[UP]
[1][TOP] >UniRef100_Q9C9Z2 Putative uncharacterized protein F17O14.11 n=1 Tax=Arabidopsis thaliana RepID=Q9C9Z2_ARATH Length = 337 Score = 209 bits (531), Expect = 1e-52 Identities = 100/100 (100%), Positives = 100/100 (100%) Frame = +3 Query: 93 MAAMAAKLQLSAKSDQSSVRLPRVINLSRDPTTRVSFPRNGSVCSLHTNFSSPHLAKPCA 272 MAAMAAKLQLSAKSDQSSVRLPRVINLSRDPTTRVSFPRNGSVCSLHTNFSSPHLAKPCA Sbjct: 1 MAAMAAKLQLSAKSDQSSVRLPRVINLSRDPTTRVSFPRNGSVCSLHTNFSSPHLAKPCA 60 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWGP 392 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWGP Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWGP 100 [2][TOP] >UniRef100_Q0WS36 Putative uncharacterized protein At3g08630 n=1 Tax=Arabidopsis thaliana RepID=Q0WS36_ARATH Length = 339 Score = 167 bits (423), Expect = 3e-40 Identities = 81/100 (81%), Positives = 88/100 (88%) Frame = +3 Query: 93 MAAMAAKLQLSAKSDQSSVRLPRVINLSRDPTTRVSFPRNGSVCSLHTNFSSPHLAKPCA 272 MAAMAAKL +S KSDQS+VRLPR+INLSRDPTTRV FPRNGSV SLHTNFSSP++ PCA Sbjct: 1 MAAMAAKLHISTKSDQSNVRLPRLINLSRDPTTRVLFPRNGSVSSLHTNFSSPNIMVPCA 60 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWGP 392 GGGGGGS GN+GGGSGSGGGGGG+GGS EESSPWGP Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYGGS---EEEESSPWGP 97 [3][TOP] >UniRef100_Q9C9Z3 Putative uncharacterized protein F17O14.10 n=1 Tax=Arabidopsis thaliana RepID=Q9C9Z3_ARATH Length = 339 Score = 165 bits (418), Expect = 1e-39 Identities = 80/100 (80%), Positives = 87/100 (87%) Frame = +3 Query: 93 MAAMAAKLQLSAKSDQSSVRLPRVINLSRDPTTRVSFPRNGSVCSLHTNFSSPHLAKPCA 272 MAAMAAKL +S KSDQS+VRLPR+INLSRDPT RV FPRNGSV SLHTNFSSP++ PCA Sbjct: 1 MAAMAAKLHISTKSDQSNVRLPRLINLSRDPTARVLFPRNGSVSSLHTNFSSPNIMVPCA 60 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWGP 392 GGGGGGS GN+GGGSGSGGGGGG+GGS EESSPWGP Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYGGS---EEEESSPWGP 97 [4][TOP] >UniRef100_A4H3P3 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis RepID=A4H3P3_LEIBR Length = 1295 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/95 (38%), Positives = 51/95 (53%), Gaps = 3/95 (3%) Frame = +3 Query: 84 SIKMAAMAAKLQLSAKSDQSSVRLPR---VINLSRDPTTRVSFPRNGSVCSLHTNFSSPH 254 S+++ AA + ++ +V LP V+N +R P+ R R G VCS ++ + Sbjct: 1140 SLELLWSAAAVPSQRRTSSGNVVLPHAWTVVNFTR-PSARTGGDR-GPVCSAIRDWDNNS 1197 Query: 255 LAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 + GGGGGG G GGG G GGGGGG GG GG Sbjct: 1198 SSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1232 [5][TOP] >UniRef100_A3WBS5 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBS5_9SPHN Length = 378 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 A+PP PP PPPPPP P PPPL P PPPPPPA Sbjct: 229 AAPPPPPPPPPPPPPPPPPPLPPPAPPPPPPA 260 [6][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGF 260 S ASPP PP PPPPPP P PPP P PPPPPP F Sbjct: 302 SFASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAF 338 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFAR 254 S + PP PP PPPPPP P PPP P PPPPPP AR Sbjct: 302 SFASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAFEAR 341 [7][TOP] >UniRef100_UPI00016E10B6 UPI00016E10B6 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B6 Length = 1270 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -2 Query: 379 DDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 D + L +PP PP PPPPPP P PPP L PPPPPP Sbjct: 673 DSAGLGAPPAPPPPPPPPPPPPPPPALLASPPPPPP 708 [8][TOP] >UniRef100_UPI00016E10A1 UPI00016E10A1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10A1 Length = 1396 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -2 Query: 379 DDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 D + L +PP PP PPPPPP P PPP L PPPPPP Sbjct: 799 DSAGLGAPPAPPPPPPPPPPPPPPPALLASPPPPPP 834 [9][TOP] >UniRef100_A7Z068 LMOD2 protein n=1 Tax=Bos taurus RepID=A7Z068_BOVIN Length = 553 Score = 59.3 bits (142), Expect = 1e-07 Identities = 31/61 (50%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPV-LPPPPPPAQGFARCGEEKLVWREQTDPFRGNE 197 S A PP PP PPPPPP P PPPL P LPPPPPP A E+KL+ R + + E Sbjct: 416 SPAAPPPPPPPPPPPPPPPPPPPLAPQRLPPPPPPPPPPA--PEKKLITRNIAEVIKQQE 473 Query: 196 T 194 + Sbjct: 474 S 474 [10][TOP] >UniRef100_A4LAN9 Androgen receptor n=1 Tax=Saimiri boliviensis RepID=A4LAN9_9PRIM Length = 918 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/65 (46%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +3 Query: 204 PRNGSVCSLHTNFSSPH--LAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEES 377 P + S HT F++ L PC GGGGGG G GGG G GGGGGG GG G Sbjct: 421 PSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGGGGGEAGAVDPYG 480 Query: 378 SPWGP 392 P P Sbjct: 481 YPRPP 485 [11][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFAR 254 S ASPP PP PPPPPP P PPP P PPPPPP AR Sbjct: 255 SFASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAYEAR 293 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 S + PP PP PPPPPP P PPP P PPPPPPA Sbjct: 255 SFASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPA 289 [12][TOP] >UniRef100_B0SVF7 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0SVF7_CAUSK Length = 409 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGF 260 + SPP PP PPPPPP P PPP P PPPPPPA + Sbjct: 262 TFGSPPPPPPPPPPPPPPPPPPEPPAPPPPPPPAAAY 298 [13][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 PP PP PPPPPP P PPP P LPPPPPP+Q Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQ 110 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 A PP PP PPPPPP P PPP P PPPPPP Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPP 84 [14][TOP] >UniRef100_UPI0001B58635 hypothetical protein StAA4_25414 n=1 Tax=Streptomyces sp. AA4 RepID=UPI0001B58635 Length = 326 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 P G DS+ PP PP PPPPPP P PPP PV PPPPP Sbjct: 229 PGGGDSNTPKPPPPPPPPPPPPTP-PPPPPPVTAPPPPP 266 [15][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPPLP PPP P LPPPPPP Sbjct: 1212 PPLPPPPPPPPPLPPPPPPPPPLPPPPPP 1240 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = -2 Query: 391 GPHGD---DSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 G HGD + + + P PP PPPPPLP PPP P LPPPPPP Sbjct: 1188 GGHGDVCVPAPVPAGPPPPLTPPPPPLPPPPPPPPPLPPPPPP 1230 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPL-----PPPLLPVLPPPPPPAQGFARC 251 P G L PP P PPPPPP PL PPP LP PPPPPP C Sbjct: 1200 PAGPPPPLTPPPPPLPPPPPPPPPLPPPPPPPPPLPPPPPPPPPPPPVGEC 1250 [16][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 PP PP PPPPPP P PPP P+LPPPPPP+ Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPLLPPPPPPS 460 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 422 PPLPPPPPPPPPPPPPPPPPPPPPPPPPP 450 [17][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -2 Query: 379 DDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 D + A PP PP PPPPPP P PPP P PPPPPP Q Sbjct: 226 DAAGFAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQ 263 [18][TOP] >UniRef100_C9RBN7 Peptidase S8 and S53 subtilisin kexin sedolisin n=1 Tax=Ammonifex degensii KC4 RepID=C9RBN7_9THEO Length = 1029 Score = 58.2 bits (139), Expect = 3e-07 Identities = 39/99 (39%), Positives = 48/99 (48%), Gaps = 4/99 (4%) Frame = +3 Query: 105 AAKLQLSAKSDQSSVRLPRVINLSRDPTTRVSFPRNGSVCSLHT----NFSSPHLAKPCA 272 AA L LS + D S +L ++ P +S G V S T N + + P Sbjct: 549 AAALALSLRGDLSPGQLINILRSQVTPLPGLS----GKVASGGTLNAYNVVNYVRSLPAP 604 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGG GGS+G GGG G G GGGG GG G A +E P G Sbjct: 605 GGGTGGSSGAGGGGGGGGSGGGGGGGGGAPAKKEEMPPG 643 [19][TOP] >UniRef100_B7PYQ7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PYQ7_IXOSC Length = 209 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPW 386 GGGGGG G GGG G GGGGGG GG GG E PW Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGREIRPW 46 [20][TOP] >UniRef100_B7PJU5 GGY domain-containing protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PJU5_IXOSC Length = 200 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/64 (48%), Positives = 35/64 (54%), Gaps = 5/64 (7%) Frame = +3 Query: 183 PTTRVSFPRNGSVCSL-HTNFSSPHL----AKPCAGGGGGGSTGNNGGGSGSGGGGGGFG 347 P++R+ R C L T +PH A C GGGGGG G GGG G GGGGGG G Sbjct: 133 PSSRLHCTRRERACPLARTRPRTPHGSGAGAAYCEGGGGGGGGGGGGGGGGGGGGGGGGG 192 Query: 348 GSGG 359 G GG Sbjct: 193 GGGG 196 [21][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPPLP PPP P PPPPPP Sbjct: 304 PPSPPPPPPPPPLPSPPPPPPTPPPPPPP 332 [22][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 S A+PP PP PPPPPP P PPP P PPPPPP + Sbjct: 227 SFAAPPAPPPPPPPPPPPPPPPPPPPPPPPPPPEE 261 [23][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGF 260 PP PP PPPPPP P PPP P PPPPPP Q F Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSF 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 [24][TOP] >UniRef100_B7Q768 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q768_IXOSC Length = 230 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/62 (48%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +3 Query: 186 TTRVSFPRNGSVCSLHTNFSSPHLAKPCA----GGGGGGSTGNNGGGSGSGGGGGGFGGS 353 T R S P C++H+ S L +P GGGGGG G GGG G GGGGGG GG Sbjct: 129 TARASVPH----CAMHSPKKSRFLKRPVRPRTNGGGGGGGGGGGGGGGGGGGGGGGGGGG 184 Query: 354 GG 359 GG Sbjct: 185 GG 186 [25][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEK 239 PP PP P PPPP P PPP P PPPPPPA + +CG +K Sbjct: 179 PPSPPPPSPPPPSPSPPPP-PASPPPPPPALPYPQCGIKK 217 [26][TOP] >UniRef100_UPI0001552E25 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001552E25 Length = 112 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = +3 Query: 243 SSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 S+P C+GGGGGG G +GGG G GGGGGG GG GG Sbjct: 4 STPRREHLCSGGGGGGGGGGSGGGGGGGGGGGGGGGDGG 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +3 Query: 252 HLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 HL GGGGGG +G GGG G GGGGGG GG GG Sbjct: 10 HLCSGGGGGGGGGGSGGGGGGGGGGGGGGGDGGGGG 45 [27][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/64 (46%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEK-LVWREQTDPFRGNETLVVG 182 PP PP PPPPPP P PPP P PPPPPP R G+ K ++Q P E V Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPRTPRGGKRKHKQQQQQQQPQLQREEEVKA 1534 Query: 181 SRER 170 R R Sbjct: 1535 KRHR 1538 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 +PP PP PPPPPP P PPP P PPPPPP Sbjct: 1471 TPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 1500 [28][TOP] >UniRef100_UPI00016E159F UPI00016E159F related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E159F Length = 468 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 243 SSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSG 356 S+P L KP GG GGG GGGSG GGGGGGFGG G Sbjct: 60 SAPVLEKPGGGGSGGGGGSGGGGGSGGGGGGGGFGGGG 97 [29][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 S A+PP PP PPPPPP P PPP P PPPPPP Sbjct: 212 SFAAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 S A PP PP PPPPPP P PPP P PPPPPPA Sbjct: 212 SFAAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPA 246 [30][TOP] >UniRef100_Q7YXC8 Protein R08B4.1b, partially confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=Q7YXC8_CAEEL Length = 1160 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/49 (53%), Positives = 28/49 (57%) Frame = +3 Query: 243 SSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 + P L P GGGG GN G G G GGGGGG GGSGG S +S G Sbjct: 775 NDPTLGGPTGSSGGGGGGGNGGSGGGGGGGGGGSGGSGGGGSNSNSGGG 823 [31][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEKLVW 230 PP PP PPPPPP P PPP P PPPPPP G C + VW Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVDC---RQVW 90 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQG 263 PP PP PPPPPP P PPP P PPPPPP G Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 80 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQG 263 PP PP PPPPPP P PPP P PPPPPP G Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGG 81 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 [32][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFAR 254 SPP PP PPPPPP P PPP P PPPPPP AR Sbjct: 173 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNAR 208 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 171 PPSPPPPPPPPPPPPPPPPPPPPPPPPPP 199 [33][TOP] >UniRef100_UPI00016E10B5 UPI00016E10B5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B5 Length = 1246 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 + L +PP PP PPPPPP P PPP L PPPPPP Sbjct: 651 AGLGAPPAPPPPPPPPPPPPPPPALLASPPPPPP 684 [34][TOP] >UniRef100_UPI00016E10B4 UPI00016E10B4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B4 Length = 1323 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 + L +PP PP PPPPPP P PPP L PPPPPP Sbjct: 728 AGLGAPPAPPPPPPPPPPPPPPPALLASPPPPPP 761 [35][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 ASPP PP PPPPPP P PPP P PPPPPP Sbjct: 466 ASPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 PP PP PPPPPP P PPP P PPPPPP + Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPVE 500 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/37 (59%), Positives = 24/37 (64%) Frame = -2 Query: 385 HGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPP 275 + D+S PP PP PPPPPP P PPP P PPPPP Sbjct: 462 YAHDASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 [36][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP LP PPPPPP Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPPL P PPPPPP Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 P L PP PP PPPPPP P PPP P PPPPPP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP P PPPP P PPP LP PPPPPP Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPP 249 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPP PP PLPPP P PPPPPP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPP 254 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P LPP PPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP PLPP P PPPPPP Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPPLP PP P PPPPPP Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 673 PPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 [37][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGF 260 PP PP PPPPPP P PPP P PPPPPP G+ Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPGY 119 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 367 LASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 L PP PP PPPPPP P PPP P PPPPPP Sbjct: 70 LTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -2 Query: 367 LASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 + +PP PP PPPPPP P PPP P PPPPPP Sbjct: 69 ILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 [38][TOP] >UniRef100_A2XBH9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XBH9_ORYSI Length = 178 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +3 Query: 264 PCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEAS 368 P GGGGGG G GGG GSGGGGGG GGSGG S Sbjct: 33 PSPGGGGGGGGGGRGGGGGSGGGGGGGGGSGGGGS 67 [39][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGF 260 + L+ PP PP PPPPPP P PPP P PPPPPP GF Sbjct: 981 NGLSPPPPPPPPPPPPPPPPPPP--PPPPPPPPPPPGF 1016 [40][TOP] >UniRef100_UPI0000DB75B1 PREDICTED: similar to One cut domain family member 2 (Transcription factor ONECUT-2) (OC-2) n=1 Tax=Apis mellifera RepID=UPI0000DB75B1 Length = 770 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 380 GGGGGG G+ GGG GSGGGGGG GGS G +S SS Sbjct: 249 GGGGGGGGGSGGGGGGSGGGGGGGGGSSGGSSSSSS 284 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 270 AGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 380 +GGGGGG N GGG G GGGGGG GG GG +S SS Sbjct: 196 SGGGGGGGGSNIGGGGGGGGGGGGSGGGGGSSSSSSS 232 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 380 GGGGGG +G GGGSG GGGGGG G SGG +S S+ Sbjct: 251 GGGGGGGSGGGGGGSGGGGGGGG-GSSGGSSSSSST 285 [41][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P LPPPPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP LP PPPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPP 275 PP PP PPPPPPLP PPP P LPPPPP Sbjct: 260 PPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P+ PPPPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 262 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 [42][TOP] >UniRef100_UPI0000607901 AT rich interactive domain 1B (Swi1 like) n=1 Tax=Mus musculus RepID=UPI0000607901 Length = 2244 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 249 PHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEAS 368 P ++P AGGGGGG G GGGSG GGGGGG GG+GG A+ Sbjct: 243 PGYSRPGAGGGGGG--GGGGGGSGGGGGGGGAGGAGGAAA 280 [43][TOP] >UniRef100_UPI00005A5941 PREDICTED: similar to Wiskott-Aldrich syndrome protein interacting protein n=1 Tax=Canis lupus familiaris RepID=UPI00005A5941 Length = 517 Score = 56.6 bits (135), Expect = 8e-07 Identities = 38/98 (38%), Positives = 53/98 (54%), Gaps = 1/98 (1%) Frame = +3 Query: 66 PSLPYVSIKMAAMAAKLQLSAKSDQSSVRLPRVINLSRDPTTRVSFPRNGSVCSLHTNFS 245 P +P++S+ AA K L+ KS+Q+ R + ++S+ + + + S Sbjct: 22 PPIPWLSLLNAANTEKPTLN-KSEQAG-RNALLSDISKGKKLKKTVTNDRS--------- 70 Query: 246 SPHLAKPC-AGGGGGGSTGNNGGGSGSGGGGGGFGGSG 356 +P L KP AG GGGG G GGG G GGGGGGFGG G Sbjct: 71 APILDKPKGAGAGGGGGFGGGGGGGGGGGGGGGFGGGG 108 [44][TOP] >UniRef100_UPI00015AA11D AT rich interactive domain 1B (Swi1 like) n=1 Tax=Mus musculus RepID=UPI00015AA11D Length = 2243 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 249 PHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEAS 368 P ++P AGGGGGG G GGGSG GGGGGG GG+GG A+ Sbjct: 295 PGYSRPGAGGGGGG--GGGGGGSGGGGGGGGAGGAGGAAA 332 [45][TOP] >UniRef100_C5CY78 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CY78_VARPS Length = 137 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = +3 Query: 225 SLHTNFSSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 +L N + P A+P GGGGG G GGG G GGGGGG+GG GG S +G Sbjct: 73 ALTVNEARPMEARPPRTGGGGGYGGGGGGGYGGGGGGGGYGGGGGGRSGGGGGYG 127 [46][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/60 (45%), Positives = 30/60 (50%) Frame = -2 Query: 385 HGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEKLVWREQTDPFR 206 +GD S PP PP PPPPPP P PPP P PPPPP + + E PFR Sbjct: 91 NGDGVSSLQPPPPPPPPPPPPPPPPPPPPPPPPPPPPGSAEALQTDEALTAMAGGYSPFR 150 [47][TOP] >UniRef100_C4Q878 Formin-like n=1 Tax=Schistosoma mansoni RepID=C4Q878_SCHMA Length = 1039 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPL---LPVLPPPPPPAQGFARCGEE 242 SS A+ P PP PPPPPPLP PPP +P PPPPPP G G E Sbjct: 500 SSGANAPPPPPPPPPPPLPPPPPSAGGIPPPPPPPPPGMGAMVPGAE 546 [48][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 S L+ PP PP PPPPPP P PPP P PPPPPP Sbjct: 484 SHLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/52 (48%), Positives = 27/52 (51%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEKLVWREQTDPFRG 203 PP PP PPPPPP P PPP P PPPPPP L+ Q+ P G Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLIEEAQSSPALG 551 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 [49][TOP] >UniRef100_B7Q9F8 E3 ubiquitin ligase, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q9F8_IXOSC Length = 112 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 2/68 (2%) Frame = +3 Query: 162 VINLSRDPTTRVSFPRNG--SVCSLHTNFSSPHLAKPCAGGGGGGSTGNNGGGSGSGGGG 335 V+ S DP + NG ++ S + H+A+ GGGGGG G GGG G GGGG Sbjct: 15 VVKRSLDPNKPKTTKTNGRSALESYGRHDKDVHVARLGGGGGGGGGGGGGGGGGGGGGGG 74 Query: 336 GGFGGSGG 359 GG GG GG Sbjct: 75 GGGGGGGG 82 [50][TOP] >UniRef100_B4ND74 GK24962 n=1 Tax=Drosophila willistoni RepID=B4ND74_DROWI Length = 282 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P P P PVLPPPPPP Sbjct: 89 PPTPPPPPPPPPPPPPTPPTPVLPPPPPP 117 [51][TOP] >UniRef100_B4N591 GK20527 n=1 Tax=Drosophila willistoni RepID=B4N591_DROWI Length = 2261 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +3 Query: 270 AGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSP 383 +GGG GGS+G GGG G GGGGGG GG GG S S+P Sbjct: 1789 SGGGAGGSSGGGGGGGGGGGGGGGGGGGGGYHSNSSTP 1826 [52][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 367 LASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 L PP PP PPPPPP P PPP P PPPPPPA Sbjct: 35 LCCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPA 67 [53][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 SL PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFAR 254 PP PP PPPPPP P PPP P PPPPPP AR Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRAR 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [54][TOP] >UniRef100_UPI0000F2CB43 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2CB43 Length = 252 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 380 GGGGGG G GGG G GGGGGG GGSGG +S S Sbjct: 196 GGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGS 231 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 380 GGGGGG G GGG G GGGGGG GG GG SS Sbjct: 