbjct: 61 GHGGGYGGGYGQPSYGGGYGQPGYGGG 87 [85][TOP] >UniRef100_C4WYF2 ACYPI004778 protein n=1 Tax=Acyrthosiphon pisum RepID=C4WYF2_ACYPI Length = 118 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/49 (63%), Positives = 32/49 (65%), Gaps = 13/49 (26%) Frame = +3 Query: 141 GYGGGHGG-HGGHGGGG---------GHGHGGH-NG--GGGHGLDGYGG 248 GY GGHGG HGGHG GG GHGHGGH NG GGGHG G+GG Sbjct: 59 GYNGGHGGGHGGHGNGGYGNSGYGNSGHGHGGHGNGGYGGGHGSGGHGG 107 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/57 (57%), Positives = 34/57 (59%), Gaps = 20/57 (35%) Frame = +3 Query: 141 GYGGGHGG--HGGHGGG--GGH--GHGGH-NGG-------------GGHGLDGYGGG 251 GY GGHGG +GGHGGG GGH GHGGH NGG GGHG GYGGG Sbjct: 43 GYNGGHGGGYNGGHGGGYNGGHGGGHGGHGNGGYGNSGYGNSGHGHGGHGNGGYGGG 99 [86][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/51 (54%), Positives = 30/51 (58%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLSGFTMP 98 PPP P P PPPP PP P PPPPP PP PP PPP P S++S P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYMQKP 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [87][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGC 131 PPP P P PPPP PP P PPPPP PP PP PPP P C Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLC 85 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 [88][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTV 125 PPP P P PPPP PP P PPPPP PP PP PPP P C + Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCNL 51 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [89][TOP] >UniRef100_B4LUJ0 GJ17322 n=1 Tax=Drosophila virilis RepID=B4LUJ0_DROVI Length = 418 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/43 (67%), Positives = 31/43 (72%), Gaps = 6/43 (13%) Frame = +3 Query: 141 GYGGG--HGGHGGHGGGGGHGHGGH----NGGGGHGLDGYGGG 251 GYGGG HGG GG GGGGHG GGH +GGGG+G GYGGG Sbjct: 354 GYGGGGKHGGGGGGFGGGGHGGGGHGGGGHGGGGYGGGGYGGG 396 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/41 (68%), Positives = 29/41 (70%), Gaps = 6/41 (14%) Frame = +3 Query: 147 GGGHGGHGGHG------GGGGHGHGGHNGGGGHGLDGYGGG 251 GGG+GG G HG GGGGHG GGH GGGGHG GYGGG Sbjct: 352 GGGYGGGGKHGGGGGGFGGGGHGGGGH-GGGGHGGGGYGGG 391 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHN-GGGGHGLDGYGGG 251 G GGG G GG+GGGG HG GG GGGGHG G+GGG Sbjct: 344 GIGGGKHGGGGYGGGGKHGGGGGGFGGGGHGGGGHGGG 381 [90][TOP] >UniRef100_B4I7F0 GM15778 n=1 Tax=Drosophila sechellia RepID=B4I7F0_DROSE Length = 254 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/38 (73%), Positives = 30/38 (78%), Gaps = 4/38 (10%) Frame = +3 Query: 150 GGHGGHGGHGGGGGH--GHGGHNGG--GGHGLDGYGGG 251 GGHGGHGGHGG GGH GHGGH+GG GGHG G+ GG Sbjct: 136 GGHGGHGGHGGHGGHDGGHGGHDGGHDGGHG--GHDGG 171 [91][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPP 132 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PP P PP P PPPPP PP PP PPP P Sbjct: 67 PPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPP 103 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P PPP P PP PP PPP PS Sbjct: 87 PPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPS 124 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP PS P PPPP PP P PPPPP PP PP P P P Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPP 141 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P SP PPPP PP P PPPPP PP PP PP P Sbjct: 79 PPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPP 114 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 111 PPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPP 146 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 93 PPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP PS P PPPP PP P PPPPP PP PP P P PS Sbjct: 119 PPPPPSPPPPPPPPPPPPPNPPPPP-PPPPPSPSPPPS 155 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP PS P PPPP PP P PPPPP PP P PPP P Sbjct: 82 PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPP 117 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP P PP PPP P Sbjct: 97 PPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPP 133 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*P-PCPPWPPP*PS 137 PPP P P PPPP PP P PPPPP P P PP PPP PS Sbjct: 111 PPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPS 149 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PP P PP P PPPPP PP PP PPP P Sbjct: 99 PPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPP 135 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PP P PP P PP PP PP PP PPP PS Sbjct: 73 PPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPS 110 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P P PPP PP PP PPP P Sbjct: 89 PPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSP 125 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P P PPPP PP P PP PP PP PP PPP Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPP 136 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPC---PPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSP 160 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P +P PPPP PP P PPP P P PP PPP P Sbjct: 132 PPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSP 168 [92][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTV 125 PPP P P PPPP PP P PPPPP PP PP PPP P+ V Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIVV 74 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP+ P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 [93][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP PS P PPPP PP P PPPPP PP PP PPP PS Sbjct: 221 PPPPPSPPPPPPP--PPPPSPPPPPPPPPPPSPPPPPS 256 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP PS P PPPP PP P PPP P PP PP PPP Sbjct: 233 PPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPP 267 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = -2 Query: 250 PPPYPSSPW--PPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP PS P PPPP PP P PPPPP PP PP PPP PS Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 250 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P SP PPP PP P PPPPP PP PP PPP P Sbjct: 208 PPPPPPSP-SPPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 P P P P PPPP PP P PPPPP PP PP PPP Sbjct: 225 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPP 259 [94][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P PPPPP PP PP PPP PS Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPS 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 [95][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTV 125 PPP P P PPPP PP P PPPPP PP PP PPP P+ V Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIVV 74 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 23 PPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 28 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPY-PSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP+ P P PPPPL PP P PPPPP PP PP PPP P Sbjct: 17 PPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 29 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 [96][TOP] >UniRef100_B8B142 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B142_ORYSI Length = 132 Score = 59.3 bits (142), Expect = 1e-07 Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 29/107 (27%) Frame = +3 Query: 18 MASKALILLG--LFSVLLVVSEVSAARQSGMVKPESEETVQPE----------------- 140 MASK+L LLG L S+LLV +VSAAR+ + ++ E Sbjct: 1 MASKSLFLLGVVLASLLLVAQDVSAARELAEANEAKGKNMKQEVAYGPQDEKLAHHADGY 60 Query: 141 GYGGGHGGH--GGHGGGGGHGHGGHNGG--------GGHGLDGYGGG 251 G+GGG+GG G+GGG G G+GG GG GG G+ GYG G Sbjct: 61 GHGGGYGGGYGSGYGGGNGGGYGGGYGGYGGYNKGYGGAGVGGYGKG 107 [97][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTV 125 PPP P P PPPP PP P PPPPP PP PP PPP P+ V Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIVV 71 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP+ P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 [98][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P +P PPPP PP P PPPPP PP PP PPP P Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P P PPPP PP P PPPPP PP PP PPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P+ P PPPP PP P PPPPP PP PP PPP P Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPP--WPPP*PS 137 PPP P P PPPP PP P PPPPP PP PP PPP PS Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPS 109 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP P P P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 [99][TOP] >UniRef100_B3NWD3 GG19108 n=1 Tax=Drosophila erecta RepID=B3NWD3_DROER Length = 176 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/41 (68%), Positives = 31/41 (75%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHG--HGGH--NGGGGHGLDGYGGG 251 GYGGG GG GG+GGGGG G GG+ NGGGGHG G+GGG Sbjct: 31 GYGGGGGGQGGYGGGGGGGGGQGGYQKNGGGGHGGGGHGGG 71 [100][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPC-PPWPPP*P 140 PPP P P PPPPL PP P PPPPP PP PP PPP P Sbjct: 91 PPPLPPPPPPPPPLPPPPPLPPPPPPPPLPPPLPPPLP 128 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 80 PPLPPPPPLPPPPPLPPPP-PPPPPLPPPPPLPPPPP 115 [101][TOP] >UniRef100_Q0IB89 Putative uncharacterized protein n=1 Tax=Synechococcus sp. CC9311 RepID=Q0IB89_SYNS3 Length = 166 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GG HGG G HGGGG HG GGH+GGGGH G+ GG Sbjct: 8 GGGGHHGGGGHHGGGGHHGGGGHHGGGGHHGGGHHGG 44 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GG HGG G HGGGG HG GGH+GGG HG +GGG Sbjct: 14 GGGGHHGGGGHHGGGGHHGGGGHHGGGHHGGGHHGGG 50 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGG-HGLDGYGGG 251 G HGG G HGGGG HG GGH+GGGG HG G+ GG Sbjct: 4 GHHHGGGGHHGGGGHHGGGGHHGGGGHHGGGGHHGG 39 [102][TOP] >UniRef100_Q8GVD4 Glycine-rich protein n=1 Tax=Lilium hybrid division VII RepID=Q8GVD4_9LILI Length = 138 Score = 58.9 bits (141), Expect = 2e-07 Identities = 37/85 (43%), Positives = 49/85 (57%), Gaps = 7/85 (8%) Frame = +3 Query: 18 MASKALILLGLFSV--LLVVS----EVSAARQSGMVKPESEETVQPEGYGGGHGGHGGH- 176 MASKAL++LG+ V L V S E++ + K +E V + YGGG+ GG+ Sbjct: 1 MASKALLMLGVLIVAALFVTSDAGRELAEETKENTEKRATEAGVADQKYGGGYNNGGGYP 60 Query: 177 GGGGGHGHGGHNGGGGHGLDGYGGG 251 GGGGG+ +GG GGG G G GGG Sbjct: 61 GGGGGYHNGGGYPGGGGGYPGGGGG 85 [103][TOP] >UniRef100_Q5Z4Q6 Os06g0316300 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5Z4Q6_ORYSJ Length = 167 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/93 (44%), Positives = 52/93 (55%), Gaps = 15/93 (16%) Frame = +3 Query: 18 MASKALILLG--LFSVLLVVSEVSAARQSGMVKPESEETVQPE----GYGGG--HGGHGG 173 MA+K+LIL G L S+LLV +V AAR+ + V+PE +GGG HGG Sbjct: 1 MAAKSLILFGVLLASLLLVSQDVVAARELTEAHESERKNVKPEVEQNNWGGGYMHGGGYE 60 Query: 174 HGGG-------GGHGHGGHNGGGGHGLDGYGGG 251 HGGG GG+G G+ GGG+G GYG G Sbjct: 61 HGGGYSQPRYGGGYGQPGY--GGGYGQPGYGSG 91 [104][TOP] >UniRef100_A7YFB9 Glycine-rich protein n=1 Tax=Lilium formosanum RepID=A7YFB9_9LILI Length = 135 Score = 58.9 bits (141), Expect = 2e-07 Identities = 38/86 (44%), Positives = 46/86 (53%), Gaps = 8/86 (9%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQ-SGMVKPESEETVQPEG-----YGGGHGGHGGHG 179 MASKAL++LG+ V + A R+ + K +EE V G YGG GG G G Sbjct: 1 MASKALLMLGVLIVAALFVTSDAGRELAEETKENTEERVTEAGVTDQKYGGYSGGGGYPG 60 Query: 180 GGGGHGHGGHNGGGG--HGLDGYGGG 251 GGG H GG+ GGGG H GY GG Sbjct: 61 GGGYHNGGGYQGGGGGYHNGGGYQGG 86 [105][TOP] >UniRef100_B7Q8M2 Secreted protein, putative n=1 Tax=Ixodes scapularis RepID=B7Q8M2_IXOSC Length = 172 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 5/72 (6%) Frame = +3 Query: 48 LFSVLLVVSEVSAARQSGMVKPESEETVQPEGYG----GGHGGHGGHGGG-GGHGHGGHN 212 LF + LV + +G+V V G G GG+GG+GG+GGG GG+GHGG Sbjct: 7 LFLLALVCMANAGGHSAGIVSSSYTTAVNHGGRGYGGYGGYGGYGGYGGGYGGYGHGGFL 66 Query: 213 GGGGHGLDGYGG 248 GG G+G GYGG Sbjct: 67 GGFGYGHGGYGG 78 [106][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/46 (60%), Positives = 28/46 (60%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLS 113 PPP P P PPPP PP P PPPPP PP PP PPP P T LS Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPLS 107 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/44 (61%), Positives = 28/44 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSS 119 PPP P P PPPP PP P PPPPP PP PP PPP P V+S Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTS 103 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/51 (50%), Positives = 30/51 (58%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLSGFTMP 98 PPP P P PPPP PP P PPPPP PP PP PP + +S+L +P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPLSALFARPVP 115 [107][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/70 (45%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLSGFTMPDC-LAADTS 74 PPP P P PPPP PP P PPPPP PP PP PPP P + + P L DT+ Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAFPPAPLRRDTA 63 Query: 73 ETTRRTEKRP 44 T E P Sbjct: 64 STGPSQETYP 73 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 [108][TOP] >UniRef100_B4JE74 GH11325 n=1 Tax=Drosophila grimshawi RepID=B4JE74_DROGR Length = 148 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/76 (42%), Positives = 35/76 (46%), Gaps = 10/76 (13%) Frame = +3 Query: 54 SVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGH----------GGHGGGGGHGHG 203 SVL+ + G + YGGGHGG GG GGG G GHG Sbjct: 8 SVLVAAASALPQFGHGGGSANANANANANAYGGGHGGGLGGGYRPGFGGGIGGGPGFGHG 67 Query: 204 GHNGGGGHGLDGYGGG 251 GH G GG GL GYGGG Sbjct: 68 GHGGFGGGGLGGYGGG 83 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/44 (68%), Positives = 30/44 (68%), Gaps = 7/44 (15%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGG----GHGHGGHNGG-GGH--GLDGYGGG 251 G G GHGGHGG GGGG G G GGH GG GGH GL GYGGG Sbjct: 61 GPGFGHGGHGGFGGGGLGGYGGGLGGHGGGFGGHGGGLGGYGGG 104 [109][TOP] >UniRef100_Q25055 Holotricin-3 n=1 Tax=Holotrichia diomphalia RepID=HOL3_HOLDI Length = 104 