[UP]
[1][TOP] >UniRef100_Q8L7S5 AT4g18560/F28J12_220 n=1 Tax=Arabidopsis thaliana RepID=Q8L7S5_ARATH Length = 642 Score = 367 bits (941), Expect = e-100 Identities = 180/185 (97%), Positives = 180/185 (97%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PPQKSIPPP PPPPPPLL QPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 363 Query: 381 HSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFI 202 HSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFI Sbjct: 364 HSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFI 423 Query: 201 RFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSF 22 RFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFC F Sbjct: 424 RFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCYF 483 Query: 21 VLKDL 7 LK L Sbjct: 484 DLKKL 488 [2][TOP] >UniRef100_O49524 Pherophorin - like protein n=1 Tax=Arabidopsis thaliana RepID=O49524_ARATH Length = 637 Score = 358 bits (918), Expect = 2e-97 Identities = 180/197 (91%), Positives = 180/197 (91%), Gaps = 12/197 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PPQKSIPPP PPPPPPLL QPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY Sbjct: 287 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 346 Query: 381 HSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFI 202 HSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFI Sbjct: 347 HSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFI 406 Query: 201 RFLIKEVGNAAFSDIEDVVPFVKWLDDELSYL------------VDERAVLKHFEWPEQK 58 RFLIKEVGNAAFSDIEDVVPFVKWLDDELSYL VDERAVLKHFEWPEQK Sbjct: 407 RFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLFKVCKFVVVSLKVDERAVLKHFEWPEQK 466 Query: 57 ADALREAAFCSFVLKDL 7 ADALREAAFC F LK L Sbjct: 467 ADALREAAFCYFDLKKL 483 [3][TOP] >UniRef100_B9S986 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9S986_RICCO Length = 616 Score = 258 bits (658), Expect = 3e-67 Identities = 137/183 (74%), Positives = 146/183 (79%), Gaps = 2/183 (1%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSK--APPPPPPPPPPKSLSIASAKVRRVPEVVEFYHS 376 S PPP PPPPPP PP P K AP PPPPPPPPK + +AKVRRVPEVVEFYHS Sbjct: 292 SAPPPPPPPPPP----PPRPAEAIKKTAPTPPPPPPPPKGTRMVAAKVRRVPEVVEFYHS 347 Query: 375 LMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRF 196 LMRRDS RR+S G A++ + A SNARDMIGEIENRS +LLAIKTDVETQGDFIRF Sbjct: 348 LMRRDS---RRESGAG---ASDVLSATSNARDMIGEIENRSTHLLAIKTDVETQGDFIRF 401 Query: 195 LIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSFVL 16 LIKEV +AAF+DIEDVVPFVKWLDDELSYLVDERAVLKHF WPEQKADALREAAF L Sbjct: 402 LIKEVEDAAFTDIEDVVPFVKWLDDELSYLVDERAVLKHFNWPEQKADALREAAFGYCDL 461 Query: 15 KDL 7 K L Sbjct: 462 KKL 464 [4][TOP] >UniRef100_UPI000198402C PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI000198402C Length = 627 Score = 251 bits (642), Expect = 2e-65 Identities = 136/182 (74%), Positives = 144/182 (79%), Gaps = 3/182 (1%) Frame = -2 Query: 543 PPPHPPPPPPLLHQ---PPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSL 373 P P PPPPPP L + PPPP SKA PPPPPPPP + L KVRRVPEVVEFYHSL Sbjct: 302 PTPPPPPPPPTLTKKSVPPPPQPPSKAAPPPPPPPP-RGLKPMPTKVRRVPEVVEFYHSL 360 Query: 372 MRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFL 193 MRRDS RRDS G A + AN+NARDMIGEIENRS +LLAIKTDVETQGDFIRFL Sbjct: 361 MRRDS---RRDSGAG----APDVPANANARDMIGEIENRSSHLLAIKTDVETQGDFIRFL 413 Query: 192 IKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSFVLK 13 IKEV NAAF++IEDVVPFVKWLDDELS+LVDERAVLKHF WPEQKADALREAAF LK Sbjct: 414 IKEVENAAFTNIEDVVPFVKWLDDELSFLVDERAVLKHFNWPEQKADALREAAFGFCDLK 473 Query: 12 DL 7 L Sbjct: 474 KL 475 [5][TOP] >UniRef100_B9I1N4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I1N4_POPTR Length = 613 Score = 248 bits (634), Expect = 2e-64 Identities = 128/170 (75%), Positives = 139/170 (81%) Frame = -2 Query: 540 PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRD 361 PP PPPPPP P PP V+K PPPPPPPPK + + KVRRVPEVVEFYHSLMR+ Sbjct: 293 PPVPPPPPP-----PNPPPVAKKVAPPPPPPPPKGRRVGAEKVRRVPEVVEFYHSLMRK- 346 Query: 360 STNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEV 181 NSRR+ GG AE + A++NARDMIGEIENRS +LLAIKTDVE QGDFIRFLIKEV Sbjct: 347 --NSRRECGGG---MAETLPASANARDMIGEIENRSTHLLAIKTDVEIQGDFIRFLIKEV 401 Query: 180 GNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 NAAF+ IEDVVPFVKWLDDELSYLVDERAVLKHF+WPEQKADALREAAF Sbjct: 402 ENAAFTVIEDVVPFVKWLDDELSYLVDERAVLKHFDWPEQKADALREAAF 451 [6][TOP] >UniRef100_B9H2J9 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9H2J9_POPTR Length = 289 Score = 245 bits (626), Expect = 1e-63 Identities = 128/167 (76%), Positives = 137/167 (82%), Gaps = 2/167 (1%) Frame = -2 Query: 501 PPPPPSVSK--APPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDSTNSRRDSTGG 328 PPPPP V+K PPPPPPPPPPK + KVRRVPEV EFYHSLMRRDS RRDS GG Sbjct: 2 PPPPPPVAKKVGPPPPPPPPPPKGKRAGTEKVRRVPEVAEFYHSLMRRDS---RRDSGGG 58 Query: 327 GNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDV 148 AEA+ +NARDMIGEIENRS +LLAIKTDVE QGDFI+FLIKEV AAF+DIEDV Sbjct: 59 ---VAEALPVTANARDMIGEIENRSTHLLAIKTDVEIQGDFIKFLIKEVEIAAFTDIEDV 115 Query: 147 VPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSFVLKDL 7 VPFVKWLDDELSYLVDERAVLKHF+WPEQKADALREAAF + LK L Sbjct: 116 VPFVKWLDDELSYLVDERAVLKHFDWPEQKADALREAAFGYYDLKKL 162 [7][TOP] >UniRef100_B8A1H5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B8A1H5_MAIZE Length = 477 Score = 224 bits (570), Expect = 5e-57 Identities = 130/214 (60%), Positives = 136/214 (63%), Gaps = 29/214 (13%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPP-------SVSKAPPPPPPPPPPK------------ 439 PP PPP PPPPPP + PP S + APPPPPPPPPP Sbjct: 116 PPIPPPPPPCPPPPPPSRSKRSSPPNSASVDGSAAAAPPPPPPPPPPPPPPARRQFGAAP 175 Query: 438 ----SLSIASAKVRRVPEVVEFYHSLMRRDS------TNSRRDSTGGGNAAAEAILANSN 289 