193 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSS 228 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGGGGG G GGG G GGGGGG GG GG + SS G Sbjct: 192 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSG 230 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 380 GGGGGG G GGG G GGGGGG GG GG S SS Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSS 226 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGGGGG G GGG G GGGGGG GG G S SS G Sbjct: 194 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGSG 232 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 6/43 (13%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFG------GSGGEASEESSP 383 GGGGGG G GGG G GGGGGG G GSGG E+ SP Sbjct: 199 GGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGSGGSGGEDRSP 241 [55][TOP] >UniRef100_UPI0000F2B896 PREDICTED: similar to Homeobox protein SIX3 (Sine oculis homeobox homolog 3) n=1 Tax=Monodelphis domestica RepID=UPI0000F2B896 Length = 333 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = +3 Query: 237 NFSSPH-----LAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 NF+ PH LA GGGGG S G GGG+G GG GGG GG GG Sbjct: 18 NFADPHHRSLLLASSSGGGGGGSSAGGGGGGAGGGGAGGGGGGGGG 63 [56][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 SL PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [57][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLL----PVLPPPPPPAQG 263 S SPP PP PPPPPP P PPP L P +PPPPPP G Sbjct: 549 SAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPG 588 [58][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLL----PVLPPPPPPAQG 263 S SPP PP PPPPPP P PPP L P +PPPPPP G Sbjct: 561 SAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPG 600 [59][TOP] >UniRef100_UPI000069FBE2 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE2 Length = 980 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLL----PVLPPPPPPAQG 263 S SPP PP PPPPPP P PPP L P +PPPPPP G Sbjct: 448 SAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPG 487 [60][TOP] >UniRef100_UPI00004D6F7F Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7F Length = 555 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLL----PVLPPPPPPAQG 263 S SPP PP PPPPPP P PPP L P +PPPPPP G Sbjct: 20 SAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPG 59 [61][TOP] >UniRef100_UPI00004D6F7D Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7D Length = 1054 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLL----PVLPPPPPPAQG 263 S SPP PP PPPPPP P PPP L P +PPPPPP G Sbjct: 530 SAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPG 569 [62][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1937 PPPPPPPPPPPPTPAPPPTPPPPPPPPPP 1965 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 P S PP PP PPPPPP P P P P PPPPPP Sbjct: 1923 PISPSSPETPPPPPPPPPPPPPPPPPTPAPPPTPPPPPP 1961 [63][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 S+ +PP PP PPPPPP P PPP P PPPPPP Sbjct: 648 SVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 680 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 A PP PP PPPPPP P PPP P PPPPPP Sbjct: 651 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 681 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 656 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 [64][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFAR 254 A P PP PPPPPP P PPP P PPPPPPA+ AR Sbjct: 240 AEPAAPPPPPPPPPPPPPPPPPPPPPPPPPPAKPAAR 276 [65][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 Query: 376 DSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 D +ASP PP PPPPPP P PPP P PPPPPP Sbjct: 217 DRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 251 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 230 PPPPPPPPPPPPSPPPPPPPPPPPPPPPP 258 [66][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEKLVWREQ 221 +PP PP PPPPPP P PPP P PPPPPP W E+ Sbjct: 42 NPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPIKLIASIPFTWEEK 88 [67][TOP] >UniRef100_B7QNG2 Glycine-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QNG2_IXOSC Length = 138 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPW 386 GGGGGG G GGG G GGGGGG GG GG +PW Sbjct: 14 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAPW 51 [68][TOP] >UniRef100_Q0CUB4 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CUB4_ASPTN Length = 442 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 264 PCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 PC GGGGGG G GGGS GGGGGG GG GG Sbjct: 161 PCGGGGGGGGGGGGGGGSSCGGGGGGGGGGGG 192 [69][TOP] >UniRef100_P09026 Homeobox protein Hox-B3 n=2 Tax=Mus musculus RepID=HXB3_MOUSE Length = 433 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = +3 Query: 243 SSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 380 SSP A+ C GGGGGG G GGG SGGGGG GG GG+ S S Sbjct: 145 SSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGG--GGGGGDKSPPGS 188 [70][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 PP PP PPPPPP P PPP P PPPPPPA Sbjct: 942 PPPPPPPPPPPPPPPPPPPPPGAPPPPPPA 971 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQG 263 PP PP PPPPPP P PPP P PPPPPP G Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 963 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/36 (58%), Positives = 24/36 (66%) Frame = -2 Query: 379 DDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 ++ + PP PP PPPPPP P PPP P PPPPPP Sbjct: 849 EEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 [71][TOP] >UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI000155382B Length = 492 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPW 386 GGGGGG G GGG G GGGGGG GG GG E W Sbjct: 412 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGQEPEQTW 449 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 GGGGGG G GGG GSGGGGGG GGSGG Sbjct: 64 GGGGGGGGGGGGGGGGSGGGGGGGGGSGG 92 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 GGGGGGS G GGG GSGGGGGG GG GG Sbjct: 74 GGGGGGSGGGGGGGGGSGGGGGGGGGGGG 102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEE 374 GGGGGG G GGG G GGGGGG GG GG +E Sbjct: 411 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGQE 444 [72][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 367 LASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 L PP PP+PPPPPP P PPP P PPPPPP Sbjct: 18 LPPPPPPPRPPPPPPPPPPPPPPPPPPPPPPP 49 [73][TOP] >UniRef100_UPI0001A2D80C UPI0001A2D80C related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D80C Length = 815 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/45 (53%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPP------LLPVLPPPPPP 272 P+G ++L PP PP PPPPPP P PPP + LPPPPPP Sbjct: 276 PNGPSAALPPPPPPPPPPPPPPPPPPPPPGHSIEISAPLPPPPPP 320 [74][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 SPP PP PPPPPP P PPP P PPPPPP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 SPP PP PPPPPP P PPP P PPPPPP Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 PP PP PPPPPP P PPP + PPPPPP+ Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPS 419 [75][TOP] >UniRef100_A9SDN8 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SDN8_PHYPA Length = 1271 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/65 (46%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = +3 Query: 198 SFPRNGSVCSLHTNFSSP-----HLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGE 362 S P G+ S + +P H GGGGGG G GGG G GGGGGG GG GG Sbjct: 118 SLPSRGNTMSGSSTDDNPPARPRHRHSRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 177 Query: 363 ASEES 377 SE S Sbjct: 178 ESEGS 182 [76][TOP] >UniRef100_Q6S9V4 DSXF n=1 Tax=Musca domestica RepID=Q6S9V4_MUSDO Length = 397 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/51 (50%), Positives = 30/51 (58%) Frame = +3 Query: 204 PRNGSVCSLHTNFSSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSG 356 P + + ++ T S PH GGGGGG G GGGSGSGGGGGG G G Sbjct: 169 PHHIAAAAIPTIRSPPHSDHSANGGGGGGGGGGGGGGSGSGGGGGGSAGGG 219 [77][TOP] >UniRef100_Q6S9V3 DSXM n=1 Tax=Musca domestica RepID=Q6S9V3_MUSDO Length = 527 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/51 (50%), Positives = 30/51 (58%) Frame = +3 Query: 204 PRNGSVCSLHTNFSSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSG 356 P + + ++ T S PH GGGGGG G GGGSGSGGGGGG G G Sbjct: 169 PHHIAAAAIPTIRSPPHSDHSANGGGGGGGGGGGGGGSGSGGGGGGSAGGG 219 [78][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 PP PP PPPPPP P PPP P PPPPPP Q Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTQ 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 [79][TOP] >UniRef100_B7P0X5 Collagen-like repeats containing protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P0X5_IXOSC Length = 117 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/51 (49%), Positives = 28/51 (54%) Frame = +3 Query: 207 RNGSVCSLHTNFSSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 R CS+ + + P GGGGGG G GGG G GGGGGG GG GG Sbjct: 33 RQEGCCSVSSTTAPPKTGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 [80][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 PP PP PPPPPP P PPP P PPPPPP Q Sbjct: 71 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQ 101 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/49 (46%), Positives = 27/49 (55%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEKLVWREQTDP 212 PP PP PPPPPP P PPP P PPPPPP + + W ++ P Sbjct: 70 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP------QRRDAWTQEPSP 112 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 PP PP PPPPPP P PPP P PPPPPP+ Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPS 89 [81][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPCPPPCPPPPPP 293 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 299 PPPPPCPPPPPPPPPPPPPCPPPPPPPPP 327 [82][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 SPP PP PPPPPP P PPP P PPPPPP Sbjct: 379 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPPPP 388 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPPP 389 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 393 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 367 PPPPPPPPPPPPSPPPPPPPPPPPPPPPP 395 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 377 PPSPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 386 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 [83][TOP] >UniRef100_UPI000155CFFC PREDICTED: similar to diaphanous homolog 2 (Drosophila) n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155CFFC