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/74 (45%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Frame = +3 Query: 33 LILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHN 212 LI+LGL ++ V S + G G+GGGHGG G+G GGGHGHG Sbjct: 4 LIILGLACIIAVASAMPYGPGDG----------HGGGHGGGHGGGHGNGQGGGHGHGPGG 53 Query: 213 G-GGGHGLDGYGGG 251 G GGGHG G+GGG Sbjct: 54 GFGGGHG-GGHGGG 66 [110][TOP] >UniRef100_UPI0001985623 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985623 Length = 89 Score = 58.5 bits (140), Expect = 2e-07 Identities = 35/72 (48%), Positives = 43/72 (59%), Gaps = 3/72 (4%) Frame = +3 Query: 24 SKALILLGLFS--VLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 SK +LLGL VL++ SEVSA + + S E + G+G GHG H GHG G GHG Sbjct: 4 SKVFLLLGLLCSVVLVLSSEVSARELAEAAQTRSVEEAKHWGHGHGHG-HWGHGHGHGHG 62 Query: 198 HG-GHNGGGGHG 230 H GH+G GHG Sbjct: 63 HRHGHHGKPGHG 74 [111][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P P PPP PP PP PPP PS Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPS 288 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP P P P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PP P Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP P PPP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/67 (46%), Positives = 33/67 (49%), Gaps = 5/67 (7%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P-----SGCTVSSLSGFTMPDCLA 86 PPP P P PPPP PP P PPPPP PP PP PP P + TV+ S Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPP-PPLPPPPPSLPLPLPTTSATVAPPSTSQPTQLST 313 Query: 85 ADTSETT 65 TS TT Sbjct: 314 TPTSSTT 320 [112][TOP] >UniRef100_Q7VEJ9 RNA-binding protein, RRM domain n=1 Tax=Prochlorococcus marinus RepID=Q7VEJ9_PROMA Length = 252 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGG----HGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG +GG GG+GGGGG+G GG+ GGGG G GYGGG Sbjct: 90 GYGGGGRGGYGGGGGYGGGGGYGGGGYGGGGGQG--GYGGG 128 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/52 (51%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = +3 Query: 102 MVKPESEETVQPEGYGGGH--GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 M +P +P G GGG GG+GG G GG G GG+ GGGG+G GYGGG Sbjct: 68 MGRPLRINKAEPRGGGGGGRGGGYGGGGRGGYGGGGGYGGGGGYGGGGYGGG 119 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG GG+GGGG G GG G GG G GYGGG Sbjct: 100 GGGGGYGGGGGYGGGGYGGGGGQGGYGGGGQGGYGGG 136 [113][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPP--WPPP*PSGCTVSSLSG 110 PPP P P PPPP PP P PPPPP PP PP PPP P +SS +G Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTG 1460 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PP--CPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 [114][TOP] >UniRef100_A8L9Y7 Putative uncharacterized protein n=1 Tax=Frankia sp. EAN1pec RepID=A8L9Y7_FRASN Length = 453 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/61 (52%), Positives = 35/61 (57%), Gaps = 10/61 (16%) Frame = +3 Query: 96 SGMVKPESEETVQPEG-YGGGHGGH-----GGHGGGGGH----GHGGHNGGGGHGLDGYG 245 +G VKP G +GGGHGGH GGHGG GGH GHGGH G GGHG+ G Sbjct: 158 AGAVKPAGHVHGPVGGAHGGGHGGHGSGPGGGHGGPGGHGAIGGHGGHGGIGGHGVAGGA 217 Query: 246 G 248 G Sbjct: 218 G 218 [115][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = -2 Query: 250 PPPYPSSPWPPP--PLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P SP PPP P PP P PPPPP PP PP PPP PS Sbjct: 792 PPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPS 831 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 4/42 (9%) Frame = -2 Query: 250 PPPYPSSPWP----PPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP PSSP P PPP PP P PPPPP PP P PPP PS Sbjct: 832 PPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPS 873 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P+ P PP P P P PPPPP PP PP PPP PS Sbjct: 862 PPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPS 899 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPW-PPPPP*PPCPPWPPP*PS 137 PPP PS P PPPP PP P PP PP PP PP PPP PS Sbjct: 799 PPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPS 837 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCP-WPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P PPPPP PP PP PP PS Sbjct: 805 PPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPS 843 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP PS P PPP PP P PPPPP PP P PPP Sbjct: 868 PPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPP 902 [116][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/52 (53%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP-*PSGCTVSSLSGFTMP 98 PPP P P PPPP PP P PPPPP PP PP PPP P C+V ++ P Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQCSVCIVAKLQPP 319 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPP PP P PPPPP PP PP PPP PS Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPS 276 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP PPPPP PP PP PPP P Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P P PP PP P PPPPP PP PP PPP P Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPP 274 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P PPPP PP P PPPPP PP PP PPP P Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP P PP PPP P Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 253 PPPPPPPPPPPPP--PPPPPPPPPPSPPPPPPPPPPP 287 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PP PP PP PP PPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P P PPP PP PP PPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP P P PPPPP PP PP PPP P Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPP PP P PPPPP PP PP PPP P Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PP P PP P PPPPP PP PP PPP P Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P SP PPPP PP P P PPP PP PP PPP P Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP PS P PPP PP P PPPPP PP PP PPP P Sbjct: 243 PPPPPSPPPSPPP--PPPPPPPPPPPPPPPPPPPPSP 277 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P SP P PP PP P P PPP PP PP PPP P Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPP 263 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P PS P PPPP PP P PPPPP PP P PPP P Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 [117][TOP] >UniRef100_A9P8F5 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9P8F5_POPTR Length = 189 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGG-GGHGLDGYGGG 251 GYGGGHGG+GG GG G GHGG+ GG GG+G GYGGG Sbjct: 116 GYGGGHGGYGGGHGGYGGGHGGYGGGHGGYG-GGYGGG 152 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGGHGG+GG GG G GHGG+ GG G GYGGG Sbjct: 123 GYGGGHGGYGGGHGGYGGGHGGYGGGYG---GGYGGG 156 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +3 Query: 129 VQPEGYGGGHGGHGGHGGGGGHGHGGHNG-GGGHGLDGYGGG 251 +Q G GG GGHGG+GGG G GGH G GGGHG GYGGG Sbjct: 109 LQGVGRGGYGGGHGGYGGGHGGYGGGHGGYGGGHG--GYGGG 148 [118][TOP] >UniRef100_B9Q6L7 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii VEG RepID=B9Q6L7_TOXGO Length = 510 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +3 Query: 144 YGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 YGGG G GG+GGGGG+G GG GGGG+G GYGGG Sbjct: 294 YGGGGYGGGGYGGGGGYGGGGGYGGGGYGGGGYGGG 329 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGG-HGGHGGHGGGGGHGHGGHNGGG-GHGLDGYGGG 251 GYGGG +GG GG+GGGGG+G GG+ GGG G G GYGGG Sbjct: 298 GYGGGGYGGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGG 336 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG+GGGGG+G GGGG G GYGGG Sbjct: 359 GYGGGGGGYGGYGGGGGYG-----GGGGFGSGGYGGG 390 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGG--GHGHGGHNGGGGHGLDGYGGG 251 GYGGG+GG+GG G GG G G+GG NGG G G GYGGG Sbjct: 325 GYGGGNGGYGGGGNGGYGGGGYGGGNGGYGGGGGGYGGG 363 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGGHGGG--GGHGHGGHNGG-GGHGLDGYGGG 251 G GGG+GG GG+GGG GG G+GG NGG GG G GYGGG Sbjct: 305 GGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGYGGG 344 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 6/40 (15%) Frame = +3 Query: 150 GGHGGHG------GHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GG+GGHG G+GGGG G GG+ GGGG+G GYGGG Sbjct: 285 GGYGGHGSPYGGGGYGGGGYGGGGGYGGGGGYGGGGYGGG 324 [119][TOP] >UniRef100_B7Q1P5 Collagen-like repeats containing protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q1P5_IXOSC Length = 103 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/62 (48%), Positives = 36/62 (58%) Frame = +3 Query: 66 VVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYG 245 +++E S S M K + + + G GGG GG GG GGGGG G GG GGGG G G G Sbjct: 27 ILTECSLMAPSQMHKVDDHDILAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Query: 246 GG 251 GG Sbjct: 87 GG 88 [120][TOP] >UniRef100_B4R7C9 GD16486 n=1 Tax=Drosophila simulans RepID=B4R7C9_DROSI Length = 197 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGG---HNGGGGHGLDGYGGG 251 G GGGHGG GGHGGGGGHG GG +GGGG G GGG Sbjct: 111 GGGGGHGGGGGHGGGGGHGGGGGGWSSGGGGGGWSSGGGG 150 [121][TOP] >UniRef100_B4PJH5 GE19933 n=1 Tax=Drosophila yakuba RepID=B4PJH5_DROYA Length = 347 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG GG+GGGGG+G GG NGGGG G G GGG Sbjct: 300 GGGGGNGGGGGNGGGGGNGGGGGNGGGGGGGGGGGGG 336 [122][TOP] >UniRef100_A8P059 Pherophorin-dz1 protein, putative n=1 Tax=Brugia malayi RepID=A8P059_BRUMA Length = 351 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P PPPPL PPCP PPPP PCPP PPP P Sbjct: 119 PPPCPPQSCPPPPLPPPCPKPPPP--IPCPPPPPPKP 153 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCP---WPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PPCP PPPP PPCP PPP P Sbjct: 105 PPPLPPKPCPPPPAPPPCPPQSCPPPPLPPPCPKPPPPIP 144 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PPCP PPPP P PP PPP P Sbjct: 146 PPPPPPKPCPPPPSPPPCPPPPPPQPCPPPPLPPPCP 182 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P P PPPP PP P PPPP PPCPP PPP P Sbjct: 137 PKPPPPIPCPPPP--PPKPCPPPPSPPPCPPPPPPQP 171 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/51 (52%), Positives = 27/51 (52%), Gaps = 14/51 (27%) Frame = -2 Query: 250 PPPYPSSPWPPPPL--------CPPCPWPPPPP------*PPCPPWPPP*P 140 PPP PS P PP P CPP P PPPPP PPCPP PPP P Sbjct: 53 PPPPPSPPCPPQPCPSLPPPTPCPPQPCPPPPPPVPCPKPPPCPPPPPPIP 103 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPP--PPP*PPCPPWPPP*PSGC 131 PPP P P PPP CPP P PP PPP PP P PPP P C Sbjct: 140 PPPIPCPPPPPPKPCPPPPSPPPCPPPPPPQPCPPPPLPPPC 181 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/63 (44%), Positives = 28/63 (44%), Gaps = 19/63 (30%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCP---WPPPPP----------------*PPCPPWPPP*PSGCT 128 PPP P P PPPPL PPCP PPPP P CP PPP PS C Sbjct: 164 PPPPPPQPCPPPPLPPPCPPTYCTPPPPSQPPVTYSPPPKPYPYVPECPSLPPPSPSDCK 223 Query: 127 VSS 119 S Sbjct: 224 TDS 226 [123][TOP] >UniRef100_Q07202 Cold and drought-regulated protein CORA n=1 Tax=Medicago sativa RepID=CORA_MEDSA Length = 204 Score = 58.5 bits (140), Expect = 2e-07 Identities = 38/104 (36%), Positives = 51/104 (49%), Gaps = 27/104 (25%) Frame = +3 Query: 21 ASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEG------YGGG--------- 155 + KA+++L L ++ L+ S +SA + +E V+ YGGG Sbjct: 3 SKKAILMLSLLAMALISSVMSARDLTETSTDAKKEVVEKTNEVNDAKYGGGYNHGGGYNG 62 Query: 156 ----------HGGHGGHGGGGG--HGHGGHNGGGGHGLDGYGGG 251 HGG G H GGGG HG GG+NGGGGHG G+GGG Sbjct: 63 GGYNHGGGYNHGGGGYHNGGGGYNHGGGGYNGGGGHG--GHGGG 104 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGG 248 GGGHGGHGG G GG GHGGH GGG +G G+GG Sbjct: 95 GGGHGGHGGGGYNGGGGHGGHGGGGYNGGGGHGG 128 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GY G GG+ G GG GGHG GG+NGGGGHG G+GGG Sbjct: 84 GYNHGGGGYNGGGGHGGHGGGGYNGGGGHG--GHGGG 118 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/44 (63%), Positives = 30/44 (68%), Gaps = 8/44 (18%) Frame = +3 Query: 141 GYGGGHGGHGGHGGG--------GGHGHGGHNGGGGHGLDGYGG 248 GY GG GHGGHGGG GGHG GG+NGGGGHG G+GG Sbjct: 91 GYNGGG-GHGGHGGGGYNGGGGHGGHGGGGYNGGGGHG--GHGG 131 [124][TOP] >UniRef100_UPI0001985624 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985624 Length = 94 Score = 58.2 bits (139), Expect = 3e-07 Identities = 37/79 (46%), Positives = 46/79 (58%), Gaps = 10/79 (12%) Frame = +3 Query: 24 SKALILLGL-FSVLLVVS-EVSAARQSGMVKPESEETVQPEGYGGGHG-----GHGGHGG 182 SK +LLGL F+V+L++S EVSA + S E + G+G GHG GH GH Sbjct: 4 SKTFLLLGLLFAVVLILSSEVSARELAEAAHTRSVEDAKSWGHGHGHGHEHEHGHWGHEH 63 Query: 183 GGGHGHG---GHNGGGGHG 230 G GHGHG GH+G GG G Sbjct: 64 GHGHGHGHGHGHHGHGGAG 82 [125][TOP] >UniRef100_UPI000194CF5F PREDICTED: formin homology 2 domain containing 1 n=1 Tax=Taeniopygia guttata RepID=UPI000194CF5F Length = 1275 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/59 (47%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -2 Query: 250 PPPYPSSPW-----PPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLSGFTMPDCL 89 PPP P+ P PPPP P CP PPPP P CPP PPP GC + +P CL Sbjct: 664 PPPPPALPGCPPPPPPPPAIPGCPPPPPPALPGCPPPPPPELPGCPLPPPPPPAVPGCL 722 [126][TOP] >UniRef100_Q1QPF0 Hemolysin-type calcium-binding region n=1 Tax=Nitrobacter hamburgensis X14 RepID=Q1QPF0_NITHX Length = 370 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/64 (50%), Positives = 39/64 (60%), Gaps = 2/64 (3%) Frame = +3 Query: 66 VVSEVSAARQSGMVKPES-EETVQPEGYGGGHGGHGGHGGGGGHGHG-GHNGGGGHGLDG 239 +VS A+ G + S ++ V +G GGG G HGGG GHGHG GH GG GHG DG Sbjct: 168 LVSGALASGTGGNARVASADDQVFGKGQGGGQGHDDDHGGGRGHGHGNGHGGGQGHG-DG 226 Query: 240 YGGG 251 +GGG Sbjct: 227 HGGG 230 [127][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQP 369 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP P P P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPP 367 [128][TOP] >UniRef100_B6SZ03 Meiosis 5 n=1 Tax=Zea mays RepID=B6SZ03_MAIZE Length = 194 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG+GGGGG