S VRRVPEVVEFYHSLMRR+S T S + GGG AAA Sbjct: 176 APPAGASSGQGDVRRVPEVVEFYHSLMRRESKRDGSGTASEAANGGGGGAAA-------- 227 Query: 288 ARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSY 109 RDMIGEIENRS +LLAIK+DVE QGDFIRFLIKEV AAF DIEDVV FVKWLDDELS Sbjct: 228 TRDMIGEIENRSAHLLAIKSDVERQGDFIRFLIKEVEGAAFVDIEDVVSFVKWLDDELSR 287 Query: 108 LVDERAVLKHFEWPEQKADALREAAFCSFVLKDL 7 LVDERAVLKHFEWPE KADALREAAF LK L Sbjct: 288 LVDERAVLKHFEWPENKADALREAAFGYCDLKKL 321 [8][TOP] >UniRef100_B4FW52 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FW52_MAIZE Length = 639 Score = 224 bits (570), Expect = 5e-57 Identities = 130/214 (60%), Positives = 136/214 (63%), Gaps = 29/214 (13%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPP-------SVSKAPPPPPPPPPPK------------ 439 PP PPP PPPPPP + PP S + APPPPPPPPPP Sbjct: 278 PPIPPPPPPCPPPPPPSRSKRSSPPNSASVDGSAAAAPPPPPPPPPPPPPPARRQFGAAP 337 Query: 438 ----SLSIASAKVRRVPEVVEFYHSLMRRDS------TNSRRDSTGGGNAAAEAILANSN 289 S VRRVPEVVEFYHSLMRR+S T S + GGG AAA Sbjct: 338 APPAGASSGQGDVRRVPEVVEFYHSLMRRESKRDGSGTASEAANGGGGGAAA-------- 389 Query: 288 ARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSY 109 RDMIGEIENRS +LLAIK+DVE QGDFIRFLIKEV AAF DIEDVV FVKWLDDELS Sbjct: 390 TRDMIGEIENRSAHLLAIKSDVERQGDFIRFLIKEVEGAAFVDIEDVVSFVKWLDDELSR 449 Query: 108 LVDERAVLKHFEWPEQKADALREAAFCSFVLKDL 7 LVDERAVLKHFEWPE KADALREAAF LK L Sbjct: 450 LVDERAVLKHFEWPENKADALREAAFGYCDLKKL 483 [9][TOP] >UniRef100_Q6F359 Putative uncharacterized protein OJ1268_B08.2 n=1 Tax=Oryza sativa Japonica Group RepID=Q6F359_ORYSJ Length = 694 Score = 221 bits (564), Expect = 2e-56 Identities = 127/198 (64%), Positives = 133/198 (67%), Gaps = 21/198 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKA----PPPPPPPPPP---------------K 439 PP PPP PPPP P P PS S + PP PPPPPPP Sbjct: 305 PPIPPPPPPPPPPPMPRSRSASPSPSTSSSGSAGPPAPPPPPPPAAKRTSRTSTPATTSS 364 Query: 438 SLSIASAKVRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILAN--SNARDMIGEI 265 S + VRRVPEVVEFYHSLMRRDS +RD GGG AEA + ARDMIGEI Sbjct: 365 SAPASGPCVRRVPEVVEFYHSLMRRDS---KRDG-GGGGGGAEACPGGGAAAARDMIGEI 420 Query: 264 ENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVL 85 ENRS +LLAIK+DVE QGDFIRFLIKEV AAF DIEDVV FVKWLD ELS LVDERAVL Sbjct: 421 ENRSAHLLAIKSDVERQGDFIRFLIKEVEGAAFVDIEDVVTFVKWLDVELSRLVDERAVL 480 Query: 84 KHFEWPEQKADALREAAF 31 KHFEWPEQKADALREAAF Sbjct: 481 KHFEWPEQKADALREAAF 498 [10][TOP] >UniRef100_C5YW16 Putative uncharacterized protein Sb09g029200 n=1 Tax=Sorghum bicolor RepID=C5YW16_SORBI Length = 693 Score = 212 bits (540), Expect = 1e-53 Identities = 123/206 (59%), Positives = 135/206 (65%), Gaps = 29/206 (14%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLL-----HQPPPPPSVSKA----------PPPPPPPPPPKSLSI 427 PP + PPP PPPPPP + PS S + PP PPPPPPP + Sbjct: 313 PPIPAPPPPPPPPPPPTMPARGRRSASSSPSTSSSSSGGGSGGAGPPAPPPPPPPAAKRS 372 Query: 426 