Length = 1111 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/43 (60%), Positives = 27/43 (62%) Frame = -2 Query: 391 GPHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQG 263 GP SS SPP PP PPPPPP P PP +P PPPPPP G Sbjct: 561 GPGLSTSSGVSPPPPPSPPPPPP-PPPPQGIPPPPPPPPPLFG 602 [84][TOP] >UniRef100_UPI0000F2D7BB PREDICTED: similar to Brn3b POU domain transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2D7BB Length = 412 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/78 (42%), Positives = 40/78 (51%), Gaps = 18/78 (23%) Frame = +3 Query: 198 SFPRNGSVCSLHTNFSSPHLAKPC----------------AGGGGGGSTG--NNGGGSGS 323 S P GS+ + +S+ H A PC +GGGGGGS G +N G SGS Sbjct: 13 SMPHGGSL-HVEPKYSALHTASPCTSSSAAPSSSSPSNTSSGGGGGGSGGRSSNSGSSGS 71 Query: 324 GGGGGGFGGSGGEASEES 377 GGGGG GGSGG E+ Sbjct: 72 SGGGGGGGGSGGGGGSEA 89 [85][TOP] >UniRef100_UPI0000D9E28F PREDICTED: homeobox B3 n=1 Tax=Macaca mulatta RepID=UPI0000D9E28F Length = 425 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = +3 Query: 243 SSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 380 SSP A+ C GGGGGG GGGSG GGGGG GG GG+ S S Sbjct: 145 SSPGTAEGCGGGGGGGG---GGGGSGGSGGGGGGGGGGGDKSPPGS 187 [86][TOP] >UniRef100_UPI000060414B formin-like domain containing protein MAN n=1 Tax=Mus musculus RepID=UPI000060414B Length = 1083 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 9/48 (18%) Frame = -2 Query: 385 HGDDSSLASPPEPPKPPPPPPLPLPPPL---------LPVLPPPPPPA 269 +G S SPP PP PPPPPP P PPPL P LPPPPPP+ Sbjct: 545 NGTASPPMSPPPPPPPPPPPPPPPPPPLPGPAAETSPAPPLPPPPPPS 592 [87][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPPLP PPPL P PPPPPP Sbjct: 92 PPLPPPPPPPPPLPPPPPLPP--PPPPPP 118 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPP 275 S+L S P PP PPPPPLP PPPL P PPPPP Sbjct: 71 STLGSVPPPPPLPPPPPLPPPPPLPPPPPPPPP 103 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPP 281 PP PP PPPPPP PLPPPL P LPPP Sbjct: 105 PPPPPLPPPPPPPPLPPPLPPPLPPP 130 [88][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1426 PPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 A PP PP PPPPPP P PPP P PPPPPP Sbjct: 1408 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 [89][TOP] >UniRef100_A3YVC6 RNA-binding protein RbpD n=1 Tax=Synechococcus sp. WH 5701 RepID=A3YVC6_9SYNE Length = 113 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEA 365 GGGGGG GN GGG G GGGGGG+GG GG + Sbjct: 81 GGGGGGGGGNRGGGGGYGGGGGGYGGGGGRS 111 [90][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 PP PP PPPPPP P PPP P PPPPPP Q Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [91][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEE 242 PP PP PPPPPP P PPP P PPPPPP C E+ Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPCCEK 122 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 [92][TOP] >UniRef100_B9I1N4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I1N4_POPTR Length = 613 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/51 (50%), Positives = 29/51 (56%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEKL 236 P G D S++ PP PP PPPP P PP V PPPPPP R G EK+ Sbjct: 283 PTGSDQSVSGPPVPPPPPPPNP---PPVAKKVAPPPPPPPPKGRRVGAEKV 330 [93][TOP] >UniRef100_A9TLY4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TLY4_PHYPA Length = 1657 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 11/72 (15%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPP--------PLLPVLPPPPPPAQGFARCGEE---KLVWREQT 218 A PP PP PPPPPPLP PP P++PV P PPP A+ + + W Q Sbjct: 1354 APPPRPPPPPPPPPLPPPPLRPHHSNSPIVPVAPAPPPQPPNMAQTNSKVAMREAWHAQR 1413 Query: 217 DPFRGNETLVVG 182 +G T+ +G Sbjct: 1414 LAKKGLRTMSLG 1425 [94][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 A PP PP PPPPPP P PPP P PPPPPP + Sbjct: 44 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVK 76 [95][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 PP PP PPPPPP P PPP P PPPPPP Q Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 83 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 [96][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 SPP PP PPPPPP P PPP P PPPPPP Sbjct: 44 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 PP PP PPPPPP P PPP P PPPPPP Q Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 [97][TOP] >UniRef100_B7PML5 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PML5_IXOSC Length = 79 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/50 (56%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +3 Query: 216 SVCSLHTNFS--SPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 SV + +N S S H KP GGGGG G GGG G GGGGGG GG GG Sbjct: 15 SVTFIQSNDSLLSAHSHKPFTWGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64 [98][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 PP PP PPPPPP P PPP P PPPPPP Q Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 107 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 [99][TOP] >UniRef100_B4NYJ9 GE18286 n=1 Tax=Drosophila yakuba RepID=B4NYJ9_DROYA Length = 622 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PH PP PP PPPPPP P PPP P PPPPPP Sbjct: 495 PHHHHHVHHPPPPPPPPPPPPPPPPPPPTEPPPPPPPPP 533 [100][TOP] >UniRef100_Q7S636 Related to putative copper-activated transcription factor n=1 Tax=Neurospora crassa RepID=Q7S636_NEUCR Length = 565 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Frame = +3 Query: 168 NLSRDPTTRVSFPRNGSVCSLHTNFSSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFG 347 ++S D VS PR +LH F + + A GGGGG G+ GG G+GGGGGG G Sbjct: 497 DMSSDMNNAVSSPR-----TLHAPFGIDDILRAPASGGGGGGGGSCCGGRGAGGGGGGGG 551 Query: 348 GSG--GEASEESSP 383 G G G ++E S P Sbjct: 552 GGGGAGRSTEVSVP 565 [101][TOP] >UniRef100_A2APV2-3 Isoform 3 of Formin-like protein 2 n=1 Tax=Mus musculus RepID=A2APV2-3 Length = 1091 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 9/48 (18%) Frame = -2 Query: 385 HGDDSSLASPPEPPKPPPPPPLPLPPPL---------LPVLPPPPPPA 269 +G S SPP PP PPPPPP P PPPL P LPPPPPP+ Sbjct: 545 NGTASPPMSPPPPPPPPPPPPPPPPPPLPGPAAETSPAPPLPPPPPPS 592 [102][TOP] >UniRef100_A2APV2 Formin-like protein 2 n=1 Tax=Mus musculus RepID=FMNL2_MOUSE Length = 1086 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 9/48 (18%) Frame = -2 Query: 385 HGDDSSLASPPEPPKPPPPPPLPLPPPL---------LPVLPPPPPPA 269 +G S SPP PP PPPPPP P PPPL P LPPPPPP+ Sbjct: 545 NGTASPPMSPPPPPPPPPPPPPPPPPPLPGPAAETSPAPPLPPPPPPS 592 [103][TOP] >UniRef100_UPI000186DEC1 Ras-GTPase-activating protein-binding protein, putative n=1 Tax=Pediculus humanus corporis RepID=UPI000186DEC1 Length = 506 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/71 (40%), Positives = 37/71 (52%), Gaps = 5/71 (7%) Frame = +3 Query: 195 VSFPRNGSV-CSLHTNFSSPHLAKP----CAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 + FP+ G V ++ + P + P GGGGGG NN GG G GGGGGG G +GG Sbjct: 398 IYFPKEGGVKLNVEEKKTKPRSSLPSQGTAGGGGGGGGGSNNAGGGGGGGGGGGGGNAGG 457 Query: 360 EASEESSPWGP 392 S S+ P Sbjct: 458 SESNWSAGRAP 468 [104][TOP] >UniRef100_UPI00017C397B PREDICTED: similar to ankyrin repeat and sterile alpha motif domain containing 1A n=1 Tax=Bos taurus RepID=UPI00017C397B Length = 1144 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPW-GP 392 GGGGGGS G +GGGSGSGGGGGG G S S S W GP Sbjct: 35 GGGGGGSGGGSGGGSGSGGGGGGLGSSSHALSSLLSIWRGP 75 [105][TOP] >UniRef100_UPI000175F960 PREDICTED: similar to WAS/WASL interacting protein family, member 1 n=1 Tax=Danio rerio RepID=UPI000175F960 Length = 485 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +3 Query: 243 SSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 S+P L KP GGG GG G GGG G GGGGGG GG GG Sbjct: 55 SAPVLDKPKGGGGPGGGGGGGGGGGGFGGGGGGGGGGGG 93 [106][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 S++A+PP PP PP PPP P PPP P PPPPPP Sbjct: 2795 SAVATPPPPPPPPTPPPPPPPPPPPPPPPPPPPP 2828 [107][TOP] >UniRef100_UPI0000DD90BE Os04g0438100 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD90BE Length = 200 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/78 (41%), Positives = 37/78 (47%) Frame = +3 Query: 126 AKSDQSSVRLPRVINLSRDPTTRVSFPRNGSVCSLHTNFSSPHLAKPCAGGGGGGSTGNN 305 + S S++R R P R PRN S T ++ GGGGGG G Sbjct: 69 SSSAASALRRRRARASRNSPARR---PRNSSPAIGTTTITTMLFGGGGGGGGGGGGGGGG 125 Query: 306 GGGSGSGGGGGGFGGSGG 359 GGG G GGGGGG GG GG Sbjct: 126 GGGGGGGGGGGGGGGGGG 143 [108][TOP] >UniRef100_UPI0001A2D7F0 WAS/WASL interacting protein family member 1 (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein) (PRPL-2 protein). n=1 Tax=Danio rerio RepID=UPI0001A2D7F0 Length = 490 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +3 Query: 243 SSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 S+P L KP GGG GG G GGG G GGGGGG GG GG Sbjct: 55 SAPVLDKPKGGGGPGGGGGGGGGGGGFGGGGGGGGGGGG 93 [109][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 53 PPPPPPPPPPPPRPCPPPPPPPPPPPPPP 81 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 P + + PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 [110][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 A PP PP PPPPPP P PPP P PPPPPP Sbjct: 223 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 253 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 [111][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PH PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [112][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 +S PP PP PPPPPP P PPP P PPPPPP Sbjct: 430 ASTPPPPPPPPPPPPPPPPTPPPPPPRPPPPPPP 463 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 437 PPPPPPPPPPPPTPPPPPPRPPPPPPPPP 465 [113][TOP] >UniRef100_C5YHY3 Putative uncharacterized protein Sb07g005020 n=1 Tax=Sorghum bicolor RepID=C5YHY3_SORBI Length = 2166 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 PP PP PPPPPP P PPPL P +PPP PP+ Sbjct: 391 PPPPPLPPPPPPPPPPPPLPPAVPPPLPPS 420 [114][TOP] >UniRef100_C1E508 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E508_9CHLO Length = 867 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 5/42 (11%) Frame = +3 Query: 252 HLAKPCAGGGGGG-----STGNNGGGSGSGGGGGGFGGSGGE 362 H A+ C GGGGGG G GGG G GGGGGG+GG GGE Sbjct: 825 HWARDCPGGGGGGYGGGGGYGGGGGGYGGGGGGGGWGGGGGE 866 [115][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PH PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [116][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQG 263 PP PP PPPPPP P PPP P PPPPPP G Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLG 53 