G GG+ GGGG G GYGGG Sbjct: 39 GYGGG-GGYGGYGGGGGGGGGGYGGGGGGG--GYGGG 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG+GG GGGGG G+GG GGGG+G GGG Sbjct: 41 GGGGGYGGYGGGGGGGGGGYGGGGGGGGYG----GGG 73 [129][TOP] >UniRef100_B7QMH8 H/ACA ribonucleoprotein complex protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QMH8_IXOSC Length = 121 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/49 (59%), Positives = 31/49 (63%) Frame = +3 Query: 105 VKPESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 V+ +S T P G GGG GG GG GGGGG G GG GGGG G G GGG Sbjct: 39 VQQDSALTPMPGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 [130][TOP] >UniRef100_B4JMZ8 GH24721 n=1 Tax=Drosophila grimshawi RepID=B4JMZ8_DROGR Length = 207 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+GGG GG GG+GGGGG+G GG GGGG G G GGG Sbjct: 30 GFGGGFGGGGGYGGGGGYGGGGGYGGGGGGHPGGGGG 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH--GHGGHNGGGGHGLDGYGGG 251 G GGG+GG GG+GGGGG+ G GGH GGGG G G GGG Sbjct: 36 GGGGGYGGGGGYGGGGGYGGGGGGHPGGGGGGHPGGGGG 74 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH----GHGGHNGGGGHGLDGYGGG 251 G GGG+GG GG+GGGGG G GGH GGGG G G GGG Sbjct: 42 GGGGGYGGGGGYGGGGGGHPGGGGGGHPGGGGGGYHGGGGG 82 [131][TOP] >UniRef100_A5KBB6 Putative uncharacterized protein n=1 Tax=Plasmodium vivax RepID=A5KBB6_PLAVI Length = 1384 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGG 248 G G HGGH GHGG GGH GHGGH G GGHG G+GG Sbjct: 203 GNHGNHGGHSGHGGHGGHSGHGGHGGHGGHG--GHGG 237 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-GHGGHNGGGGH-GLDGYGG 248 G GGH GHGGHGG GH GHGGH G GGH G D Y G Sbjct: 206 GNHGGHSGHGGHGGHSGHGGHGGHGGHGGHGGYDNYEG 243 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 6/43 (13%) Frame = +3 Query: 141 GYG-----GGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 GYG G HG HG HGG GH GHGGH+G GGHG G GG Sbjct: 192 GYGNYGNHGNHGNHGNHGGHSGHGGHGGHSGHGGHGGHGGHGG 234 [132][TOP] >UniRef100_A8N7R7 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8N7R7_COPC7 Length = 198 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/44 (65%), Positives = 31/44 (70%), Gaps = 8/44 (18%) Frame = +3 Query: 141 GYGG-GHGGHGG--HGGGGGHGHG-----GHNGGGGHGLDGYGG 248 GYGG GHGG+GG HGG GGHGHG GH G GG+G GYGG Sbjct: 144 GYGGHGHGGYGGYGHGGYGGHGHGGYGGHGHGGYGGYGHGGYGG 187 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/44 (63%), Positives = 31/44 (70%), Gaps = 8/44 (18%) Frame = +3 Query: 141 GYG-GGHGGHGGHGGGG--GHGHG-----GHNGGGGHGLDGYGG 248 GYG GG+GG+GGHG GG G+GHG GH G GGHG GYGG Sbjct: 136 GYGQGGYGGYGGHGHGGYGGYGHGGYGGHGHGGYGGHGHGGYGG 179 [133][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/67 (43%), Positives = 35/67 (52%), Gaps = 8/67 (11%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*P--------PCPPWPPP*PSGCTVSSLSGFTMPD 95 PPP P SP PPPP PP P PPPPP P P PP PPP + + +GF + Sbjct: 271 PPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPPSVLPAATGFPFCE 330 Query: 94 CLAADTS 74 C++ S Sbjct: 331 CVSRSPS 337 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP PS P PPPP PP P PPPPP PP PP PPP P Sbjct: 254 PPPSPSPPPPPPP--PPPPPPPPPPSPPPPPPPPPPP 288 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P P PPPP PP P PPPPP PP PP PPP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP P P PPPPP PP PP PPP PS Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPS 298 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP P P P Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSP 299 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P SP PPPP PP P PPPPP PP PP PPP P Sbjct: 251 PSPPPPSPSPPPP--PPPPPPPPPPPPPSPPPPPPPP 285 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P SP PP P PP P PPPPP PP PP PPP P Sbjct: 246 PSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPP 282 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP P P PPPPP PP PP PPP P Sbjct: 244 PPPSPRPPSPPPP--SPSPPPPPPPPPPPPPPPPPSP 278 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PP P SP PP P PP P PPPPP PP PP PPP PS Sbjct: 241 PPSPPPSPRPPSPP-PPSPSPPPPPPPPPPPPPPPPPS 277 [134][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP+C P P PPPPP PP PP PPP P Sbjct: 123 PPPPPVCP-PPPPMCAPPPPPPPPPPPPPPPPPPPPP 158 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPP-LCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP +C P P PPPPP PPCP PPP P Sbjct: 177 PPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPP 214 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/45 (60%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PP---CPPWP--PP*PSGC 131 PPP P P PPPP PP P PPPPP PP CPP P PP P+ C Sbjct: 138 PPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPC 182 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 6/43 (13%) Frame = -2 Query: 250 PPPYPSSPWPPPP-LCPP-----CPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP +CPP P PPPPP PP PP PPP P Sbjct: 114 PPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPP 156 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP +P PPPP PP P PPPPP PP PP PPP Sbjct: 131 PPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 165 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P PPPP PP P PPPPP PP PP PPP Sbjct: 130 PPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPP 164 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 4/41 (9%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPP----PP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPP PP PPCPP P P P Sbjct: 143 PPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCP 183 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = -2 Query: 250 PPPYPSSPWPPPPL--CPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP+ CPP P PPPP PCPP PPP P Sbjct: 153 PPPPPPPPPPPPPVVFCPPPPPCPPPP-APCPPPPPPPP 190 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = -2 Query: 250 PPPYPSS---PWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PPCP PPPP PPCPP P P P Sbjct: 186 PPPPPMCLPPPPPPPPPPPPCPLPPPP--PPCPPPPAPCP 223 [135][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [136][TOP] >UniRef100_UPI0000122FAC Hypothetical protein CBG05832 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000122FAC Length = 208 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 12/52 (23%) Frame = -2 Query: 250 PPPY---PSSPWPPPPLC--------PPCPWPPPPP*PP-CPPWPPP*PSGC 131 PPP P P PPPP+C PPCP PPPPP PP CPP PPP S C Sbjct: 34 PPPMCAPPPLPCPPPPICPPQFCPPPPPCPPPPPPPPPPMCPPPPPPMYSPC 85 [137][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 57.8 bits (138), Expect = 4e-07 Identities = 32/67 (47%), Positives = 35/67 (52%), Gaps = 4/67 (5%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPP-P*PPCPPWPPP---*PSGCTVSSLSGFTMPDCLAA 83 PPP P P PPPP PP P PPPP P PP PP PPP P G +S F + L Sbjct: 1177 PPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPLIPGGWKGQYVSIFPPDETLWT 1236 Query: 82 DTSETTR 62 T E T+ Sbjct: 1237 GTDEVTK 1243 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/47 (59%), Positives = 29/47 (61%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLSG 110 PPP P P PPPPL PP P PPP P PP PP PP PS +S SG Sbjct: 2748 PPPSPPPPSPPPPL-PPAPSPPPSPPPPSPPPSPPPPSPPDRTSTSG 2793 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*P-PCPPWPPP*P 140 PPP P P PPPP PP P PPPPP P P PP PPP P Sbjct: 211 PPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPP 248 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P SP PPPP PP P PPPPP PP PP PPP P Sbjct: 224 PSPPPPSPPPPPPPSPPPPSPPPPP-PPSPPPPPPPP 259 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPP PP PP P P P Sbjct: 2268 PPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPP 2304 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P PPPP PP PP PP PS Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPS 243 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPP PP PP PPP P Sbjct: 2258 PPPSPHPPSPPPP-SPPPPSPPPPTPPPSPPPPPPTP 2293 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PP PP P PP PPP P Sbjct: 2551 PPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYP 2587 [138][TOP] >UniRef100_A6G232 RNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G232_9DELT Length = 136 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG GGG G G GG+ GGGG G G GGG Sbjct: 70 GYGGGGGGYGGGGGGRGGGGGGYGGGGGGGRGGRGGG 106 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/41 (63%), Positives = 27/41 (65%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGHGG----HGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG GG +GGGGG G GG GGGG G G GGG Sbjct: 77 GYGGGGGGRGGGGGGYGGGGGGGRGGRGGGGGGGRGGRGGG 117 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGG-HGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG GG GGGGG G GG GGGG GYGGG Sbjct: 91 GYGGGGGGGRGGRGGGGGGGRGGRGGGGG----GYGGG 124 [139][TOP] >UniRef100_Q9FJS3 Genomic DNA, chromosome 5, P1 clone:MJE4 n=1 Tax=Arabidopsis thaliana RepID=Q9FJS3_ARATH Length = 343 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/45 (60%), Positives = 30/45 (66%) Frame = +3 Query: 117 SEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 + E +Q +G GGGHGG G GGGGGHG G GGGGHG GGG Sbjct: 248 ASEEIQWQGGGGGHGG-GWQGGGGGHGGGWQGGGGGHGGGWQGGG 291 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/53 (52%), Positives = 32/53 (60%), Gaps = 4/53 (7%) Frame = +3 Query: 105 VKPESEETVQPEGYGGGHGGHGGHGGG----GGHGHGGHNGGGGHGLDGYGGG 251 V+ E E + + +GGG G GGHGGG GGHG GG GGGGHG GGG Sbjct: 66 VEKEEENNYEIDQHGGGWKGGGGHGGGWKGGGGHG-GGWKGGGGHGGGWKGGG 117 [140][TOP] >UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8HQ72_CHLRE Length = 338 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG GG+GGGGG G+GG GG G G GYGGG Sbjct: 100 GGGGGYGGGGGYGGGGGGGYGGGGGGYGGGGGGYGGG 136 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG GGG G G GG+ GGGG G G GGG Sbjct: 118 GYGGGGGGYGGGGGGYGGGGGGYGGGGG-GSGGGGGG 153 [141][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVP 117 [142][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP P W P P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPADP 105 [143][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [144][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 [145][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [146][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSL 116 PPP P P PPPP PP P PPPPP PP PP P P G S++ Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPSAV 50 [147][TOP] >UniRef100_B4JLJ8 GH12877 n=1 Tax=Drosophila grimshawi RepID=B4JLJ8_DROGR Length = 96 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNG---GGGHGLDGYGGG 251 G GGG GG GG+GGGGG+G GGH G GGGHG G+GGG Sbjct: 20 GLGGGGGGGGGYGGGGGYGGGGHGGGGYGGGHG-GGHGGG 58 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG G GG+GGG G GHGG +GGGG G G GGG Sbjct: 36 GYGGGGHGGGGYGGGHGGGHGGGHGGGGGGGGGGGGG 72 [148][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 [149][TOP] >UniRef100_B3MJM6 GF14078 n=1 Tax=Drosophila ananassae RepID=B3MJM6_DROAN Length = 338 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 5/42 (11%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLD-----GYGGG 251 G+GGGHGG GG+GGGGG+G GG GGGG+G GYGGG Sbjct: 277 GFGGGHGGGGGYGGGGGYG-GGPGGGGGYGGSPGGGGGYGGG 317 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 2/38 (5%) Frame = +3 Query: 141 GYGGGHGGH--GGHGGGGGHGHGGHNGGGGHGLDGYGG 248 G+GGG GG GGHGGGGG+G GG GGG G GYGG Sbjct: 269 GFGGGPGGGFGGGHGGGGGYGGGGGYGGGPGGGGGYGG 306 [150][TOP] >UniRef100_A8X1J0 C. briggsae CBR-GRL-4 protein n=1 Tax=Caenorhabditis briggsae RepID=A8X1J0_CAEBR Length = 217 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 12/52 (23%) Frame = -2 Query: 250 PPPY---PSSPWPPPPLC--------PPCPWPPPPP*PP-CPPWPPP*PSGC 131 PPP P P PPPP+C PPCP PPPPP PP CPP PPP S C Sbjct: 34 PPPMCAPPPLPCPPPPICPPQFCPPPPPCPPPPPPPPPPMCPPPPPPMYSPC 85 [151][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 99 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P P PPPP PP P PPPPP PP PP PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 101 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP P P P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 101 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 [152][TOP] >UniRef100_C8VGJ1 Putative uncharacterized protein n=2 Tax=Emericella nidulans RepID=C8VGJ1_EMENI Length = 440 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+GGG GGHGGH GG G GHGGH GG G G+GGG Sbjct: 347 GFGGGSGGHGGHEGGHG-GHGGHEGGHGGNGGGFGGG 382 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+ GGHGGHGGH GG G GG GGGG G G+GGG Sbjct: 357 GHEGGHGGHGGHEGGHGGNGGGFGGGGGGGGGGFGGG 393 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGG-GGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG+GGG GG G GG GG G G G+GGG Sbjct: 307 GYGGGEGGNGGNGGGFGGGGGGGGGGGFGGGSGGFGGG 344 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGH-GGHGGGGGH--GHGGHNGGGGHGLDGYGGG 251 G GGHGGH GGHGG GGH GHGG+ GG G G G GGG Sbjct: 350 GGSGGHGGHEGGHGGHGGHEGGHGGNGGGFGGGGGGGGGG 389 [153][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 [154][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 63 PPPPPPPPPPPPP--PPPPPPPPPPPPPSPPPPPPPP 97 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPP-PPSPPPPP 94 [155][TOP] >UniRef100_UPI00019261C6 PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI00019261C6 Length = 241 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 6/43 (13%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWP------PPPP*PPCPPWPPP*P 140 PPP P P PPPP C P P+P PPPP PPCPP P P P Sbjct: 162 PPPPPPPPPPPPPPCAPMPYPFPCYASPPPPPPPCPPPPAPCP 204 [156][TOP] >UniRef100_UPI0000223072 Hypothetical protein CBG22624 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000223072 Length = 397 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 7/44 (15%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHG-------HGGHNGGGGHGLDGYGGG 251 G GG+GGHGG+GG GGHG HGGH G GG G DG GG Sbjct: 83 GGNGGNGGHGGNGGNGGHGGNGGNGGHGGHGGDGGRGGDGGNGG 126 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 7/44 (15%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHG-------HGGHNGGGGHGLDGYGGG 251 G GG+GGHGG+GG GGHG HGGH G GG G DG GG Sbjct: 119 GGDGGNGGHGGNGGNGGHGGNGGNGGHGGHGGDGGRGGDGGNGG 162 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 7/44 (15%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHG-------HGGHNGGGGHGLDGYGGG 251 G GG+GGHGG+GG GGHG HGGH G GG G DG GG Sbjct: 155 GGDGGNGGHGGNGGNGGHGGNGGNGGHGGHGGDGGRGGDGGNGG 198 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/44 (56%), Positives = 28/44 (63%), Gaps = 7/44 (15%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-------GHGGHNGGGGHGLDGYGGG 251 G GG+GGHGGHGG GG GHGG+ G GGHG +G GG Sbjct: 101 GGNGGNGGHGGHGGDGGRGGDGGNGGHGGNGGNGGHGGNGGNGG 144 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/44 (56%), Positives = 28/44 (63%), Gaps = 7/44 (15%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-------GHGGHNGGGGHGLDGYGGG 251 G GG+GGHGGHGG GG GHGG+ G GGHG +G GG Sbjct: 137 GGNGGNGGHGGHGGDGGRGGDGGNGGHGGNGGNGGHGGNGGNGG 180 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 138 EGYGGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGGG 251 +G GG GG+GGHGG GG+G HGG+ G GGHG G GG Sbjct: 115 DGGRGGDGGNGGHGGNGGNGGHGGNGGNGGHGGHGGDGG 153 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 138 EGYGGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGGG 251 +G GG GG+GGHGG GG+G HGG+ G GGHG G GG Sbjct: 151 DGGRGGDGGNGGHGGNGGNGGHGGNGGNGGHGGHGGDGG 189 [157][TOP] >UniRef100_Q7XHB6 Transposon protein, putative, CACTA, En/Spm sub-class n=2 Tax=Oryza sativa RepID=Q7XHB6_ORYSJ Length = 773 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 5/39 (12%) Frame = -2 Query: 250 PPPYPSSPWPPPPL-----CPPCPWPPPPP*PPCPPWPP 149 PPP PS P PPPP PP P PPPPP PPCPP PP Sbjct: 433 PPPAPSPPAPPPPPPPPAPSPPAPPPPPPPPPPCPPAPP 471 [158][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P P PPPP PP P PPPPP PP PP PPP Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P PPPPP PP PP PP PS Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPS 266 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP P P P Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSG 134 PPP P SP PPPP PP P PPPPP PP P PP P G Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKG 274 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP P P PPPPP PP PP PPP P Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 262 [159][TOP] >UniRef100_A0P8W6 Cell wall glycine-rich protein n=1 Tax=Cucumis sativus RepID=A0P8W6_CUCSA Length = 119 Score = 57.4 bits (137), Expect = 5e-07 Identities = 43/98 (43%), Positives = 51/98 (52%), Gaps = 20/98 (20%) Frame = +3 Query: 18 MASKALILLGLFS--VLLVVSEVSA---ARQSGMVKPESEETVQPEG------------- 143 M+SKA + LGL VLL+ SEV+A A S K ++E TV+ G Sbjct: 1 MSSKAFVFLGLLLAFVLLLSSEVAARDLAETSS--KTDNEATVETNGVEDAKYGRGGYDR 58 Query: 144 -YGGGHG-GHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 YGGGH G+GG GG G GH G GG G G GYG G Sbjct: 59 GYGGGHDRGYGGGRGGYGRGHYGGRGGYGGGRGGYGRG 96 [160][TOP] >UniRef100_A7XYI3 JXC1 n=1 Tax=Monodelphis domestica RepID=A7XYI3_MONDO Length = 918 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P + PPPPL PP P PPPPP PP PP PPP P Sbjct: 757 PPEPLALVPPPPLLPPLPLPPPPPPPPPPPPPPPPP 792 [161][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSL 116 PPP P P PPPPL PP P PPP P PP PP PPP P G +S + Sbjct: 1211 PPPLPPPPPPPPPLPPPPPPPPPLPPPPPPP-PPPPPVGECISDM 1254 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 1209 PPPPPLPPPPPPP--PPLPPPPPPP-PPLPPPPPPPP 1242 [162][TOP] >UniRef100_B9PW07 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii GT1 RepID=B9PW07_TOXGO Length = 508 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/36 (69%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGG-GHGLDGYGGG 251 GGG+GG GG+GGGGG+G GG+ GGG G G GYGGG Sbjct: 299 GGGYGGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGG 334 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG+GGGGG+G GGGG G GYGGG Sbjct: 357 GYGGGGGGYGGYGGGGGYG-----GGGGFGSGGYGGG 388 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGG--GHGHGGHNGGGGHGLDGYGGG 251 GYGGG+GG+GG G GG G G+GG NGG G G GYGGG Sbjct: 323 GYGGGNGGYGGGGNGGYGGGGYGGGNGGYGGGGGGYGGG 361 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/40 (62%), Positives = 29/40 (72%), Gaps = 6/40 (15%) Frame = +3 Query: 150 GGHGGHG------GHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GG+GGHG G+GGGGG+G GG GGGG+G GYGGG Sbjct: 288 GGYGGHGSPYGGGGYGGGGGYGGGGGYGGGGYGGGGYGGG 327 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGGHGGG--GGHGHGGHNGG-GGHGLDGYGGG 251 G GGG+GG GG+GGG GG G+GG NGG GG G GYGGG Sbjct: 303 GGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGYGGG 342 [163][TOP] >UniRef100_B7Q3T8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3T8_IXOSC Length = 247 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/69 (46%), Positives = 38/69 (55%), Gaps = 3/69 (4%) Frame = +3 Query: 54 SVLLVVSEVSAARQSGMVKPESEETVQ---PEGYGGGHGGHGGHGGGGGHGHGGHNGGGG 224 SVL + + SG K ++ + P+G GGG GG GG GGGGG G GG GGGG Sbjct: 144 SVLTLPFPLPTMPDSGETKRSAKRKTKSHRPKGSGGGGGGGGGGGGGGGGGGGGGGGGGG 203 Query: 225 HGLDGYGGG 251 G G GGG Sbjct: 204 GGGGGGGGG 212 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/57 (50%), Positives = 33/57 (57%) Frame = +3 Query: 81 SAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 SA R++ +P+ G GGG GG GG GGGGG G GG GGGG G G GGG Sbjct: 164 SAKRKTKSHRPKGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 220 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = +3 Query: 90 RQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 ++S K +S G GGG GG GG GGGGG G GG GGGG G G GGG Sbjct: 162 KRSAKRKTKSHRPKGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 215 [164][TOP] >UniRef100_B6KME4 RRM domain-containing protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KME4_TOXGO Length = 513 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGG-GHGLDGYGGG 251 GYGGG G GG+GGGGG+G GG+ GGG G G GYGGG Sbjct: 301 GYGGGGYGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGG 338 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG+GGGGG+G GGGG G GYGGG Sbjct: 362 GYGGGGGGYGGYGGGGGYG-----GGGGFGSGGYGGG 393 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 8/43 (18%) Frame = +3 Query: 147 GGGHGGHGGHG--------GGGGHGHGGHNGGGGHGLDGYGGG 251 G G GG+GGHG GGGG+G GG+ GGGG+G GYGGG Sbjct: 284 GMGRGGYGGHGSPYGGGGYGGGGYGGGGYGGGGGYGGGGYGGG 326 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGG--GHGHGGHNGG-GGHGLDGYGGG 251 GYGGG+GG+GG G GG G G+GG NGG GG G GYGGG Sbjct: 327 GYGGGNGGYGGGGNGGYGGGGYGGGNGGYGGGGGGGYGGG 366 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGH--GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG+GGGGG G+GG GGGG+G GYGGG Sbjct: 342 GYGGGGYGGGNGGYGGGGGGGYGG--GGGGYG--GYGGG 376 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/43 (62%), Positives = 30/43 (69%), Gaps = 6/43 (13%) Frame = +3 Query: 141 GYGG-----GHGGHGGHG-GGGGHGHGGHNGGGGHGLDGYGGG 251 GYGG G GG+GG G GGGG+G GG GGGG+G GYGGG Sbjct: 289 GYGGHGSPYGGGGYGGGGYGGGGYGGGGGYGGGGYGGGGYGGG 331 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/41 (68%), Positives = 31/41 (75%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGG-HGGHGGHGGG--GGHGHGGHNGG-GGHGLDGYGGG 251 GYGGG +GG GG+GGG GG G+GG NGG GG G GYGGG Sbjct: 306 GYGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGYGGG 346 [165][TOP] >UniRef100_B4NC76 GK25807 n=1 Tax=Drosophila willistoni RepID=B4NC76_DROWI Length = 234 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGG--HNGGGGHGLDGYGGG 251 G GGG+GG GG GGGG+G GG H GGGG+G GYGGG Sbjct: 27 GGGGGYGGGGGGNGGGGYGGGGGSHGGGGGNGGGGYGGG 65 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 13/50 (26%) Frame = +3 Query: 141 GYGGGHGGHGG---------HGGGGGHGHGGHNGGGGH----GLDGYGGG 251 GYGGG GG+GG HGGGGG+G GG+ GGGG G GYGGG Sbjct: 31 GYGGGGGGNGGGGYGGGGGSHGGGGGNGGGGYGGGGGSHGGGGGGGYGGG 80 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGG----GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGG G GG+GG+GGGGG HGG NGGGG+G +G GGG Sbjct: 153 GYGGNGGNGGGGYGGNGGGGGGKHGG-NGGGGYGGNGGGGG 192 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGG-HGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGG GG GG HGGGGG G+GG NGGGG G G GGG Sbjct: 183 GYGGNGGGGGGKHGGGGGGGYGG-NGGGGGGKHGGGGG 219 [166][TOP] >UniRef100_B4JLS9 GH24514 n=1 Tax=Drosophila grimshawi RepID=B4JLS9_DROGR Length = 587 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/37 (75%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG GG GGGGG GHGG GGGGHG GYGGG Sbjct: 23 GGGGGGGGGGGGGGGGGGGHGG-GGGGGHG-GGYGGG 57 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/40 (70%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNG---GGGHGLDGYGGG 251 G GGG GG GGHGGGGG GHGG G GGGHG G+GGG Sbjct: 31 GGGGGGGGGGGHGGGGGGGHGGGYGGGHGGGHG-GGHGGG 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 18/55 (32%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGH------------------GGHNGGGGHGLDGYGGG 251 GYGGGHGG GHGGG G GH GGH GGGGHG GY GG Sbjct: 53 GYGGGHGG--GHGGGHGGGHGGGHGGGGVHVVKVIQEQGGHYGGGGHGGGGYSGG 105 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 14/57 (24%) Frame = +3 Query: 123 ETVQPEG--YGGGHGGHGGHGGGGGHG------------HGGHNGGGGHGLDGYGGG 251 + +Q +G YGGG G GG+ GGGGHG GGH GGGGHG GY GG Sbjct: 83 KVIQEQGGHYGGGGHGGGGYSGGGGHGGGGVHVVKLIQEQGGHYGGGGHGGGGYSGG 139 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/55 (50%), Positives = 31/55 (56%), Gaps = 14/55 (25%) Frame = +3 Query: 129 VQPEG--YGGGHGGHGGHGGGGGHG------------HGGHNGGGGHGLDGYGGG 251 +Q +G YGGG G GG+ GGGGHG GGH GGGGHG GY GG Sbjct: 119 IQEQGGHYGGGGHGGGGYSGGGGHGGGGVHVVKLIQEQGGHYGGGGHGGGGYSGG 173 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/42 (66%), Positives = 30/42 (71%), Gaps = 5/42 (11%) Frame = +3 Query: 141 GYGGGHGGHGG--HGGGGGHGHGGHNG---GGGHGLDGYGGG 251 G GGGHGG GG HGGG G GHGG +G GGGHG G+GGG Sbjct: 37 GGGGGHGGGGGGGHGGGYGGGHGGGHGGGHGGGHG-GGHGGG 77 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/57 (45%), Positives = 30/57 (52%), Gaps = 14/57 (24%) Frame = +3 Query: 123 ETVQPEGYGGGHGGHGGHGGGGGHGH--------------GGHNGGGGHGLDGYGGG 251 + V+ + GGH G GGHGGG G GH GGH+GGGGH GY GG Sbjct: 210 QVVKVVEHQGGHSGGGGHGGGHGGGHGGGGVQVVKVIKEQGGHSGGGGHDGGGYSGG 266 [167][TOP] >UniRef100_B0W5B7 Putative uncharacterized protein n=1 Tax=Culex quinquefasciatus RepID=B0W5B7_CULQU Length = 147 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Frame = +3 Query: 33 LILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHG-GGGGHGHGGH 209 L+++ +F+VL++ S G K ++ G GGG GGHG G G GGHG G+ Sbjct: 4 LMIMTIFAVLVLASADHGGSSGGYGKSSYQKN--SGGGGGGQGGHGQQGFGQGGHGQQGY 61 Query: 210 NGGGGHGLDGYGGG 251 GGGHG G+G G Sbjct: 62 GQGGGHGQQGFGQG 75 [168][TOP] >UniRef100_A8XGY9 C. briggsae CBR-RNH-1.1 protein n=1 Tax=Caenorhabditis briggsae RepID=A8XGY9_CAEBR Length = 519 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/69 (49%), Positives = 39/69 (56%), Gaps = 6/69 (8%) Frame = +3 Query: 63 LVVSEVSAARQSGMVKPESEETVQPE------GYGGGHGGHGGHGGGGGHGHGGHNGGGG 224 L +SE + + S V+ E E G GGG GG GGHGGGG HG GGH GGG Sbjct: 35 LAISETTTNQTSQRVEQVQEVVDCQEDRRSLGGKGGGGGGGGGHGGGG-HGGGGH-GGGS 92 Query: 225 HGLDGYGGG 251 HG G+GGG Sbjct: 93 HGGGGHGGG 101 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/42 (71%), Positives = 30/42 (71%), Gaps = 5/42 (11%) Frame = +3 Query: 141 GYGGGHGG--HGGHG-GGGGHGHGGHNG--GGGHGLDGYGGG 251 G GGGHGG HGG G GGG HG GGH G GGGHG GYGGG Sbjct: 73 GGGGGHGGGGHGGGGHGGGSHGGGGHGGGHGGGHG-SGYGGG 113 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/38 (73%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHG-GGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GGHGG G GGGGHG GG +GGGGHG G+GGG Sbjct: 70 GGGGGGGGHGGGGHGGGGHG-GGSHGGGGHG-GGHGGG 105 [169][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P SP PPPP PP P PP PP PP P PPP PS Sbjct: 25 PPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPS 62 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/42 (66%), Positives = 28/42 (66%), Gaps = 4/42 (9%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*P----PCPPWPPP*PS 137 PPP PSSP PPPP PP P PPPPP P P PP PPP PS Sbjct: 64 PPPPPSSPPPPPP--PPSPPPPPPPSPPPPLPSPPPPPPLPS 103 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP PS P PPPP PP P PPPP PP P PPP PS Sbjct: 144 PPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPS 181 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P SP PPPP PP P P PPP PP P PPP P Sbjct: 73 PPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPP 109 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 5/43 (11%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPW--PPPPP*PPCPPW---PPP*PS 137 PPP PSSP PPPP PP P PPPPP PP PP PPP PS Sbjct: 107 PPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPS 149 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWP-PPPP*PPCPPWPPP*P 140 PPP P SP PPP L PP P P PPPP PP PP PPP P Sbjct: 128 PPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSP 165 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*P--PCPPWPPP*P 140 P P P P PPPPL PP P PPPPP P P PP PPP P Sbjct: 156 PSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPP 194 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCP--WPPPPP*PPCPPWPPP 146 PPP P SP PPPP PP P PPPPP PP PP