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 [117][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 S+ +PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 STRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEE 242 PP PP PPPPPP P PPP P PPPPPP C ++ Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQ 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [118][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -2 Query: 367 LASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 + +PP PP PPPPPP P PPP P PPPPPP Sbjct: 73 MTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 [119][TOP] >UniRef100_B4HTW7 GM14602 n=1 Tax=Drosophila sechellia RepID=B4HTW7_DROSE Length = 164 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSG 356 GGGGGGS G GGGSGSGGGGGG GGSG Sbjct: 59 GGGGGGSGGGGGGGSGSGGGGGGGGGSG 86 [120][TOP] >UniRef100_A0NCZ0 AGAP001055-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A0NCZ0_ANOGA Length = 208 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGGGGG G GGG G GGGGGG GG GG WG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGPGGGGWG 104 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGGGGG G GGG G GGGGGG GG GG P G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGPGG 100 [121][TOP] >UniRef100_A6RAG1 Predicted protein n=1 Tax=Ajellomyces capsulatus NAm1 RepID=A6RAG1_AJECN Length = 608 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 270 AGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 380 +GGGGGG G GGG G GGGGGG GGSGG S+ S Sbjct: 443 SGGGGGGGGGGGGGGGGGGGGGGGGGGSGGTDSKTGS 479 [122][TOP] >UniRef100_A4QXQ3 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4QXQ3_MAGGR Length = 671 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +3 Query: 264 PCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 PC G GGGG G GGG G GGGGGG GG GG Sbjct: 474 PCGGNGGGGGGGGGGGGGGGGGGGGGGGGGGG 505 [123][TOP] >UniRef100_UPI0001797C9D PREDICTED: similar to Protein enabled homolog n=1 Tax=Equus caballus RepID=UPI0001797C9D Length = 600 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/86 (37%), Positives = 39/86 (45%), Gaps = 10/86 (11%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPL-------PPPLLP---VLPPPPPPAQGFARCGEEK 239 P G + A+ P PP PPPPPPLP PPP LP PPPPPPA G Sbjct: 329 PPGPAQASATLPPPPGPPPPPPLPSSGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFA 388 Query: 238 LVWREQTDPFRGNETLVVGSRERLIT 161 E P G + G++ R ++ Sbjct: 389 ASMSEDNRPLTGLAAAIAGAKLRKVS 414 [124][TOP] >UniRef100_UPI0000DA45DC PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA45DC Length = 92 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 267 CAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 C GGGGGG G GGG G GGGGGG GG GG Sbjct: 27 CGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57 [125][TOP] >UniRef100_UPI0000DA36CE PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA36CE Length = 136 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 267 CAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 C GGGGGG G GGG G GGGGGG GG GG Sbjct: 9 CCGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 267 CAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 C GGGGGG G GGG G GGGGGG GG GG Sbjct: 10 CGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40 [126][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 A PP PP PPPPPP P PPP P PPPPPPA Sbjct: 619 APPPAPPPPPPPPPPPAPPP-PPAPPPPPPPA 649 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 A PP PP PPPPPP P PPP P P PPPP Sbjct: 663 APPPAPPPPPPPPPAPPPPPAPPPPPAPPPP 693 [127][TOP] >UniRef100_Q8C414 Putative uncharacterized protein (Fragment) n=1 Tax=Mus musculus RepID=Q8C414_MOUSE Length = 824 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 7/47 (14%) Frame = -2 Query: 382 GDDSSLASPPEPPK-------PPPPPPLPLPPPLLPVLPPPPPPAQG 263 G S++ PP PP PPPPPP P PPPL V+PPPPPP G Sbjct: 264 GVPSAIPGPPPPPPLPGAGPCPPPPPPPPPPPPLPGVVPPPPPPLPG 310 [128][TOP] >UniRef100_Q6W4W7 DIA3 n=1 Tax=Mus musculus RepID=Q6W4W7_MOUSE Length = 1102 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 7/47 (14%) Frame = -2 Query: 382 GDDSSLASPPEPPK-------PPPPPPLPLPPPLLPVLPPPPPPAQG 263 G S++ PP PP PPPPPP P PPPL V+PPPPPP G Sbjct: 542 GVPSAIPGPPPPPPLPGAGPCPPPPPPPPPPPPLPGVVPPPPPPLPG 588 [129][TOP] >UniRef100_Q3U4Y4 Putative uncharacterized protein n=1 Tax=Mus musculus RepID=Q3U4Y4_MOUSE Length = 949 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 7/47 (14%) Frame = -2 Query: 382 GDDSSLASPPEPPK-------PPPPPPLPLPPPLLPVLPPPPPPAQG 263 G S++ PP PP PPPPPP P PPPL V+PPPPPP G Sbjct: 538 GVPSAIPGPPPPPPLPGAGPCPPPPPPPPPPPPLPGVVPPPPPPLPG 584 [130][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = -2 Query: 385 HGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 +G + PP PP PPPPPP P PPP P PPPPPP Sbjct: 312 NGFTPDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 PP PP PPPPPP P PPP P PPPPPP + Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPE 364 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 [131][TOP] >UniRef100_B6INW7 R body protein, putative n=1 Tax=Rhodospirillum centenum SW RepID=B6INW7_RHOCS Length = 157 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 PP PP PP PPP P PPP P PPPPPPA Sbjct: 105 PPAPPPPPAPPPPPAPPPAPPAPPPPPPPA 134 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 A PP PP PPPPPP P PPP P PPPPPP Sbjct: 119 APPPAPPAPPPPPP-PAPPPAPPAPPPPPPP 148 [132][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = -2 Query: 388 PHGDD-----SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 P DD S SPP PP PPPPPP P PPP P PPP PP Sbjct: 471 PDNDDDWFLRSGGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPP 514 [133][TOP] >UniRef100_A0YXE4 Putative uncharacterized protein n=1 Tax=Lyngbya sp. PCC 8106 RepID=A0YXE4_9CYAN Length = 304 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 267 CAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 C GGGGGG G GGG G GGGGGG GG GG Sbjct: 269 CGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 299 [134][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPP 133 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 119 PPPPPSPPPPPPPPPPPPPNPPPPPPPPP 147 [135][TOP] >UniRef100_B9RLU7 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RLU7_RICCO Length = 1550 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPL----PPPLLPVLPPPPPPAQ 266 S A+PP PP PPPPPP PL PPPL PPPPPP Q Sbjct: 899 SRAAPPPPPPPPPPPPPPLRATPPPPLQGSPPPPPPPPQ 937 [136][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 367 LASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 L PP PP PPPPPP P PPP P PPPPPP Sbjct: 31 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PH PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [137][TOP] >UniRef100_Q5CS67 Signal peptide containing large protein with proline stretches n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CS67_CRYPV Length = 1884 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/49 (53%), Positives = 30/49 (61%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEE 242 PH SS +S P PP PPPPPP P PPP P PP PPP+ +A +E Sbjct: 1534 PHPPPSSGSSAPPPPPPPPPPP-PPPPPPPPSPPPSPPPSPFYAVVSDE 1581 [138][TOP] >UniRef100_Q5CKJ5 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis RepID=Q5CKJ5_CRYHO Length = 996 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 4/54 (7%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLP----VLPPPPPPAQGFARCGEEKLVWREQTDP 212 SPP PP PPPPPP P PPP LP +LPPPPP G+ K+ ++ DP Sbjct: 408 SPPPPPPPPPPPPPPPPPPPLPPSQHLLPPPPP----LPLSGDSKVSDMQKEDP 457 [139][TOP] >UniRef100_Q4DD51 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi RepID=Q4DD51_TRYCR Length = 603 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/39 (61%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPP-PPPAQGF 260 S+L +PP PP PPPPPP P PPP PPP PPP GF Sbjct: 378 SALEAPPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPPGF 416 [140][TOP] >UniRef100_B7QAD8 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QAD8_IXOSC Length = 164 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSP 383 GGGGGG G GGG G GGGGGG GG GG + SP Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGTGPQRSP 90 [141][TOP] >UniRef100_B7Q141 RNA-binding protein musashi, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q141_IXOSC Length = 266 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +3 Query: 225 SLHTNFSSPHLA-KPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 +L S H++ +P GGGGGG G GGG G GGGGGG GG GG Sbjct: 206 ALALEMSGIHMSGRPIRGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 251 [142][TOP] >UniRef100_B7PZF7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PZF7_IXOSC Length = 106 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 267 CAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 C GGGGGG G GGG G GGGGGG GG GG Sbjct: 69 CGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99 [143][TOP] >UniRef100_B7PQR4 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PQR4_IXOSC Length = 71 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +3 Query: 252 HLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 H+ K GGGGGG G GGG G GGGGGG GG GG Sbjct: 25 HIIKYVRGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60 [144][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEKL 236 PP PP PPPPPP P PPP P PPPPPP + R +L Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRRL 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [145][TOP] >UniRef100_B3N3R7 GG25000 n=1 Tax=Drosophila erecta RepID=B3N3R7_DROER Length = 613 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPTEPPPPPPPPP 524 [146][TOP] >UniRef100_A7UTZ4 AGAP005965-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UTZ4_ANOGA Length = 113 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGGGGG G GGG G GGGGGG GG GG WG Sbjct: 18 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGWG 56 [147][TOP] >UniRef100_O70566-2 Isoform 2 of Protein diaphanous homolog 2 n=1 Tax=Mus musculus RepID=O70566-2 Length = 1112 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 7/47 (14%) Frame = -2 Query: 382 GDDSSLASPPEPPK-------PPPPPPLPLPPPLLPVLPPPPPPAQG 263 G S++ PP PP PPPPPP P PPPL V+PPPPPP G Sbjct: 538 GVPSAIPGPPPPPPLPGAGPCPPPPPPPPPPPPLPGVVPPPPPPLPG 584 [148][TOP] >UniRef100_O70566 Protein diaphanous homolog 2 n=1 Tax=Mus musculus RepID=DIAP2_MOUSE Length = 1098 