PPP Sbjct: 49 PPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPP 85 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPP-CPWPPPPP*PPCPPWPPP*PS 137 PPP PS P PPPP PP P PPPPP P PP PPP PS Sbjct: 74 PPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPS 112 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWP-PPPP*PPCPPWPPP*P 140 PPP PS P PPPP PP P P PP P PP PP PPP P Sbjct: 192 PPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPP 229 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWP-PPPP*PPCPPWP-PP*P 140 PPP PSSP PPPP PP P P PPPP PP PP P PP P Sbjct: 10 PPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSP 48 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP PS P PPPP PP P PPP P PP PP PPP Sbjct: 57 PPPPPSQP-PPPPSSPPPPPPPPSPPPPPPPSPPP 90 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 P PS P PPPP PP P PPPPP PP P PPP PS Sbjct: 217 PSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPPPPPS 253 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 6/44 (13%) Frame = -2 Query: 250 PPPYPSSPWPPPPL----CPPCPWPPPPP*PPCPP--WPPP*PS 137 PPP PS P PPPP PP P PPPPP PP PP PPP PS Sbjct: 26 PPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPS 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P SP PPPP PP P PPP PP PP PPP Sbjct: 121 PPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPP 155 [170][TOP] >UniRef100_Q2HEQ9 Predicted protein n=1 Tax=Chaetomium globosum RepID=Q2HEQ9_CHAGB Length = 438 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/52 (53%), Positives = 29/52 (55%) Frame = +3 Query: 96 SGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 S M P +T G GGG GG GG GGGGG G GG GGG G G GGG Sbjct: 348 STMSAPTRRQTTSTRGGGGGGGGRGGGGGGGGRGGGGGGRGGGGGGGGRGGG 399 [171][TOP] >UniRef100_B8PHZ3 Predicted protein n=1 Tax=Postia placenta Mad-698-R RepID=B8PHZ3_POSPM Length = 517 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/38 (68%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDG-YGGG 251 G GGG+GG GG+GGGGG+G GG GGGG+G G YGGG Sbjct: 405 GGGGGYGGGGGYGGGGGYGGGGGYGGGGYGGGGVYGGG 442 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDG-YGGG 251 G GGG+GG GG+GGGGG+G GG+ GGG +G G YGGG Sbjct: 411 GGGGGYGGGGGYGGGGGYGGGGYGGGGVYGGGGAYGGG 448 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/51 (52%), Positives = 32/51 (62%), Gaps = 12/51 (23%) Frame = +3 Query: 135 PEGYGG-----------GHGGHGGHGGGGGHGHGG-HNGGGGHGLDGYGGG 251 P YGG G+GG GG+GGGGG+G GG + GGGG+G GYGGG Sbjct: 386 PAAYGGALGGVVPGTTTGYGGGGGYGGGGGYGGGGGYGGGGGYGGGGYGGG 436 [172][TOP] >UniRef100_A8N6M0 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8N6M0_COPC7 Length = 108 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G G GG GG+ GGGG+G GG++GGGG+G GYGGG Sbjct: 49 GSGGGGGGGYSGGGGYGGGGYSGGGGYGGGGYGGG 83 [173][TOP] >UniRef100_P37704 Glycine-rich protein DC7.1 n=1 Tax=Daucus carota RepID=GRP7_DAUCA Length = 96 Score = 57.4 bits (137), Expect = 5e-07 Identities = 38/76 (50%), Positives = 44/76 (57%), Gaps = 5/76 (6%) Frame = +3 Query: 18 MASKALILLGLFSV--LLVVSEVSAARQSGMVKPESEETVQPEGYGGGH--GGHGGH-GG 182 M SK +LLGL LL+ SEV+A + SE T + GGH GG GGH G Sbjct: 1 MGSKIFLLLGLSIAFALLISSEVAA-------RDLSETTTEGASLDGGHHGGGGGGHYSG 53 Query: 183 GGGHGHGGHNGGGGHG 230 GGGHG G H+GGGGHG Sbjct: 54 GGGHG-GSHHGGGGHG 68 [174][TOP] >UniRef100_Q5B0J9 ATP-dependent RNA helicase dbp2 n=2 Tax=Emericella nidulans RepID=DBP2_EMENI Length = 563 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/38 (65%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGG-HGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+GGG+GG GG +GGGGG G+GG GGGG+G GYG G Sbjct: 30 GHGGGYGGRGGGYGGGGGSGYGGGYGGGGYGGGGYGRG 67 [175][TOP] >UniRef100_UPI0001A7B233 nucleic acid binding n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B233 Length = 405 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 3/41 (7%) Frame = +3 Query: 138 EGYGGGHGGHGGHGGGGGHGHGGHNG---GGGHGLDGYGGG 251 EGYGGG GG+GG GG G G+GG G GGG G DGYGGG Sbjct: 292 EGYGGGRGGYGGRSGGQGDGYGGGRGDGYGGGRG-DGYGGG 331 [176][TOP] >UniRef100_UPI0001984704 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984704 Length = 462 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/58 (51%), Positives = 38/58 (65%), Gaps = 6/58 (10%) Frame = +3 Query: 96 SGMVKPESEETVQPE-----GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGL-DGYGGG 251 SG+ + +E+ QP G GGG+GG G GGGGG G+GG++GGGG G GYGGG Sbjct: 2 SGVYGHDGDESGQPPSSGGYGGGGGYGGGGYGGGGGGGGYGGNSGGGGGGRGGGYGGG 59 [177][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGC 131 PPP P P PP P PP P PPPPP PP PP PPP P C Sbjct: 15 PPPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPPPPLPLQC 54 [178][TOP] >UniRef100_UPI0000F2EA00 PREDICTED: similar to Jmy-pending protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2EA00 Length = 500 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/48 (56%), Positives = 30/48 (62%) Frame = +3 Query: 108 KPESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 KP+S++ G GG GG GG GGGGG G GG GGGG G G GGG Sbjct: 441 KPDSKKDPGSGGGRGGRGGRGGRGGGGGGGSGGGAGGGGGGNSGGGGG 488 [179][TOP] >UniRef100_UPI0000E4626F PREDICTED: similar to heterogeneous nuclear ribonucleoprotein A2/B1 n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E4626F Length = 360 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +3 Query: 123 ETVQPEGYGGGHGGH-GGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 E Q GYGG GG+ GG GGGGG+G GG+ GGGG GYGGG Sbjct: 186 EQQQGGGYGGQGGGYRGGQGGGGGYGGGGYGGGGGDYQGGYGGG 229 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +3 Query: 138 EGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLD-GYGGG 251 +G GGG+GG GG+GGGGG GG+ GGGG G + GYGGG Sbjct: 204 QGGGGGYGG-GGYGGGGGDYQGGYGGGGGGGYNQGYGGG 241 [180][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P+ P PPPP PP P PPPPP P PP PPP P Sbjct: 636 PPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPPP 672 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P+ P PPP PP P PPPPP PP PP PPP P+ Sbjct: 658 PPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPPPPA 695 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PP P PP P PPPPP PP PP PPP P+ Sbjct: 624 PPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPA 661 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P PPP P PP PP PPP P+ Sbjct: 620 PPPAPPPPPPPPP--PPAPPPPPAPPPPPPPAPPPPPA 655 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P+ P PP P PP P PPPPP PP PP P P P+ Sbjct: 630 PPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPA 667 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P +P PPPP PP P P PPP PP PP PPP P Sbjct: 643 PPPPPPAP-PPPPAPPPPPAPAPPPAPPPPPPPPPAP 678 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPW-PPPPP*PPCPPWPPP*P 140 PPP P+ P P PP PP P PPPPP PP PP PPP P Sbjct: 609 PPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPP 646 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPW--PPPPP*PPCPPWPPP*PS 137 PPP P+ P PP P PP P PPPPP PP PP PPP P+ Sbjct: 650 PPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPA 689 [181][TOP] >UniRef100_Q7SXQ3 Zgc:66127 n=1 Tax=Danio rerio RepID=Q7SXQ3_DANRE Length = 388 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/39 (71%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHG-GHNG-GGGHGLDGYGGG 251 GYGGG+GG GG GGGGG+G G G+NG GGG+G GYGGG Sbjct: 219 GYGGGYGGGGGRGGGGGYGGGDGYNGYGGGNG--GYGGG 255 [182][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP P P P Sbjct: 135 PPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPP 171 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP PPP P PP PP PPP PS Sbjct: 230 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPS 267 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPP-P*PPCPPWPPP 146 PPP P P PPPP PP P PPPP P PP PP PPP Sbjct: 406 PPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPP 441 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPL-CPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P PP PP PP PP PPP PS Sbjct: 125 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPS 163 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPP P PP PP P P P Sbjct: 140 PPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPP 176 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPP-P*PPCPPWPPP*P 140 PPP PS P PPPP PP P PPPP P PP PP P P P Sbjct: 149 PPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 186 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP P P P Sbjct: 240 PPPSPPPPSPPPP-SPPPPSPPPPPPPPSPPPPSPPP 275 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP PPP P PP PP PPP P Sbjct: 284 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSP 320 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPP PP PP PPP P Sbjct: 289 PPPSPPPPSPPPP-SPPPPSPPPPSPPPPPPSPPPSP 324 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP PPP P PP PP PPP P Sbjct: 340 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSP 376 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPP PP PP PPP P Sbjct: 345 PPPSPPPPSPPPP-SPPPPSPPPPSPPPPPPSPPPSP 380 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP PP PPP P Sbjct: 130 PPPSPPPPSPPPP-SPPPPSPPPPPSPPPPP-PPPSP 164 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP PP P PPP P Sbjct: 396 PPPSPPPPSPPPP-SPPPPSPPPPPSPPPPSPPPPSP 431 [183][TOP] >UniRef100_Q39DL0 Putative uncharacterized protein n=1 Tax=Burkholderia sp. 383 RepID=Q39DL0_BURS3 Length = 563 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/43 (62%), Positives = 30/43 (69%), Gaps = 5/43 (11%) Frame = +3 Query: 138 EGYGGGHGGHGGHGGG--GGHGHGGHNG---GGGHGLDGYGGG 251 +G GGGHG GGHG G GGHGHGG +G GGGHG G+G G Sbjct: 307 DGDGGGHGHGGGHGDGDGGGHGHGGGHGDGDGGGHGNGGHGNG 349 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/48 (60%), Positives = 30/48 (62%), Gaps = 14/48 (29%) Frame = +3 Query: 150 GGHGGHGGHGG----GGGHGHGGHNG----------GGGHGLDGYGGG 251 GGHGGHGGHGG GGGHG+GGH GGGHG DG GGG Sbjct: 280 GGHGGHGGHGGGDGDGGGHGNGGHGDGDGDGGGHGHGGGHG-DGDGGG 326 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/48 (62%), Positives = 32/48 (66%), Gaps = 10/48 (20%) Frame = +3 Query: 138 EGYGGGHGGHGGHGGG--GGHGHGGH-NG-------GGGHGLDGYGGG 251 +G GGGHG GGHG G GGHG+GGH NG GGGHG DG GGG Sbjct: 321 DGDGGGHGHGGGHGDGDGGGHGNGGHGNGDGGGHGNGGGHG-DGDGGG 367 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/47 (63%), Positives = 31/47 (65%), Gaps = 10/47 (21%) Frame = +3 Query: 141 GYGGGHGGHGGHGGG--GGHGHGGH-NG-------GGGHGLDGYGGG 251 G GGGHG GGHG G GGHG+GGH NG GGGHG DG GGG Sbjct: 349 GDGGGHGNGGGHGDGDGGGHGNGGHGNGDGGGHGNGGGHG-DGDGGG 394 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/47 (63%), Positives = 31/47 (65%), Gaps = 10/47 (21%) Frame = +3 Query: 141 GYGGGHGGHGGHGGG--GGHGHGGH-NG-------GGGHGLDGYGGG 251 G GGGHG GGHG G GGHG+GGH NG GGGHG DG GGG Sbjct: 376 GDGGGHGNGGGHGDGDGGGHGNGGHGNGDGGGHGNGGGHG-DGDGGG 421 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/47 (63%), Positives = 31/47 (65%), Gaps = 10/47 (21%) Frame = +3 Query: 141 GYGGGHGGHGGHGGG--GGHGHGGH-NG-------GGGHGLDGYGGG 251 G GGGHG GGHG G GGHG+GGH NG GGGHG DG GGG Sbjct: 403 GDGGGHGNGGGHGDGDGGGHGNGGHGNGDGGGHGNGGGHG-DGDGGG 448 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGHGGHG--GGGGHGHGGH-NG-GGGHGLDGYGGG 251 G G GHG GGHG GGGHG+GGH NG GGGHG G+G G Sbjct: 457 GDGSGHGNGGGHGEGDGGGHGNGGHGNGDGGGHGNGGHGHG 497 [184][TOP] >UniRef100_Q1BU84 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia AU 1054 RepID=Q1BU84_BURCA Length = 517 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHG-GHGGHGGGGGHGHGG--HNGGGGHGLDGYGGG 251 G GGGHG G GGHG GGGHG+GG + GGGHG G GGG Sbjct: 287 GNGGGHGDGGGGHGNGGGHGNGGGGNGNGGGHGNGGGGGG 326 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHG-GHGGHGGGGGHGHGG--HNGGGGHGLDGYGGG 251 G GGGHG G GGHG GGGHG GG H GGGHG G G G Sbjct: 274 GNGGGHGDGGGGHGNGGGHGDGGGGHGNGGGHGNGGGGNG 313 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHG-GHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGGHG G GG+G GGGHG+GG GGGG G G GGG Sbjct: 300 GNGGGHGNGGGGNGNGGGHGNGGGGGGGGGGGGGGGGG 337 [185][TOP] >UniRef100_A5GPV8 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. RCC307 RepID=A5GPV8_SYNR3 Length = 204 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG GG+GGGGG G+GG GG G G GYGGG Sbjct: 100 GYGGGGGGRGGYGGGGG-GYGGGGGGYGGGGGGYGGG 135 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG GG+GGGGG G GG+ GGGG GYGGG Sbjct: 90 GYGGGGGGRGGYGGGGG-GRGGYGGGGG----GYGGG 121 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG GGG G G GG+ GGGG GYGGG Sbjct: 110 GYGGGGGGYGGGGGGYGGGGGGYGGGGG----GYGGG 142 [186][TOP] >UniRef100_A0K9V3 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia HI2424 RepID=A0K9V3_BURCH Length = 509 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHG-GHGGHGGGGGHGHGG--HNGGGGHGLDGYGGG 251 G GGGHG G GGHG GGGHG+GG + GGGHG G GGG Sbjct: 287 GNGGGHGDGGGGHGNGGGHGNGGGGNGNGGGHGNGGGGGG 326 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHG-GHGGHGGGGGHGHGG--HNGGGGHGLDGYGGG 251 G GGGHG G GGHG GGGHG GG H GGGHG G G G Sbjct: 274 GNGGGHGDGGGGHGNGGGHGDGGGGHGNGGGHGNGGGGNG 313 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHG-GHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGGHG G GG+G GGGHG+GG GGGG G G GGG Sbjct: 300 GNGGGHGNGGGGNGNGGGHGNGGGGGGGGGGGGGGGGG 337 [187][TOP] >UniRef100_Q9ZRI2 Environmental stress-induced protein (Fragment) n=1 Tax=Medicago sativa RepID=Q9ZRI2_MEDSA Length = 133 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/39 (71%), Positives = 30/39 (76%), Gaps = 5/39 (12%) Frame = +3 Query: 147 GGGHGGHGGHG--GGGGH---GHGGHNGGGGHGLDGYGG 248 GGGHGGHGG G GGGGH G GG+NGGGGHG G+GG Sbjct: 5 GGGHGGHGGGGYNGGGGHGGYGGGGYNGGGGHG--GHGG 41 [188][TOP] >UniRef100_Q75QN8 Cold shock domain protein 3 n=1 Tax=Triticum aestivum RepID=Q75QN8_WHEAT Length = 231 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGH-NGGGGHGLDGYGGG 251 GYGGG GG+GG GGG G G GG+ GGGG+G GYGGG Sbjct: 94 GYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGYGGG 131 [189][TOP] >UniRef100_A7PDA4 Chromosome chr17 scaffold_12, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PDA4_VITVI Length = 277 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG GG GGGG+G GG+ G GG+G GYGGG Sbjct: 126 GGGGGYGGGGGGYGGGGYGGGGYGGSGGYGGGGYGGG 162 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/40 (65%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGG--HGGGGGHGHGGHNGGG-GHGLDGYGGG 251 GYGGG GG+GG +GGGG G GG+ GGG G G GYGGG Sbjct: 130 GYGGGGGGYGGGGYGGGGYGGSGGYGGGGYGGGSGGYGGG 169 [190][TOP] >UniRef100_A5B074 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B074_VITVI Length = 272 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG GG GGGG+G GG+ G GG+G GYGGG Sbjct: 126 GGGGGYGGGGGGYGGGGYGGGGYGGSGGYGGGGYGGG 162 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/40 (65%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGG--HGGGGGHGHGGHNGGG-GHGLDGYGGG 251 GYGGG GG+GG +GGGG G GG+ GGG G G GYGGG Sbjct: 130 GYGGGGGGYGGGGYGGGGYGGSGGYGGGGYGGGSGGYGGG 169 [191][TOP] >UniRef100_B9PV72 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9PV72_TOXGO Length = 488 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = +3 Query: 111 PESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 P+S+ GYGGG GG+GG GGG G G GG+ GGGG GYGGG Sbjct: 54 PQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGG----GYGGG 96 [192][TOP] >UniRef100_B4M7I0 GJ16994 n=1 Tax=Drosophila virilis RepID=B4M7I0_DROVI Length = 205 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/38 (65%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGG-HNGGGGHGLDGYGGG 251 G GGG+GG GG+GGGGG+G GG ++GGGG+G GY GG Sbjct: 42 GGGGGYGGGGGYGGGGGYGGGGGYHGGGGYGGGGYQGG 79 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGG--HGLDGYGGG 251 G+GGG GG GG+GGGGG+G GG GGGG HG GYGGG Sbjct: 37 GHGGGGGG-GGYGGGGGYGGGGGYGGGGGYHGGGGYGGG 74 [193][TOP] >UniRef100_Q5KCZ6 Putative uncharacterized protein n=1 Tax=Filobasidiella neoformans RepID=Q5KCZ6_CRYNE Length = 667 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGHGGH----GGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGHGGHGGH G GG HGHGG GGGG G G GGG Sbjct: 534 GGHGGHGGHGGHGFGRGRGGHHGHGGGGGGGGGGGGGGGGG 574 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 9/46 (19%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGG---------GHGHGGHNGGGGHGLDGYGGG 251 G GGHGGHGGHGG G GHG GG GGGG G G GGG Sbjct: 531 GRRGGHGGHGGHGGHGFGRGRGGHHGHGGGGGGGGGGGGGGGGGGG 576 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYG 245 G+G G GGH GHGGGGG G GG GGGG G G+G Sbjct: 546 GFGRGRGGHHGHGGGGGGGGGGGGGGGGGGGKGHG 580 [194][TOP] >UniRef100_UPI000042D0EA hypothetical protein CNBF3470 n=1 Tax=Cryptococcus neoformans var. neoformans B-3501A RepID=UPI000042D0EA Length = 559 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGH--GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG GGGGG+G GG GGG+G GYGGG Sbjct: 25 GYGGGGYGGGYGGGGGGGGYGGGGGGYGGGYGGGGYGGG 63 [195][TOP] >UniRef100_UPI0000123EDF Hypothetical protein CBG13051 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000123EDF Length = 482 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG GGHGGGG HG GGH GGG HG G+GGG Sbjct: 47 GKGGGGGGGGGHGGGG-HGGGGH-GGGSHGGGGHGGG 81 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/42 (71%), Positives = 30/42 (71%), Gaps = 5/42 (11%) Frame = +3 Query: 141 GYGGGHGG--HGGHG-GGGGHGHGGHNG--GGGHGLDGYGGG 251 G GGGHGG HGG G GGG HG GGH G GGGHG GYGGG Sbjct: 53 GGGGGHGGGGHGGGGHGGGSHGGGGHGGGHGGGHG-SGYGGG 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/38 (73%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHG-GGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GGHGG G GGGGHG GG +GGGGHG G+GGG Sbjct: 50 GGGGGGGGHGGGGHGGGGHG-GGSHGGGGHG-GGHGGG 85 [196][TOP] >UniRef100_Q0BCI9 Putative uncharacterized protein n=1 Tax=Burkholderia ambifaria AMMD RepID=Q0BCI9_BURCM Length = 529 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGG---HGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+GGGHGG GG HGGG G GHGG NGGG G G G G Sbjct: 289 GHGGGHGGGGGGGGHGGGNGGGHGGGNGGGNGGGSGGGSG 328 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/41 (60%), Positives = 28/41 (68%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGH----GGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+GGG GGH GGHG G G+G+GG GGGG G G GGG Sbjct: 378 GHGGGSGGHGNGNGGHGNGNGNGNGGGGGGGGGGGGGGGGG 418 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG GG GGGGG G GG GGGG G G GGG Sbjct: 416 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGG 452 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNG---GGGHGLDGYGGG 251 G GGHGGHGG G G G G+GG NG GGGHG G+GGG Sbjct: 259 GTSGGHGGHGGGGHGDGGGNGGGNGVGNGGGHG-GGHGGG 297 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG GG GGGGG G GG GGGG G G GGG Sbjct: 418 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGG 454 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG GG GGGGG G GG GGGG G G GGG Sbjct: 400 GNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 436 [197][TOP] >UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia MC0-3 RepID=B1JXE0_BURCC Length = 505 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHG-GHGGHGGGGGHGHGG--HNGGGGHGLDGYGGG 251 G GGGHG G GGHG GGGHG GG H GGGHG G G G Sbjct: 282 GSGGGHGDGGGGHGSGGGHGDGGGGHGNGGGHGNGGGGNG 321 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = +3 Query: 141 GYGGGHG-GHGGHGGGGGHGHG--GHNGGGGHGLDGYGG 248 G GGGHG G GGHG GGGHG G GH GGGHG DG GG Sbjct: 256 GNGGGHGDGSGGHGNGGGHGDGSGGHGSGGGHG-DGGGG 293 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = +3 Query: 141 GYGGGHG-GHGGHGGGGGHGH--GGHNGGGGHGLDGYGG 248 G GGGHG G GGHG GGGHG GGH GGGHG DG GG Sbjct: 269 GNGGGHGDGSGGHGSGGGHGDGGGGHGSGGGHG-DGGGG 306 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG+GG+GGGGG G GG GGGG G G GGG Sbjct: 357 GGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGG 393 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG GG GGGGG G GG GGGG+G +G GGG Sbjct: 367 GNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGG 403 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/36 (69%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +3 Query: 147 GGGHGGHGGHG-GGGGHGHGGHNGGGGHGLDGYGGG 251 GGGHG GGHG GGGGHG+GG +G GG G +G GGG Sbjct: 291 GGGHGSGGGHGDGGGGHGNGGGHGNGGGG-NGNGGG 325 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHG--GHNGGGGHGLDGYGG 248 GGG G GGHG GGGHG G GH GGGHG DG GG Sbjct: 246 GGGDGDGGGHGNGGGHGDGSGGHGNGGGHG-DGSGG 280 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHG-GHGGHGGGGGHGH--GGHNGGGGHGLDGYGGG 251 G GGGHG G GGHG GGGHG+ GG+ GGG G G GGG Sbjct: 295 GSGGGHGDGGGGHGNGGGHGNGGGGNGNGGGPGNGGGGGG 334 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG GG GGGGG G G NGGGG G G GGG Sbjct: 375 GGGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGGG 411 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG GG GGGGG G+GG+ GGGG G GGG Sbjct: 376 GGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGGGG 412 [198][TOP] >UniRef100_A4YK94 Putative uncharacterized protein n=1 Tax=Bradyrhizobium sp. ORS278 RepID=A4YK94_BRASO Length = 220 Score = 56.6 bits (135), Expect = 8e-07 Identities = 36/80 (45%), Positives = 44/80 (55%), Gaps = 2/80 (2%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEE--TVQPEGYGGGHGGHGGHGGGGG 191 +A+ ALI+L S + + + V P S E T+Q G GG GG GGHGGGG Sbjct: 17 LAAAALIVLAGASGRPASAMTPVSPGATPVAPASAEALTIQVRGPGGHGGGGGGHGGGGF 76 Query: 192 HGHGGHNGGGGHGLDGYGGG 251 HG GG +GGG G G GGG Sbjct: 77 HGGGGFHGGG--GFHGGGGG 94 [199][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PP P SP PPPP PP P PPPPP PP PP PPP PS Sbjct: 525 PPPPPSP-PPPPSPPPPPSPPPPPSPPPPPSPPPPPS 560 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PP P SP PPPP PP P PPPPP PP PP PPP PS Sbjct: 531 PPPPPSP-PPPPSPPPPPSPPPPPSPPPPPSPPPPPS 566 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PP P SP PPPP PP P PPPPP PP PP PPP PS Sbjct: 537 PPPPPSP-PPPPSPPPPPSPPPPPSPPPPPSPPPPPS 572 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PP P SP PPPP PP P PPPPP PP PP PPP PS Sbjct: 543 PPPPPSP-PPPPSPPPPPSPPPPPSPPPPPSPPPPPS 578 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PP P SP PPPP PP P PPPPP PP PP PPP PS Sbjct: 549 PPPPPSP-PPPPSPPPPPSPPPPPSPPPPPSPPPPPS 584 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCP-WPPPPP*PPCPPWPPP*PS 137 PP PS P PPPP PP P PPPPP PP PP PPP PS Sbjct: 517 PPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS 554 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PP P P P PP PP P PPPPP PP PP PPP PS Sbjct: 512 PPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPS 548 [200][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPP-P*PPCPPWPPP*P 140 PPP P SP PPPP PP P PPPP P PP PP PPP P Sbjct: 176 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 213 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/66 (48%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPP------P*PPCPPWPPP*PSGCTVSSLSGFTMPDCL 89 PPP P SP PPPP PP P PPPP P PP PP PPP PS S P C Sbjct: 202 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP-PPPPPSPPPPSPPPPSPPPPCK 260 Query: 88 AADTSE 71 T E Sbjct: 261 VCATWE 266 [201][TOP] >UniRef100_Q2QQ97 Os12g0502200 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2QQ97_ORYSJ Length = 258 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = +3 Query: 105 VKPESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 V +E T GGG+GG G GGGGG+G GG++GGGG+G GY GG Sbjct: 104 VNTANERTGGFRSGGGGYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSGG 152 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/39 (66%), Positives = 30/39 (76%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHG--GGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG G GGGG+G GG++GGGG G GY GG Sbjct: 125 GYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGG-GGYQGG 162 [202][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 5/43 (11%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PP-----CPPWPPP*PS 137 PPP P SP PPPP PP P PPPPP PP PP PPP PS Sbjct: 1095 PPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPS 1137 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 5/42 (11%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PP-----CPPWPPP*PS 137 PP P SP PPPP PP P PPPPP PP PP PPP P+ Sbjct: 1165 PPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPN 1206 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PP P SP PPP PP P PPPPP PP PP PPP PS Sbjct: 1085 PPSPPSPPSPPPPPPPSPPPPPPPSPP-PPRPPPPPS 1120 [203][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPL-CPPCPWPPPPP*PPCPPWPPP*P 140 PPP P+ P PPPP PP P PPPPP PP PP PPP P Sbjct: 240 PPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPP 277 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP P P PPPPP PP PP PPP PS Sbjct: 250 PPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPS 287 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P SP PPPP PP P PPPPP PP PP P P P Sbjct: 252 PSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSP 288 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P SP PP P PP P PPPPP PP PP PPP P Sbjct: 247 PSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPP 283 [204][TOP] >UniRef100_C0H6D7 Putative cuticle protein n=1 Tax=Bombyx mori RepID=C0H6D7_BOMMO Length = 224 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/38 (68%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 G GGG+GG GG+GGG G+ G GG+ GGGGHG GYGGG Sbjct: 149 GGGGGYGGGGGYGGGSGYGGGGGYGGGGGHG-GGYGGG 185 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGG--HGLDGYGGG 251 G GGG+GG GG+GGGGG+G GG GGGG G GYGGG Sbjct: 131 GGGGGYGGGGGYGGGGGYGGGGGYGGGGGYGGGSGYGGG 169 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/44 (63%), Positives = 30/44 (68%), Gaps = 8/44 (18%) Frame = +3 Query: 141 GYGGGH--------GGHGGHGGGGGHGHGGHNGGGGHGLDGYGG 248 GYGGG GG GG+GGGGGHG GG+ GGGGHG GYGG Sbjct: 153 GYGGGGGYGGGSGYGGGGGYGGGGGHG-GGYGGGGGHG-GGYGG 194 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/37 (67%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGG--HGLDGYGGG 251 GGG+GG GG+GGGGG+G GG GGGG G GYGGG Sbjct: 127 GGGYGGGGGYGGGGGYGGGGGYGGGGGYGGGGGYGGG 163 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG G+GGGGG+G GG +GGG G G+GGG Sbjct: 155 GGGGGYGGGSGYGGGGGYGGGGGHGGGYGGGGGHGGG 191 [205][TOP] >UniRef100_B7QJ84 Glycine-rich RNA-binding protein GRP1A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJ84_IXOSC Length = 105 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GGG GGHGG GGG G G GGH GGGG G G GGG Sbjct: 40 GGGGGGHGGGGGGHGGGGGGHGGGGGGGHGGGGGG 74 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/41 (68%), Positives = 29/41 (70%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGH----GGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G+GGG GGH GGHGGGGG GHGG GGGGHG GGG Sbjct: 45 GHGGGGGGHGGGGGGHGGGGGGGHGG--GGGGHG----GGG 79 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGG-GHGLDGYGGG 251 G GGGHGG GG GGGG GHGG GGG G G G+GGG Sbjct: 41 GGGGGHGGGGGGHGGGGGGHGGGGGGGHGGGGGGHGGG 78 [206][TOP] >UniRef100_B6DE24 Hypothetical secreted protein n=1 Tax=Anopheles darlingi RepID=B6DE24_ANODA Length = 103 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 13/54 (24%) Frame = +3 Query: 126 