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 7/47 (14%) Frame = -2 Query: 382 GDDSSLASPPEPPK-------PPPPPPLPLPPPLLPVLPPPPPPAQG 263 G S++ PP PP PPPPPP P PPPL V+PPPPPP G Sbjct: 538 GVPSAIPGPPPPPPLPGAGPCPPPPPPPPPPPPLPGVVPPPPPPLPG 584 [149][TOP] >UniRef100_UPI000155CF00 PREDICTED: similar to Wiskott-Aldrich syndrome protein interacting protein n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155CF00 Length = 498 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 243 SSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 S+P L KP GGGGGG G GG SG GG GGGFGG GG Sbjct: 55 SAPILDKPKGGGGGGGGFG--GGSSGGGGSGGGFGGGGG 91 [150][TOP] >UniRef100_UPI00015539C6 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI00015539C6 Length = 123 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 267 CAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 C+GGGGGG G GGGSG GGGGGG GGSGG Sbjct: 30 CSGGGGGGG-GGGGGGSGGGGGGGGGGGSGG 59 [151][TOP] >UniRef100_UPI00015539BB PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI00015539BB Length = 123 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 267 CAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 C+GGGGGG G GGGSG GGGGGG GGSGG Sbjct: 30 CSGGGGGGG-GGGGGGSGGGGGGGGGGGSGG 59 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GG GGG G G G G GGGGGG GG GG S WG Sbjct: 67 GGSGGGGVGGGGDGGGGGGGGGGGGGGGGAGGGSSGGWG 105 [152][TOP] >UniRef100_UPI0000F2C731 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2C731 Length = 443 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 GGGGGG +G +GGGSG GGGGGG GG GG Sbjct: 190 GGGGGGGSGGSGGGSGGGGGGGGGGGGGG 218 [153][TOP] >UniRef100_UPI0000DB6B0F PREDICTED: similar to Protein on ecdysone puffs CG6143-PB, isoform B n=1 Tax=Apis mellifera RepID=UPI0000DB6B0F Length = 775 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +3 Query: 270 AGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPW 386 +GGGGGG GN GGG G GGGGGG GG GG S +PW Sbjct: 47 SGGGGGGMGGNMGGGMGGGGGGGGGGGGGG--SGGMNPW 83 [154][TOP] >UniRef100_UPI0000DA2645 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA2645 Length = 111 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEE 374 GGGGGG G GGG G GGGGGG GG GG+ S E Sbjct: 78 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGQKSME 111 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEES 377 GGGGGG G GGG G GGGGGG GG GG ++S Sbjct: 75 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGQKS 109 [155][TOP] >UniRef100_B4RDQ2 OmpA family protein n=1 Tax=Phenylobacterium zucineum HLK1 RepID=B4RDQ2_PHEZH Length = 410 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGF 260 S A+PP PP PPPPPP P PPP PPPPPPA + Sbjct: 267 SFAAPPPPPPPPPPPPPPPPPP----PPPPPPPAPAY 299 [156][TOP] >UniRef100_Q8RUS0 Putative uncharacterized protein At2g18115 n=1 Tax=Arabidopsis thaliana RepID=Q8RUS0_ARATH Length = 296 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 264 PCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 P +GGGGGG G GGGSG GGGGGG GG GG Sbjct: 204 PGSGGGGGGGGGGGGGGSGPGGGGGGGGGGGG 235 [157][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 244 PPMPPPPPPPPPPPPPPPPPPSPPPPPPP 272 [158][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 274 PPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 SPP P PPPPPP P PPP P PPPPPP Sbjct: 233 SPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262 [159][TOP] >UniRef100_C5Z660 Putative uncharacterized protein Sb10g024410 n=1 Tax=Sorghum bicolor RepID=C5Z660_SORBI Length = 260 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = +3 Query: 267 CAGGGGGGSTGNNGGGSGS---GGGGGGFGGSGGEA-SEESSPWGP 392 C GGGGGG G GGG + GGGGGGFGG GG A S SP P Sbjct: 151 CPGGGGGGGGGGGGGGGSNGDGGGGGGGFGGGGGSAGSPSGSPSSP 196 [160][TOP] >UniRef100_C5Z1R7 Putative uncharacterized protein Sb10g012740 n=1 Tax=Sorghum bicolor RepID=C5Z1R7_SORBI Length = 185 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGGGGG G GGG G GGGGGG GG GG +E++ G Sbjct: 80 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGTRTEQNGQDG 118 [161][TOP] >UniRef100_C3SAB4 Proline-rich protein n=1 Tax=Brachypodium distachyon RepID=C3SAB4_BRADI Length = 186 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/56 (50%), Positives = 29/56 (51%) Frame = +3 Query: 222 CSLHTNFSSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 C H + S P GGGGGG G GGGSG GGG GG GGSGG S G Sbjct: 25 CGCHCDGSCPSPGTG-GGGGGGGGGGGGGGGSGPGGGSGGSGGSGGSGGGGSGGGG 79 [162][TOP] >UniRef100_C1MI20 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MI20_9CHLO Length = 768 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWGP 392 GGG GG+ G NGGG G+GGGGG GG+GGE + P P Sbjct: 380 GGGNGGNGGGNGGGGGNGGGGGNGGGNGGERAIAKKPTKP 419 [163][TOP] >UniRef100_Q4JF01 Vasa homlogue n=1 Tax=Platynereis dumerilii RepID=Q4JF01_PLADU Length = 712 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/41 (58%), Positives = 28/41 (68%), Gaps = 5/41 (12%) Frame = +3 Query: 252 HLAKPC-----AGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 H ++ C +GGGGGG G+ GGG GS GGGGGFGG GG Sbjct: 141 HFSRECPNGGSSGGGGGGFGGSRGGGFGSSGGGGGFGGGGG 181 [164][TOP] >UniRef100_B7QIC5 E3 ubiquitin ligase, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QIC5_IXOSC Length = 86 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = +3 Query: 216 SVCSLHTNFSSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 SVC +T + GGGGGG G GGG G GGGGGG GG GG Sbjct: 14 SVCLCYTKGGHQLKERARGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61 [165][TOP] >UniRef100_B7Q3T8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3T8_IXOSC Length = 247 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/54 (46%), Positives = 28/54 (51%) Frame = +3 Query: 198 SFPRNGSVCSLHTNFSSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 + P +G + H K GGGGGG G GGG G GGGGGG GG GG Sbjct: 154 TMPDSGETKRSAKRKTKSHRPKGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 [166][TOP] >UniRef100_B7PZ39 E3 ubiquitin ligase, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PZ39_IXOSC Length = 88 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 267 CAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 C GGGGGG G GGG G GGGGGG GG GG Sbjct: 47 CEGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 [167][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/46 (52%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEKLV-WRE 224 PP PP PPPPPP P PPP P PPPPPP L+ WR+ Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRRWLLGWRD 56 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 [168][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 PP PP PPPPPP P PPP P PPPPPP + Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPE 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 [169][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCG 248 A PP PP PPPPPP P PPP P PPPPPP F G Sbjct: 119 APPPPPPPPPPPPPPPPPPP--PPPPPPPPPTPRFTTRG 155 [170][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [171][TOP] >UniRef100_C0NQ83 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NQ83_AJECG Length = 642 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFAR 254 +S P PP PPPPPP P P PV PPPPPP G R Sbjct: 455 SSSPTPPPPPPPPPAPAPASTGPVPPPPPPPTTGLPR 491 [172][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 P GD + P PP PPPPPP P PPP P PPPPPP Sbjct: 257 PPGDPFQEITGPGPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 [173][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 265 PPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 [174][TOP] >UniRef100_Q3ULZ2 FH2 domain-containing protein 1 n=1 Tax=Mus musculus RepID=FHDC1_MOUSE Length = 1149 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/70 (42%), Positives = 35/70 (50%), Gaps = 22/70 (31%) Frame = -2 Query: 382 GDDSSLASPPEPPKPPPPPPL-------------PLPPPLL--PVLPPPPPPA------- 269 G S ASPP PP PPPPPP PLPPPL P +PPPPPP Sbjct: 27 GQTSPSASPPPPPPPPPPPPCPHSGEGFPPSPPPPLPPPLPGGPPIPPPPPPGLPSVSYL 86 Query: 268 QGFARCGEEK 239 G++ G++K Sbjct: 87 NGYSSLGKKK 96 [175][TOP] >UniRef100_UPI000186A185 hypothetical protein BRAFLDRAFT_108752 n=1 Tax=Branchiostoma floridae RepID=UPI000186A185 Length = 742 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/52 (51%), Positives = 29/52 (55%), Gaps = 12/52 (23%) Frame = -2 Query: 379 DDSSLASPPEPPKPPP--------PPPLPLPPPLLPVL----PPPPPPAQGF 260 D SS+ +PP PP PPP PPP P PPP P L PPPPPP GF Sbjct: 558 DGSSMVTPPAPPPPPPYPPPGCTLPPPPPPPPPPGPTLSLPPPPPPPPPPGF 609 [176][TOP] >UniRef100_UPI00017974A0 PREDICTED: similar to WAS/WASL interacting protein family, member 1 n=1 Tax=Equus caballus RepID=UPI00017974A0 Length = 508 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +3 Query: 243 SSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEAS 368 S+P L KP G GGG G GGG G GGGGGG GG GG S Sbjct: 55 SAPILDKPKGAGAGGGGGGFGGGGGGGGGGGGGGGGGGGGGS 96 [177][TOP] >UniRef100_UPI0000DA32FB PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA32FB Length = 236 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASE 371 GGGGGG G GGG G GGGGGG GG GG A E Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGE 127 [178][TOP] >UniRef100_UPI00004D6F7E Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7E Length = 580 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 S+ SPP PP PPPPPPLP P PV PPPPPP Sbjct: 69 SIPSPPPPPPPPPPPPLPSAEP--PVPPPPPPP 99 [179][TOP] >UniRef100_UPI0000ECBAD6 inverted formin 2 isoform 1 n=1 Tax=Gallus gallus RepID=UPI0000ECBAD6 Length = 1049 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/52 (51%), Positives = 29/52 (55%), Gaps = 14/52 (26%) Frame = -2 Query: 370 SLASPPEPPKPPPPPPLP-------------LPP-PLLPVLPPPPPPAQGFA 257 +L PP PP PPPPPPLP LPP P LP +PPPPPP G A Sbjct: 428 ALPPPPPPPPPPPPPPLPSGPAAMPPTASVNLPPAPPLPGIPPPPPPLPGMA 479 [180][TOP] >UniRef100_Q69340 Pseudorabies virus ORF1, ORF2, and ORF3 n=1 Tax=Suid herpesvirus 1 RepID=Q69340_9ALPH Length = 1958 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 355 PEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFAR 254 P PP PPP PP PLPPP P PP PPPA G AR Sbjct: 480 PRPPSPPPRPPPPLPPPPPPPPPPQPPPAGGSAR 513 [181][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 SPP PP PPPPPP P PPP P P PPPP+ Sbjct: 148 SPPPPPSPPPPPPPPSPPPPSPPPPSPPPPS 178 [182][TOP] >UniRef100_B9MIH3 RNP-1 like RNA-binding protein n=1 Tax=Diaphorobacter sp. TPSY RepID=B9MIH3_DIAST Length = 155 