TVQPEGYGGGHGG---HGGHGG-GGGHGHG-------GHNGGGGHGL--DGYGG 248 +VQ +G+GGGHG HGGHGG GGHGHG GH G GGHGL D +GG Sbjct: 18 SVQGQGHGGGHGHNDGHGGHGGFQGGHGHGVQGHGVQGHGGQGGHGLAHDQHGG 71 [207][TOP] >UniRef100_B6AF23 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6AF23_9CRYT Length = 876 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSS 119 PP PS P PPPL PP P PPPPP PP PP PPP PS + SS Sbjct: 177 PPPPSPPLYPPPLHPPPPPPPPPPPPPPPP-PPPPPSSHSSSS 218 [208][TOP] >UniRef100_B4IZJ4 GH14508 n=1 Tax=Drosophila grimshawi RepID=B4IZJ4_DROGR Length = 272 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG GGGGG+G GG G GG G GYGGG Sbjct: 69 GYGGG-GGYGGGGGGGGYGGGGGGGYGGGGDSGYGGG 104 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHG-GHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG G G GGGGG+G GG +G GG G GYGGG Sbjct: 75 GYGGGGGGGGYGGGGGGGYGGGGDSGYGGGGGGGYGGG 112 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/48 (58%), Positives = 31/48 (64%), Gaps = 5/48 (10%) Frame = +3 Query: 123 ETVQPEGYGGGH----GGHGGHGGGGGHGHGGHNGG-GGHGLDGYGGG 251 ET +G GGG GG GG+GGGGG+G GG GG GG G GYGGG Sbjct: 49 ETAPAQGGGGGGWAAGGGGGGYGGGGGYGGGGGGGGYGGGGGGGYGGG 96 [209][TOP] >UniRef100_Q5KFM6 ATP-dependent RNA helicase DBP2-A n=1 Tax=Filobasidiella neoformans RepID=DBP2_CRYNE Length = 540 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGH--GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG GGGGG+G GG GGG+G GYGGG Sbjct: 6 GYGGGGYGGGYGGGGGGGGYGGGGGGYGGGYGGGGYGGG 44 [210][TOP] >UniRef100_UPI0001984057 PREDICTED: similar to cysteine protease Cp5 n=1 Tax=Vitis vinifera RepID=UPI0001984057 Length = 796 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGC 131 P PYPS PPPP PP P PPPPP PP PP P P PS C Sbjct: 653 PSPYPSPAVPPPPPPPPSPPPPPPPSPP-PPSPGPSPSEC 691 [211][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP P P PPPPP PP PP PPP P Sbjct: 1936 PPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPP 1972 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPP P PP PP PPP P Sbjct: 1932 PPPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPP 1968 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PP P PP P PPPPP PP PP PPP PS Sbjct: 1938 PPPPPPPPPPPTPAPPPTPPPPPPP-PPPPPPPPPPPS 1974 [212][TOP] >UniRef100_Q3B0Y9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. CC9902 RepID=Q3B0Y9_SYNS9 Length = 196 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG G GGGGG G+GG GGGG+G G GGG Sbjct: 92 GYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGG 128 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNG--GGGHGLDGYGGG 251 G GGG GG+GG GGGGG+G GG G GGG G GYGGG Sbjct: 94 GGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGG 132 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/56 (51%), Positives = 33/56 (58%), Gaps = 6/56 (10%) Frame = +3 Query: 102 MVKPESEETVQPEGY----GGGHGGHGGHGGGGGHGHGGHNGG--GGHGLDGYGGG 251 M +P +P G GGG GG+GG GGGGG+G GG GG GG G GYGGG Sbjct: 68 MGRPLRINKAEPRGSAPRRGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGG 123 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGG 248 GYGGG GG G GGGGG G+GG GGGG+G G GG Sbjct: 101 GYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGG 136 [213][TOP] >UniRef100_Q31DH1 RNA-binding region RNP-1 n=1 Tax=Prochlorococcus marinus str. MIT 9312 RepID=Q31DH1_PROM9 Length = 222 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGH--GGHGGHGGGGGHGHGGHNGGGGH--GLDGYGGG 251 GYGGG+ GG+GG GGGGG G+GG N GGG+ G GYGGG Sbjct: 103 GYGGGNNGGGYGGGGGGGGGGYGGGNNGGGYGGGGGGYGGG 143 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG GGG+G GG GGG+ GYGGG Sbjct: 132 GYGGGGGGYGGGNNGGGYGGGGGGYGGGNNGGGYGGG 168 [214][TOP] >UniRef100_Q13T99 Putative uncharacterized protein n=1 Tax=Burkholderia xenovorans LB400 RepID=Q13T99_BURXL Length = 173 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = +3 Query: 144 YGGGHGGHGGHGGGGGHGHGGHNGGG---GHGLDGYGGG 251 YGGGH GH GHGG GGHG+ GH GG GHG GGG Sbjct: 113 YGGGHHGHWGHGGWGGHGYWGHGQGGGWTGHGYRWRGGG 151 [215][TOP] >UniRef100_A5E904 Putative uncharacterized protein n=1 Tax=Bradyrhizobium sp. BTAi1 RepID=A5E904_BRASB Length = 235 Score = 56.2 bits (134), Expect = 1e-06 Identities = 37/80 (46%), Positives = 42/80 (52%), Gaps = 2/80 (2%) Frame = +3 Query: 18 MASKALILLGLFSV--LLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGG 191 +A+ AL LL S L +S VS S P T+Q G GG GG G HGGGG Sbjct: 17 LAAAALFLLAGASSRPALAMSPVSPGVGSRAQAPSDALTIQVRGPGGHGGGGGFHGGGGF 76 Query: 192 HGHGGHNGGGGHGLDGYGGG 251 HG GG +GGG G G GGG Sbjct: 77 HGGGGFHGGG--GFHGGGGG 94 [216][TOP] >UniRef100_A4TTR4 Putative uncharacterized protein n=1 Tax=Magnetospirillum gryphiswaldense RepID=A4TTR4_9PROT Length = 118 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -2 Query: 250 PPPYPSS-PWPPPPL-CPPCPWPPPPP*PPCPPWPPP*PSGCTVSS 119 PPP P S P PPPPL PP P+PPPPP PP P PPP P +SS Sbjct: 22 PPPLPPSLPLPPPPLPPPPPPYPPPPPPPPSPILPPPAPPPSPLSS 67 [217][TOP] >UniRef100_Q9M435 Phase-change related protein n=1 Tax=Quercus robur RepID=Q9M435_QUERO Length = 79 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/74 (47%), Positives = 45/74 (60%), Gaps = 2/74 (2%) Frame = +3 Query: 24 SKALILLGL-FSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGG-HGGHGGHGGGGGHG 197 SK +LLGL F+V+L+VS +AR+ ++ETVQ + HG H GHG G GHG Sbjct: 4 SKTFLLLGLVFAVVLLVSSEVSAREL------AQETVQTDAVNEDKHGHHHGHGHGHGHG 57 Query: 198 HGGHNGGGGHGLDG 239 H GH+G GHG G Sbjct: 58 H-GHHGKPGHGAAG 70 [218][TOP] >UniRef100_Q7XMC9 OSJNBb0018A10.6 protein n=1 Tax=Oryza sativa RepID=Q7XMC9_ORYSA Length = 909 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPP 149 PPP PS P PPPP P P PPPP PPCPP PP Sbjct: 472 PPPAPSPPAPPPPPPAPSPPAPPPPPPPCPPAPP 505 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPW---PPPPP*PPCPPWPPP*PSGC 131 PPP PS PPPP PP P PPPPP P PP PPP P C Sbjct: 458 PPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPPPC 500 [219][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P SP PPPP PP P PPPP PP PP PP PS Sbjct: 282 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPS 319 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP PS P PPPP PP P P PPP PP P PPP PS Sbjct: 430 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 467 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWP--PPPP*PPCPPWPPP 146 PPP P SP PPPP PP P P PPPP PP PP PPP Sbjct: 429 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P P PPP PP P PPP PS Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 296 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP PS P PPPP PP P P PPP P PP PPP P Sbjct: 275 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 311 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P P PPP PP P PPP PS Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 353 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P P PPP PP P PPP PS Sbjct: 360 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 397 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P P PPP PP P PPP PS Sbjct: 414 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 451 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P SP PPPP PP P PP PP PP P PPP P Sbjct: 437 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 473 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 PPP P P PPPP PP P P PPP PP P PPP PS Sbjct: 474 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 511 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 6/41 (14%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPP------P*PPCPPWPPP 146 PPP P SP PPPP PP P PPPP P PP PP PPP Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 379 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPP-P*PPCPPWPPP*P 140 PPP P SP PPPP PP P PPPP P PP PP P P P Sbjct: 383 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 420 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 6/41 (14%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPP------P*PPCPPWPPP 146 PPP P SP PPPP PP P PPPP P PP PP PPP Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 493 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPP-P*PPCPPWPPP*P 140 PPP P SP PPPP PP P PPPP P PP PP P P P Sbjct: 497 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 534 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/46 (54%), Positives = 26/46 (56%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLS 113 PPP P P PPPP PP P P PPP P PP PPP C SL+ Sbjct: 523 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPCQVCVYISLT 568 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPP-P*PPCPPWPPP*P 140 P P P SP PPPP PP P PPPP P PP PP PPP P Sbjct: 248 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 285 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/54 (50%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP--*PSGCTVSSLSGFTMPD 95 PPP P P PPPP PP PPPPP P PP PPP P C V T+ D Sbjct: 518 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPCQVCVYISLTVSD 571 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P P PPP P PP PPP P Sbjct: 223 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 259 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 P P P SP PPPP PP P PPPP PP PP PP PS Sbjct: 230 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPS 267 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P P PPP P PP PPP P Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 277 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PS 137 P P P SP PPPP PP P PPPP PP P PPP PS Sbjct: 300 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPS 337 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP P PP PPP P Sbjct: 311 PPPSPPPPSPPPP-SPPPPSPPPPPPPSPPPPPPPSP 346 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP PS P PPPP PP P P PPP P PP PPP Sbjct: 332 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 366 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP PPP P PP PP PPP P Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 386 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP P PP PPP P Sbjct: 355 PPPSPPPPSPPPP-SPPPPSPPPPPPPSPPPPPPPSP 390 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP PS P PPPP PP P P PPP P PP PPP Sbjct: 376 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 410 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP PPP P PP PP PPP P Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 440 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP P PP PPP P Sbjct: 409 PPPSPPPPSPPPP-SPPPPSPPPPPPPSPPPPPPPSP 444 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWP-PPPP*PPCPPWPPP*P 140 PPP PS P PPPP PP P P PPPP PP PP P P P Sbjct: 438 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 475 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP PS P PPPP PP P P PPP P PP PPP Sbjct: 446 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 480 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP PPP P PP PP PPP P Sbjct: 464 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 500 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P PPPP PP P PPPPP P PP PPP P Sbjct: 469 PPPSPPPPSPPPP-SPPPPSPPPPPPPSPPPPPPPSP 504 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP PS P PPPP PP P P PPP P PP PPP Sbjct: 490 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 524 [220][TOP] >UniRef100_Q10R34 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q10R34_ORYSJ Length = 880 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPP 149 PPP PS P PPPP P P PPPP PPCPP PP Sbjct: 420 PPPAPSPPAPPPPPPAPSPPAPPPPPPPCPPAPP 453 [221][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PP P SP PPPP PP P PPPPP PP P PPP P Sbjct: 2121 PPPPPSPPPPPPSPPPAPLPPPPPSPPPSPPPPPSP 2156 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 12/49 (24%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPP------------CPWPPPPP*PPCPPWPPP*PS 137 PP P PWPPPP PP PWPPPP P PP PPP PS Sbjct: 2078 PPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPS 2126 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P P PPPPL PP P P PPP P PPWPPP Sbjct: 2057 PPPAPLPP-PPPPLPPPAPSPSPPP--PPPPWPPP 2088 [222][TOP] >UniRef100_B9N506 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N506_POPTR Length = 208 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/76 (44%), Positives = 42/76 (55%), Gaps = 4/76 (5%) Frame = +3 Query: 36 ILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGH----GHG 203 ILLG+ + L+V+ ++AA G G GGG GG GG GGGGG G G Sbjct: 30 ILLGVTIITLLVTSIAAAGGGGG---------GGGGGGGGGGGGGGRGGGGGASGGGGGG 80 Query: 204 GHNGGGGHGLDGYGGG 251 G GGGG+G+ G GGG Sbjct: 81 GRGGGGGNGVGGGGGG 96 [223][TOP] >UniRef100_B7ZZ41 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B7ZZ41_MAIZE Length = 315 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGG-GHGGHGGHGGGGGHGHG--GHNGGGGHGLDGYGGG 251 G GG G GGHGG GGG GHGHG G +GGGGHG G+GGG Sbjct: 114 GQGGHGGGGHGGGGGGNGHGHGQAGGHGGGGHG--GHGGG 151 [224][TOP] >UniRef100_B6ST85 Glycine-rich cell wall structural protein n=1 Tax=Zea mays RepID=B6ST85_MAIZE Length = 107 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/84 (42%), Positives = 44/84 (52%), Gaps = 6/84 (7%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHG 197 MASKAL+++ L ++ SA Q+ K E + VQ GGG+ GHGG G GG G Sbjct: 1 MASKALLVVALLLAATFLA-ASANEQAQAAKEEKKAEVQDWHGGGGYPGHGGGGSGGYPG 59 Query: 198 HGGHNGGG------GHGLDGYGGG 251 HGG GGG G GY GG Sbjct: 60 HGGGGGGGYPHCRWGCCNRGYHGG 83 [225][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -2 Query: 250 PPPYPSSPWPP----PPLCPPCPWPPPPP*PPCPPWPPP 146 P PYP SP PP PP PP P PPPPP PP PP+PPP Sbjct: 408 PSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPP 446 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P SP+PP P P P PPPPP PP PP PPP P Sbjct: 403 PSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPP 439 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 PPP P P P PP PP P PPPPP PP PP PPP P Sbjct: 406 PPPSPYPPSPAPP-APPSPPPPPPPPPPPPPPPPPFP 441 [226][TOP] >UniRef100_A8I011 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8I011_CHLRE Length = 639 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP P P PPPP PP P PPPPP PP PP PPP Sbjct: 312 PPPPPRPPSPPPP--PPSPSPPPPPAPPSPPPPPP 344 [227][TOP] >UniRef100_A7QDJ5 Chromosome chr10 scaffold_81, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QDJ5_VITVI Length = 155 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGC 131 P PYPS PPPP PP P PPPPP PP PP P P PS C Sbjct: 12 PSPYPSPAVPPPPPPPPSPPPPPPPSPP-PPSPGPSPSEC 50 [228][TOP] >UniRef100_B7P0X5 Collagen-like repeats containing protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P0X5_IXOSC Length = 117 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/54 (53%), Positives = 29/54 (53%) Frame = +3 Query: 90 RQSGMVKPESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 RQ G S G GGG GG GG GGGGG G GG GGGG G G GGG Sbjct: 33 RQEGCCSVSSTTAPPKTGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +3 Query: 117 SEETVQPE--GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 S T P+ G GGG GG GG GGGGG G GG GGGG G G GGG Sbjct: 41 SSTTAPPKTGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 [229][TOP] >UniRef100_B4MND9 GK17065 n=1 Tax=Drosophila willistoni RepID=B4MND9_DROWI Length = 158 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GGG GGHGG GGGGG GHGG GGGGH G+GGG Sbjct: 54 GGGGGGHGGGGGGGG-GHGGSTGGGGH--SGHGGG 85 [230][TOP] >UniRef100_B4KKP9 GI17825 n=1 Tax=Drosophila mojavensis RepID=B4KKP9_DROMO Length = 552 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 141 GYGGGHGGHGGHGGG---GGHGHGGHNGGGGHGLDGYGGG 251 G GGGHGG GG GGG GGHG GG GG G G G+GGG Sbjct: 138 GLGGGHGGSGGFGGGSAGGGHGGGGGLGGSGFGSGGHGGG 177 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = +3 Query: 147 GGGHGGHGGHGGGG----GHGHGGHNGGGGHGLDGYGGG 251 GGGHGG GG GG G GHG GG GGGG G GYGGG Sbjct: 155 GGGHGGGGGLGGSGFGSGGHGGGGGLGGGGFGSGGYGGG 193 [231][TOP] >UniRef100_A8Y2S9 Putative uncharacterized protein n=1 Tax=Caenorhabditis briggsae RepID=A8Y2S9_CAEBR Length = 263 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 G GGH G+GGHGG GGH G+GGH G GG+G +G GG Sbjct: 56 GGNGGHSGNGGHGGNGGHGGNGGHGGNGGNGGNGGNGG 93 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = +3 Query: 150 GGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 GGHGG+GGHGG GGH G+GG+ G GG+G +G GG Sbjct: 65 GGHGGNGGHGGNGGHGGNGGNGGNGGNGGNGGNGG 99 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 11/86 (12%) Frame = +3 Query: 27 KALILLGLFSVLLVVSEVSAARQS--GMVKP-----ESEETVQPEGYGGG---HGGHGGH 176 K ++++ +F L R+ G+VK + + V P G G +GG+GGH Sbjct: 2 KMILVILVFLTLTAEFSAQPVREGSEGLVKAVEARKDDHDLVPPVLIGAGRGANGGNGGH 61 Query: 177 GGGGGHG-HGGHNGGGGHGLDGYGGG 251 G GGHG +GGH G GGHG +G GG Sbjct: 62 SGNGGHGGNGGHGGNGGHGGNGGNGG 87 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 G GGHGG+GGHGG GG+ G+GG+ G GG+G +G GG Sbjct: 68 GGNGGHGGNGGHGGNGGNGGNGGNGGNGGNGGNGGNGG 105 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGG 251 G GGHGG+GG+GG GG+ G+GG+ G GGHG +G GG Sbjct: 107 GGNGGHGGNGGNGGNGGNGGNGGNGGNGGHGGNGGNGG 144 [232][TOP] >UniRef100_A8QDB8 Ground-like domain containing protein n=1 Tax=Brugia malayi RepID=A8QDB8_BRUMA Length = 276 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/47 (57%), Positives = 28/47 (59%), Gaps = 11/47 (23%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPP---CPWP--------PPPP*PPCPPWPPP*P 140 PP P P PPPP+CPP CP P PPPP PPCPP PPP P Sbjct: 96 PPLPX-PCPPPPICPPPVVCPRPIICPPPPPPPPPPPPCPPSPPPCP 141 [233][TOP] >UniRef100_A7SGL4 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SGL4_NEMVE Length = 620 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*P 140 P P P P PPPP PPCP P PPP PP PP PPP P Sbjct: 423 PCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPP 459 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/57 (50%), Positives = 32/57 (56%), Gaps = 6/57 (10%) Frame = -2 Query: 250 PPPYP-----SSPWPPPPLCP-PCPWPPPPP*PPCPPWPPP*PSGCTVSSLSGFTMP 98 PPP P P PPPP CP PCP PPPPP PP PP PPP P C + + +P Sbjct: 421 PPPCPVPCPPPPPPPPPPPCPVPCPPPPPPP-PPSPPPPPPPP--CPIPCPEPYPVP 474 [234][TOP] >UniRef100_P51968 Heterogeneous nuclear ribonucleoprotein A3 homolog 1 n=1 Tax=Xenopus laevis RepID=RO31_XENLA Length = 373 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/37 (67%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +3 Query: 144 YGGGHGGHGGHGGGGGHGH-GGHNGGGGHGLDGYGGG 251 YGGG GG+ G GGGGG G+ GG+ GGGG G GYGGG Sbjct: 222 YGGGDGGNFGRGGGGGFGNRGGYGGGGGRGGGGYGGG 258 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGG 248 G GGG G GG+GGGGG G GG+ GGGG G +G+GG Sbjct: 233 GGGGGFGNRGGYGGGGGRGGGGY-GGGGDGYNGFGG 267 [235][TOP] >UniRef100_P17816 Glycine-rich cell wall structural protein n=1 Tax=Hordeum vulgare RepID=GRP1_HORVU Length = 200 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHG--GHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG G GHGG GGGG G GG++G GG G GYGGG Sbjct: 99 GYGGGGGYPGHGGEGGGGYGGGGGYHGHGGEGGGGYGGG 137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHG--GHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG G GHGG GGGG G GG++G GG G GYGGG Sbjct: 116 GYGGGGGYHGHGGEGGGGYGGGGGYHGHGGEGGGGYGGG 154 Score = 54.7 bits (130), Expect = 3e-06 Identities = 36/85 (42%), Positives = 44/85 (51%), Gaps = 7/85 (8%) Frame = +3 Query: 18 MASKALILLGLFSVLLVVSEVSAARQSGMVKPESEETVQPEGY--GGGH-----GGHGGH 176 MASK+ L+ L +L V++A + K E E + GGGH GGHGG Sbjct: 1 MASKSKGLVVLALLLAAAILVASADEHPQAKKEENEAGVENFFHGGGGHHGHGRGGHGGG 60 Query: 177 GGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG G+GG GG G GYGGG Sbjct: 61 GYGGGGGYGGGGGGYPGGGGGYGGG 85 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG+ GHGG GGGG G GG+ G GG G GYGGG Sbjct: 84 GGGGGYPGHGGEGGGGYGGGGGYPGHGGEGGGGYGGG 120 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+ G GGG G G GG+ G GG G GYGGG Sbjct: 67 GYGGGGGGYPGGGGGYGGGGGGYPGHGGEGGGGYGGG 103 [236][TOP] >UniRef100_UPI000186EF1C formin 1,2/cappuccino, putative n=1 Tax=Pediculus humanus corporis RepID=UPI000186EF1C Length = 1111 Score = 55.8 bits (133), Expect = 1e-06 Identities = 34/70 (48%), Positives = 38/70 (54%), Gaps = 9/70 (12%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPW-----PPPPP*PPC----PPWPPP*PSGCTVSSLSGFTMP 98 PPP P S PPPP PP + PPPPP PP PP PPP PSG T SS+S + Sbjct: 554 PPPLPISGAPPPPPPPPSLFNAGAPPPPPPPPPSLSGGPPPPPPLPSGFTDSSMSSTPLS 613 Query: 97 DCLAADTSET 68 + L DT T Sbjct: 614 NSL--DTGST 621 [237][TOP] >UniRef100_UPI000155D0AC PREDICTED: similar to KIAA1727 protein n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155D0AC Length = 1167 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPP---PPP*PPCPPWPPP*PSG 134 PPP P P PPPP PPCP+P PP PP PP PPP P G Sbjct: 32 PPPPPPPPPPPPPPLPPCPFPDAGFAPPLPPPPPPPPPLPGG 73 [238][TOP] >UniRef100_UPI000155CA4D PREDICTED: similar to DEAH (Asp-Glu-Ala-His) box polypeptide 9 n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155CA4D Length = 1325 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG GG+GGGGG+G GG+ GGG G GYGGG Sbjct: 1234 GSGGGYGG-GGYGGGGGYGGGGYGGGGYGGGGGYGGG 1269 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = +3 Query: 132 QPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 Q GY G GG+ G GGG+G GG+ GGGG+G GYGGG Sbjct: 1219 QSGGYRGSGGGYNRGGSGGGYGGGGYGGGGGYGGGGYGGG 1258 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG G GG GGGG+G GG+ GGGG+G +GGG Sbjct: 1238 GYGGGGYGGGGGYGGGGYGGGGYGGGGGYGGGNFGGG 1274 [239][TOP] >UniRef100_Q89FZ1 Bll6557 protein n=1 Tax=Bradyrhizobium japonicum RepID=Q89FZ1_BRAJA Length = 451 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GGGHGG GGHGGG G GHGG +GGG HG G+ GG Sbjct: 35 GGGHGG-GGHGGGHGGGHGGGHGGGHHGGGGHFGG 68 [240][TOP] >UniRef100_C3MDJ7 Putative uncharacterized protein n=1 Tax=Rhizobium sp. NGR234 RepID=C3MDJ7_RHISN Length = 209 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG GG GGGGG G GG N GGG G DG GGG Sbjct: 131 GGGGGGGGGGGGGGGGGDGGGGGNDGGGGGNDGGGGG 167 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG G GG GGGGG G GG NGGGG G G GGG Sbjct: 101 GSGGGGSGGGGGGGGGGGGGGGGNGGGGGGGGGGGGG 137 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GGG GG GG GGGGG G GG+ GGGG G G GGG Sbjct: 104 GGGSGGGGGGGGGGGGGGGGNGGGGGGGGGGGGGG 138 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG G GG GGGGG G GG GGGG G DG GGG Sbjct: 117 GGGGGGGNGGGGGGGGGGGGGGGGGGGGGGGDGGGGG 153 [241][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGG--GHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG GGGG G G GG+ GGGG G G GGG Sbjct: 122 GYGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGYGGGGGG 160 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG G GGGGG+G GG G GG G GYGGG Sbjct: 129 GYGGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGYGGG 165 [242][TOP] >UniRef100_C9YCQ8 Glycine-rich RNA-binding protein GRP1A n=2 Tax=cellular organisms RepID=C9YCQ8_9BURK Length = 149 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/48 (52%), Positives = 29/48 (60%) Frame = +3 Query: 108 KPESEETVQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 +P + G+GGG GG GG+GGGG G GG GGG G GYGGG Sbjct: 86 RPMEPRPPRSGGFGGGAGGGGGYGGGGRSGGGGFGGGGRSGGGGYGGG 133 [243][TOP] >UniRef100_Q39337 Glycine-rich_protein_(Aa1-291) n=1 Tax=Brassica napus RepID=Q39337_BRANA Length = 291 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG G GGHGGGGG G+GG GGGG GYGGG Sbjct: 155 GYGGG--GAGGHGGGGGGGNGGGGGGGGAHGGGYGGG 189 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 4/42 (9%) Frame = +3 Query: 138 EGYGGG--HGGHGGHGGGGGHGHGGHNGGGGHGL--DGYGGG 251 EGYGGG GGHGG GGGGG GG GGGG+ G+GGG Sbjct: 240 EGYGGGGGEGGHGGGGGGGGGAGGGGGGGGGYAAAGSGHGGG 281 [244][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWP-PPPP*PPCPPWPPP*P 140 PPP P P+PPPP PP P P PPPP PP PP PPP P Sbjct: 38 PPPSPPPPFPPPPSPPPPPPPLPPPPSPPPPPPPPPPP 75 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 Query: 250 PPPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP 146 PPP+P P PPPP PP P PP PP PP PP PPP Sbjct: 43 PPPFPPPPSPPPPP-PPLPPPPSPPPPPPPPPPPP 76 [245][TOP] >UniRef100_B4F7T1 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4F7T1_MAIZE Length = 254 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG GG+GG GGGGG+G GGH GGGG G GYGGG Sbjct: 123 GYGGG-GGYGGAGGGGGYG-GGHYGGGG-GSGGYGGG 156 [246][TOP] >UniRef100_B4MBP7 GJ14488 n=1 Tax=Drosophila virilis RepID=B4MBP7_DROVI Length = 185 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/73 (45%), Positives = 42/73 (57%), Gaps = 5/73 (6%) Frame = +3 Query: 48 LFSVLLVVSEVSAARQSGMVKPESEETVQPEGYGGGH-----GGHGGHGGGGGHGHGGHN 212 LF L VV A+ Q+G + + GYGGG+ GG+ G GGGG+G GG+ Sbjct: 3 LFVCLFVVVATLASAQAGFLGLLGKGGGGGGGYGGGYSGGYSGGYSGGYGGGGYGGGGY- 61 Query: 213 GGGGHGLDGYGGG 251 GGGG+G GYGGG Sbjct: 62 GGGGYGGGGYGGG 74 [247][TOP] >UniRef100_B3MW45 GF22329 n=1 Tax=Drosophila ananassae RepID=B3MW45_DROAN Length = 207 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 10/47 (21%) Frame = +3 Query: 141 GYGGGH---GGHGGHGGGGGHGHGG-------HNGGGGHGLDGYGGG 251 GYGGG GG GG+GGGGG G GG H GGGG G GYGGG Sbjct: 31 GYGGGGSGGGGQGGYGGGGGQGGGGYGGGGGKHGGGGGGGQGGYGGG 77 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 G GGG GG+GG G GGG G GG+ GGGG G GYGGG Sbjct: 24 GGGGGGGGYGGGGSGGG-GQGGYGGGGGQGGGGYGGG 59 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 4/41 (9%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGG----HNGGGGHGLDGYGGG 251 GYGGG G HGG GGGG G+GG H GGGG G GYGGG Sbjct: 55 GYGGGGGKHGGGGGGGQGGYGGGGGKHGGGGG-GQGGYGGG 94 [248][TOP] >UniRef100_A7SMB3 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SMB3_NEMVE Length = 218 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 141 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GYGGG G GGHGGGG G G GGGG+G GYGGG Sbjct: 144 GYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGG 180 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +3 Query: 147 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG 251 GGG+GG G GGGGG+G G+ GGGG+G GYGGG Sbjct: 157 GGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 191 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/42 (61%), Positives = 29/42 (69%), Gaps = 5/42 (11%) Frame = +3 Query: 141 GYGGGHGGHGGHG-GGGGHGHGGHN----GGGGHGLDGYGGG 251 GY GG GG+ G G GGGG+G GG+ GGGGHG GYGGG Sbjct: 122 GYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 163 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 141 GYGGGHGGHGGHG-GGGGHGHGGHNGGGGHGLDGYGGG 251 G G G GG+GG G GGGG+G GGH GGGG+G GYGGG Sbjct: 132 GRGRGGGGYGGGGYGGGGYGGGGH-GGGGYGGGGYGGG 168 [249][TOP] >UniRef100_UPI0001B44F35 hypothetical protein MintA_06539 n=1 Tax=Mycobacterium intracellulare ATCC 13950 RepID=UPI0001B44F35 Length = 478 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/70 (42%), Positives = 38/70 (54%), Gaps = 4/70 (5%) Frame = -2 Query: 247 PPYPSSPWPPPPLCPPCPWPPPPP*PPCPPWPPP*PSGCTVSSLSGFTMPD----CLAAD 80 PP P P PPPP PP P+ PPP PP PP P P P + + +PD L AD Sbjct: 93 PPPPPFPPPPPPPYPPAPYAFPPPPPPRPPRPGPPPDATATAVV--HPLPDGSRVILVAD 150 Query: 79 TSETTRRTEK 50 T++TT+ T + Sbjct: 151 TTQTTQVTRQ 160 [250][TOP] >UniRef100_UPI0001758286 PREDICTED: hypothetical protein n=1 Tax=Tribolium castaneum RepID=UPI0001758286 Length = 471 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +3 Query: 141 GYGGGHGGHGGHGGG--GGHGHGGHNGGGGHGLDGYGGG 251 G GGG+GG GGHGGG GG GHG GGGG G GYGGG Sbjct: 223 GLGGGYGGAGGHGGGIEGGGGHGAGLGGGGSG--GYGGG 259