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/62 (48%), Positives = 35/62 (56%), Gaps = 7/62 (11%) Frame = +3 Query: 225 SLHTNFSSPHLAKPCA-----GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEES--SP 383 S+ N + P A+P GGGGGG G GG G GGGGGG+GG GG SE SP Sbjct: 73 SIVVNEARPMEARPPRSGGGFGGGGGGYGGGRSGGGGYGGGGGGYGGGGGGRSEGGFRSP 132 Query: 384 WG 389 +G Sbjct: 133 YG 134 [183][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPP 275 A+PP PP PPPPPP P PPP P PPPPP Sbjct: 42 AAPPPPPPPPPPPPPPPPPPPPPPTPPPPP 71 [184][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPP 275 A+PP PP PPPPPP P PPP P PPPPP Sbjct: 42 AAPPPPPPPPPPPPPPPPPPPPPPTPPPPP 71 [185][TOP] >UniRef100_A9JZM2 Single-stranded DNA-binding protein n=1 Tax=Burkholderia mallei ATCC 10399 RepID=A9JZM2_BURMA Length = 209 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGGGG ++G G G+ SGGGGGG GG GG AS S+P G Sbjct: 159 GGGGGRASGGGGAGARSGGGGGGGGGGGGGASRPSAPAG 197 [186][TOP] >UniRef100_A5XS09 Single-stranded DNA-binding protein n=3 Tax=Burkholderia mallei RepID=A5XS09_BURMA Length = 212 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGGGG ++G G G+ SGGGGGG GG GG AS S+P G Sbjct: 162 GGGGGRASGGGGAGARSGGGGGGGGGGGGGASRPSAPAG 200 [187][TOP] >UniRef100_A2S6E2 Single-stranded DNA-binding protein n=3 Tax=Burkholderia mallei RepID=A2S6E2_BURM9 Length = 192 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGGGG ++G G G+ SGGGGGG GG GG AS S+P G Sbjct: 142 GGGGGRASGGGGAGARSGGGGGGGGGGGGGASRPSAPAG 180 [188][TOP] >UniRef100_O65514 Putative glycine-rich cell wall protein n=1 Tax=Arabidopsis thaliana RepID=O65514_ARATH Length = 221 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = +3 Query: 276 GGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 389 GGGGG G GGG G GGGGGG GG GG + + WG Sbjct: 153 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWG 190 [189][TOP] >UniRef100_C5YLB8 Putative uncharacterized protein Sb07g000099 n=1 Tax=Sorghum bicolor RepID=C5YLB8_SORBI Length = 1399 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 P DS PP PP PPP P P PPPL P PPPPPP Sbjct: 1107 PLPSDSPPPPPPLPPSPPPATPPPPPPPLSPASPPPPPP 1145 [190][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPP 275 A+PP PP PPPPPP P PPP P PPPPP Sbjct: 417 AAPPPPPPPPPPPPPPPPPPPPPTPPPPPP 446 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 A+ P PP PPPPPP P PPP P PPPPPP Sbjct: 416 AAAPPPPPPPPPPPPPPPPPPPPPTPPPPPP 446 [191][TOP] >UniRef100_A8IRQ5 DEAD/DEAH box helicase n=1 Tax=Chlamydomonas reinhardtii RepID=A8IRQ5_CHLRE Length = 1992 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = +3 Query: 249 PHLAKPCAGGGGGGSTGNNGGGSGSGGGG-----GGFGGSGGEASEESSP 383 PH+ A GGGGG G GGG G GGGG GG G +GG A E+++P Sbjct: 850 PHVVTVAAAGGGGGEGGGGGGGGGGGGGGRCTCWGGAGQAGGGADEQAAP 899 [192][TOP] >UniRef100_Q5CLH8 Protease n=1 Tax=Cryptosporidium hominis RepID=Q5CLH8_CRYHO Length = 1569 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 6/40 (15%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPL------PLPPPLLPVLPPPPPP 272 SS SPP PP PPPPPP P PPP LP PPPPPP Sbjct: 1529 SSSPSPPPPPPPPPPPPSSSSPSPPPPPPPLPPPPPPPPP 1568 [193][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 364 ASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQ 266 A PP PP PPPPPP P PPP P PPPPPP Q Sbjct: 52 APPPPPPPPPPPPPPPPPPP--PPPPPPPPPQQ 82 [194][TOP] >UniRef100_B7QBP0 Glycine-rich RNA-binding protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QBP0_IXOSC Length = 100 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 264 PCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 P +GGGGGG G GGG G GGGGGG GG GG Sbjct: 41 PVSGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72 [195][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [196][TOP] >UniRef100_B7PQ78 H/ACA ribonucleoprotein complex protein, putative n=1 Tax=Ixodes scapularis RepID=B7PQ78_IXOSC Length = 126 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/67 (46%), Positives = 35/67 (52%), Gaps = 11/67 (16%) Frame = +3 Query: 192 RVSFPRNGSVCSL-HTNFSSPHL----------AKPCAGGGGGGSTGNNGGGSGSGGGGG 338 RVS+P S L T+ SP + +K GGGGGG G GGG G GGGGG Sbjct: 24 RVSWPDPDSSLPLCFTSIQSPEMLAGISGRRLGSKDGGGGGGGGGGGGGGGGGGGGGGGG 83 Query: 339 GFGGSGG 359 G GG GG Sbjct: 84 GGGGGGG 90 [197][TOP] >UniRef100_B7PK11 Glycine-rich RNA-binding protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PK11_IXOSC Length = 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 380 GGGGGG G GGG G GGGGGG GG GG E S Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDSEGS 68 [198][TOP] >UniRef100_B7PHF5 Secreted salivary gland peptide, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PHF5_IXOSC Length = 120 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +3 Query: 246 SPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 S HL+ GGGGGG G GGG G GGGGGG GG GG Sbjct: 61 SIHLSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98 [199][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 [200][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 [201][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [202][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPP P PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [203][TOP] >UniRef100_B4MNL3 GK19601 n=1 Tax=Drosophila willistoni RepID=B4MNL3_DROWI Length = 338 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 GGGGGG G GGG G GGGGGGFGG GG Sbjct: 28 GGGGGGGFGGRGGGGGRGGGGGGFGGRGG 56 [204][TOP] >UniRef100_B4MID6 GK23346 n=1 Tax=Drosophila willistoni RepID=B4MID6_DROWI Length = 266 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPW 386 GGGGGG G GGG G GGGGGG GG GG W Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGNFQPRDGDW 145 [205][TOP] >UniRef100_A9URA4 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9URA4_MONBE Length = 1593 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 5/37 (13%) Frame = -2 Query: 358 PPEPPKPPP-----PPPLPLPPPLLPVLPPPPPPAQG 263 PP PP PPP PPPLP PPP +P PPPPPP G Sbjct: 1052 PPPPPPPPPGIPGAPPPLPPPPPGIPGAPPPPPPPPG 1088 [206][TOP] >UniRef100_Q9BZG7 Androgen receptor (Fragment) n=1 Tax=Homo sapiens RepID=Q9BZG7_HUMAN Length = 544 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/52 (50%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +3 Query: 204 PRNGSVCSLHTNFSSPH--LAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGS 353 P + S HT F++ L PC GGGGGG G GGG G GGGGGG G+ Sbjct: 431 PSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGGEAGA 482 [207][TOP] >UniRef100_Q5AL52 Putative uncharacterized protein n=1 Tax=Candida albicans RepID=Q5AL52_CANAL Length = 1732 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 7/45 (15%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPL-------LPVLPPPPPPAQGF 260 +S A+PP PP PPPPPP PLPP L P PPPPPP F Sbjct: 1046 TSSAAPPPPPPPPPPPPPPLPPILGGNNSSAAPPPPPPPPPPPAF 1090 [208][TOP] >UniRef100_C9S8M2 Cytokinesis protein sepA n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9S8M2_9PEZI Length = 842 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/43 (55%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLP----LPPPLLPVLPPPPPP 272 P + +S A PP PP PPPPPP+P PPP P PPPPPP Sbjct: 155 PKIEVTSAAPPPPPPPPPPPPPMPGQGGAPPPPPPPPPPPPPP 197 [209][TOP] >UniRef100_P33485 Probable nuclear antigen n=2 Tax=Suid herpesvirus 1 RepID=VNUA_SUHVK Length = 1733 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/46 (54%), Positives = 25/46 (54%) Frame = -2 Query: 391 GPHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFAR 254 G G P PP PPP PP PLPPP P PP PPPA G AR Sbjct: 259 GTAGGGEGDRDDPPPPSPPPRPPPPLPPPPPPPPPPQPPPAGGSAR 304 [210][TOP] >UniRef100_P10275 Androgen receptor n=1 Tax=Homo sapiens RepID=ANDR_HUMAN Length = 919 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/52 (50%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +3 Query: 204 PRNGSVCSLHTNFSSPH--LAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGS 353 P + S HT F++ L PC GGGGGG G GGG G GGGGGG G+ Sbjct: 425 PSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGGEAGA 476 [211][TOP] >UniRef100_P08001 Acrosin heavy chain n=1 Tax=Sus scrofa RepID=ACRO_PIG Length = 415 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFAR 254 P G S P PP PPP PP P PPP P PPPPPP Q A+ Sbjct: 328 PPGPSQQPGSRPRPPAPPPAPPPPPPPPPPPPPPPPPPPQQVSAK 372 [212][TOP] >UniRef100_UPI0001984057 PREDICTED: similar to cysteine protease Cp5 n=1 Tax=Vitis vinifera RepID=UPI0001984057 Length = 796 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGE 245 P + SS + P P PPPPPP P PPP P PPPP P + CG+ Sbjct: 646 PTKESSSPSPYPSPAVPPPPPPPPSPPPPPPPSPPPPSPGPSPSECGD 693 [213][TOP] >UniRef100_UPI0000F2B2D7 PREDICTED: similar to RNB6 n=1 Tax=Monodelphis domestica RepID=UPI0000F2B2D7 Length = 417 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = -2 Query: 388 PHGDDSSLASPPEPPK-PPPPPPLPLPPPLLPVLPPPPPP 272 P G SS A+ P P PPPPPP P+PPPL PPPPPP Sbjct: 165 PPGHPSSTATAPVPSGGPPPPPPPPVPPPLTGAAPPPPPP 204 [214][TOP] >UniRef100_UPI0000E24CFF PREDICTED: KIAA1713 n=1 Tax=Pan troglodytes RepID=UPI0000E24CFF Length = 2197 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -2 Query: 376 DSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 + +L PP PP PPPPPPL LPPP PPPPPP Sbjct: 1960 NKALVHPPPPPPPPPPPPLALPPP-----PPPPPP 1989 [215][TOP] >UniRef100_UPI0000E20C65 PREDICTED: similar to Family with sequence similarity 44, member B n=1 Tax=Pan troglodytes RepID=UPI0000E20C65 Length = 282 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 PP PP PPPPPP P PPPL P PPP PP Sbjct: 41 PPPPPSPPPPPPPPSPPPLPPWGPPPSPP 69 [216][TOP] >UniRef100_Q8QKX8 EsV-1-144 n=1 Tax=Ectocarpus siliculosus virus 1 RepID=Q8QKX8_ESV1 Length = 698 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 270 AGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 +GGGGGG TG GGG G GGGGGG GG GG Sbjct: 469 SGGGGGGGTGGAGGGGGGGGGGGGGGGGGG 498 [217][TOP] >UniRef100_Q2W222 RTX toxins and related Ca2+-binding protein n=1 Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W222_MAGSA Length = 1274 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -2 Query: 367 LASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 +A PP PP PPPPPP P PPP P P PPPP Sbjct: 270 VAPPPPPPPPPPPPPPPPPPPPSPPAPAPPPP 301 [218][TOP] >UniRef100_C3MDJ7 Putative uncharacterized protein n=1 Tax=Rhizobium sp. NGR234 RepID=C3MDJ7_RHISN Length = 209 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 GGGGGG G NGGG G GGGGGG GG GG Sbjct: 114 GGGGGGGGGGNGGGGGGGGGGGGGGGGGG 142 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 GGGGGG GN GGG G GGGGGG GG GG Sbjct: 115 GGGGGGGGGNGGGGGGGGGGGGGGGGGGG 143 [219][TOP] >UniRef100_A1TJK5 Putative uncharacterized protein n=1 Tax=Acidovorax citrulli AAC00-1 RepID=A1TJK5_ACIAC Length = 1335 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/95 (33%), Positives = 43/95 (45%), Gaps = 4/95 (4%) Frame = +3 Query: 87 IKMAAMAAKLQLSAKSDQSSVRLPRVINLSRDPTTRVSFPRNGSVCSLHTNFSSPHLAK- 263 ++ AM Q + + P + SR P ++ P+ F+S + + Sbjct: 1248 LEAKAMEEAKQQATAMQSLGLDTPAEVQTSRGPVMVMTLPQ----------FASGPMGQG 1297 Query: 264 ---PCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 P A GGGGG G GGG G GGGGGG GG GG Sbjct: 1298 GGAPGAAGGGGGDGGGGGGGGGGGGGGGGGGGGGG 1332 [220][TOP] >UniRef100_Q43522 Tfm5 protein n=1 Tax=Solanum lycopersicum RepID=Q43522_SOLLC Length = 207 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = +3 Query: 264 PCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 P +GG GGG +G+ GGGSGSGGGGGG G GG Sbjct: 39 PGSGGSGGGGSGSGGGGSGSGGGGGGSGSGGG 70 [221][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 P S SPP PP PPPPPP P PP P PPPPPP+ Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 250 [222][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 SPP PP P PPPP P+PPP P+ PPP PP Sbjct: 1200 SPPPPPNPSPPPPSPMPPPPSPMPPPPSPP 1229 [223][TOP] >UniRef100_B9S1L1 DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9S1L1_RICCO Length = 820 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/49 (53%), Positives = 26/49 (53%), Gaps = 15/49 (30%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLL---------------PVLPPPPPP 272 SS PP PP PPPPPP PLPPP L P LPPPPPP Sbjct: 586 SSSPPPPPPPPPPPPPPPPLPPPNLCSKDIYMPPPATSKGPPLPPPPPP 634 [224][TOP] >UniRef100_B9H5S2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H5S2_POPTR Length = 1494 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 +S + PP PP PPPPPPLP PP LP PPPP P Sbjct: 1237 TSPSPPPPPPLPPPPPPLPSQPPPLPSQPPPPLP 1270 [225][TOP] >UniRef100_A9RMD2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RMD2_PHYPA Length = 1127 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/46 (52%), Positives = 26/46 (56%), Gaps = 10/46 (21%) Frame = -2 Query: 379 DDSSLASPPEPPKPPPPPPLPLPPPLL----------PVLPPPPPP 272 D++S SPP PP PPPPPP P PPP P PPPPPP Sbjct: 520 DNTSPPSPPPPPSPPPPPPAPPPPPFSTNLPSKKPAPPPSPPPPPP 565 [226][TOP] >UniRef100_A7QDJ5 Chromosome chr10 scaffold_81, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QDJ5_VITVI Length = 155 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFARCGE 245 P + SS + P P PPPPPP P PPP P PPPP P + CG+ Sbjct: 5 PTKESSSPSPYPSPAVPPPPPPPPSPPPPPPPSPPPPSPGPSPSECGD 52 [227][TOP] >UniRef100_C0SUI0 Ecdysone receptor B1 isoform (Fragment) n=1 Tax=Anterhynchium flavomarginatum RepID=C0SUI0_9HYME Length = 263 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +3 Query: 270 AGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASE 371 +GGGGGG G GGG G GGGGGG GG+GG S+ Sbjct: 162 SGGGGGGGGGGGGGGGGGGGGGGGGGGAGGGGSD 195 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/40 (55%), Positives = 24/40 (60%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWGP 392 GGGGGG G GGG G GGGGGG GG G + + GP Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGAGGGGSDGCDARKKKGP 205 [228][TOP] >UniRef100_B7Q2H8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q2H8_IXOSC Length = 220 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWGP 392 GGGGGG G GGG G GGGGGG GG GG+ S + P Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGKKSRNGTAKPP 42 [229][TOP] >UniRef100_B7PT00 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PT00_IXOSC Length = 159 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +3 Query: 264 PCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 P GGGGGG G GGG G GGGGGG GG GG Sbjct: 124 PSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 155 [230][TOP] >UniRef100_B7PFE7 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PFE7_IXOSC Length = 254 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSP 383 GGGGGG G GGG G GGGGGG GG GG + S+P Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAIVSNP 151 [231][TOP] >UniRef100_B7PDJ8 SGRP-1, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ8_IXOSC Length = 166 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/46 (52%), Positives = 26/46 (56%) Frame = +3 Query: 222 CSLHTNFSSPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 C++ N L GGGGGG G GGG G GGGGGG GG GG Sbjct: 83 CNIQKNSLPRTLPAMTRGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 128 [232][TOP] >UniRef100_B7P671 Cement protein, putative n=1 Tax=Ixodes scapularis RepID=B7P671_IXOSC Length = 324 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPW 386 GGGGGG G GGG G GGGGGG GG GG +E W Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGXXKEIIYW 179 [233][TOP] >UniRef100_B7P5D9 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5D9_IXOSC Length = 138 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEAS 368 GGGGGG G GGG G GGGGGG GG GG AS Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAS 34 [234][TOP] >UniRef100_B7P0K4 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P0K4_IXOSC Length = 93 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +3 Query: 246 SPHLAKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 S H++ GGGGGG G GGG G GGGGGG GG GG Sbjct: 36 SAHISTWGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73 [235][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 SPP PP P PPPPLP PPP P+ PPPPP Sbjct: 79 SPPPPPPPSPPPPLPSPPPPPPLPSPPPPP 108 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 361 SPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 SPP PP PPPPPP P PPP P PPPP P Sbjct: 218 SPPSPPLPPPPPPPPSPPPPPPPSPPPPSP 247 [236][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 PH +SL PP PP PPPPPP P PPP PPPPPPA Sbjct: 834 PHAG-ASLPPPPPPPPPPPPPPPPPPPP----PPPPPPPA 868 [237][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 PH +SL PP PP PPPPPP P PPP PPPPPPA Sbjct: 912 PHAG-ASLPPPPPPPPPPPPPPPPPPPP----PPPPPPPA 946 [238][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPA 269 PH +SL PP PP PPPPPP P PPP PPPPPPA Sbjct: 912 PHAG-ASLPPPPPPPPPPPPPPPPPPPP----PPPPPPPA 946 [239][TOP] >UniRef100_B9W9S7 Formin (Bud-site selection/polarity protein), putative n=1 Tax=Candida dubliniensis CD36 RepID=B9W9S7_CANDC Length = 1735 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/58 (46%), Positives = 31/58 (53%), Gaps = 11/58 (18%) Frame = -2 Query: 388 PHGDDSSLAS--PPEPPKPPPPPPLPLPP---------PLLPVLPPPPPPAQGFARCG 248 P +S+++S PP PP PPPPPP PLPP P P PPPPPP F G Sbjct: 1041 PESGNSNISSSAPPPPPPPPPPPPPPLPPILGGDTTSAPPPPPPPPPPPPPPAFLNGG 1098 [240][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/54 (46%), Positives = 29/54 (53%), Gaps = 6/54 (11%) Frame = -2 Query: 358 PPEPPK------PPPPPPLPLPPPLLPVLPPPPPPAQGFARCGEEKLVWREQTD 215 PP PP PPPPPP P PPP+ P +PPPPPP G G + + Q D Sbjct: 1055 PPPPPMSAGGIPPPPPPPPPPPPPMSPGMPPPPPPPPGAPVPGAWRANYMSQQD 1108 [241][TOP] >UniRef100_A8NE03 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NE03_COPC7 Length = 434 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLP--VLPPPPPP 272 P D PP PP PPPPP PLPPP LP VLPPPP P Sbjct: 374 PPPPDEPPPLPPPPPTEPPPPPPPLPPPPLPPTVLPPPPSP 414 [242][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 373 SSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 S+ A PP PP PPPPPP P PPP +PPPPPP Sbjct: 1018 SAPAPPPPPPPPPPPPPPPPPPPGAIGVPPPPPP 1051 [243][TOP] >UniRef100_Q9C0F0 Putative Polycomb group protein ASXL3 n=2 Tax=Homo sapiens RepID=ASXL3_HUMAN Length = 2248 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -2 Query: 376 DSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPP 272 + +L PP PP PPPPPPL LPPP PPPPPP Sbjct: 2011 NKALVHPPPPPPPPPPPPLALPPP-----PPPPPP 2040 [244][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/37 (62%), Positives = 23/37 (62%), Gaps = 7/37 (18%) Frame = -2 Query: 358 PPEPPKPPPPPPLPL-------PPPLLPVLPPPPPPA 269 PP PP PPPPPP PL PPP P PPPPPPA Sbjct: 194 PPPPPPPPPPPPCPLPPPPPPCPPPPAPCPPPPPPPA 230 [245][TOP] >UniRef100_UPI0001868097 hypothetical protein BRAFLDRAFT_128521 n=1 Tax=Branchiostoma floridae RepID=UPI0001868097 Length = 1189 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -2 Query: 382 GDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQGFA 257 G SS A PP PPPPPP P PPP P +PPPPPP G A Sbjct: 673 GAPSSSAGDLPPPPPPPPPPAP-PPPPPPGMPPPPPPLPGAA 713 [246][TOP] >UniRef100_UPI00017974C7 PREDICTED: similar to KIAA1902 protein n=1 Tax=Equus caballus RepID=UPI00017974C7 Length = 1089 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = -2 Query: 388 PHGDDSSLASPPEPPKPPPPPPLPLPPPLLPVLPPPPPPAQG 263 P + A+PP PP PPPPPP P PPP PPPPPP G Sbjct: 536 PEAVQNGPATPPMPPPPPPPPPPPPPPP-----PPPPPPLPG 572 [247][TOP] >UniRef100_UPI00016C5334 RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C5334 Length = 137 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +3 Query: 258 AKPCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 A+P GGGGGG GGG G GGGGGG+GG GG Sbjct: 79 ARPKEGGGGGGGGRRGGGGGGYGGGGGGYGGGGG 112 [248][TOP] >UniRef100_UPI000155D0AC PREDICTED: similar to KIAA1727 protein n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155D0AC Length = 1167 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 9/41 (21%) Frame = -2 Query: 358 PPEPPKPPPPPPLPLPP---------PLLPVLPPPPPPAQG 263 PP PP PPPPPP PLPP P LP PPPPPP G Sbjct: 32 PPPPPPPPPPPPPPLPPCPFPDAGFAPPLPPPPPPPPPLPG 72 [249][TOP] >UniRef100_UPI000155BA60 PREDICTED: similar to hCG2029577, partial n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155BA60 Length = 870 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/51 (54%), Positives = 30/51 (58%), Gaps = 13/51 (25%) Frame = -2 Query: 370 SLASPPEPP------KPPPPPPL-----PLPPPLLP--VLPPPPPPAQGFA 257 S+A+PP PP PPPPPPL P PPPLLP PPPPPP G A Sbjct: 502 SMATPPPPPPLPGMATPPPPPPLPGMAAPPPPPLLPGMAAPPPPPPLPGMA 552 [250][TOP] >UniRef100_UPI0000F2DD8B PREDICTED: similar to zinc finger protein 312, n=1 Tax=Monodelphis domestica RepID=UPI0000F2DD8B Length = 800 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +3 Query: 273 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 359 GGGGGG G +GGG G GGGGGG GGSGG Sbjct: 541 GGGGGGGGGGSGGGGGGGGGGGGGGGSGG 569