ASAK--------------VRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSN 289 + A VRRVPEVVEFYHSLMRRDS + RD +G G A + A Sbjct: 373 SKASSPATSATAPAPAPCVRRVPEVVEFYHSLMRRDSRS--RDGSGAGEAGSGGGAAA-- 428 Query: 288 ARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSY 109 ARDMIGEIENRS +LLAIK+DVE QGDFIRFLIKEV +AAF DIEDVV FVKWLD ELS Sbjct: 429 ARDMIGEIENRSSHLLAIKSDVERQGDFIRFLIKEVQSAAFVDIEDVVTFVKWLDVELSR 488 Query: 108 LVDERAVLKHFEWPEQKADALREAAF 31 LVDERAVLKHF+WPE KADALREAAF Sbjct: 489 LVDERAVLKHFDWPEGKADALREAAF 514 [11][TOP] >UniRef100_B9FLQ8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FLQ8_ORYSJ Length = 653 Score = 210 bits (535), Expect = 5e-53 Identities = 123/198 (62%), Positives = 129/198 (65%), Gaps = 21/198 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKA----PPPPPPPPPP---------------K 439 PP PPP PPPP P P PS S + PP PPPPPPP Sbjct: 305 PPIPPPPPPPPPPPMPRSRSASPSPSTSSSGSAGPPAPPPPPPPAAKRTSRTSTPATTSS 364 Query: 438 SLSIASAKVRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILAN--SNARDMIGEI 265 S + VRRVPEVVEFYHSLMRRDS +RD GGG AEA + ARDMIGEI Sbjct: 365 SAPASGPCVRRVPEVVEFYHSLMRRDS---KRDG-GGGGGGAEACPGGGAAAARDMIGEI 420 Query: 264 ENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVL 85 ENRS +LLAIK+DVE QGDFIRFLIKEV AAF DIEDVV FVKWLD VDERAVL Sbjct: 421 ENRSAHLLAIKSDVERQGDFIRFLIKEVEGAAFVDIEDVVTFVKWLD------VDERAVL 474 Query: 84 KHFEWPEQKADALREAAF 31 KHFEWPEQKADALREAAF Sbjct: 475 KHFEWPEQKADALREAAF 492 [12][TOP] >UniRef100_A7QDM4 Chromosome chr10 scaffold_81, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QDM4_VITVI Length = 285 Score = 204 bits (520), Expect = 3e-51 Identities = 111/137 (81%), Positives = 117/137 (85%) Frame = -2 Query: 417 KVRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLA 238 KVRRVPEVVEFYHSLMRRDS RRDS G A + AN+NARDMIGEIENRS +LLA Sbjct: 4 KVRRVPEVVEFYHSLMRRDS---RRDSGAG----APDVPANANARDMIGEIENRSSHLLA 56 Query: 237 IKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQK 58 IKTDVETQGDFIRFLIKEV NAAF++IEDVVPFVKWLDDELS+LVDERAVLKHF WPEQK Sbjct: 57 IKTDVETQGDFIRFLIKEVENAAFTNIEDVVPFVKWLDDELSFLVDERAVLKHFNWPEQK 116 Query: 57 ADALREAAFCSFVLKDL 7 ADALREAAF LK L Sbjct: 117 ADALREAAFGFCDLKKL 133 [13][TOP] >UniRef100_O49525 Putative uncharacterized protein F28J12.230 n=1 Tax=Arabidopsis thaliana RepID=O49525_ARATH Length = 151 Score = 167 bits (423), Expect(2) = 2e-50 Identities = 85/87 (97%), Positives = 86/87 (98%) Frame = +3 Query: 300 QVLLPRRRFHRRWNLFSSLWSLFASTSDKTQPLPVLFSLSPTQCLNSSAAVVEEAEEELW 479 QVLLPRRRFHRRWNLFSSLWSLFASTSDKTQPLPVLFSLSPTQCLNSSAAVVEEAEEELW Sbjct: 30 QVLLPRRRFHRRWNLFSSLWSLFASTSDKTQPLPVLFSLSPTQCLNSSAAVVEEAEEELW 89 Query: 480 KQTEVVVVDEEAVAEVEDEEAESISAV 560 KQTEVVVV EEAVAEVE+EEAESISAV Sbjct: 90 KQTEVVVVVEEAVAEVEEEEAESISAV 116 Score = 56.6 bits (135), Expect(2) = 2e-50 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 158 MSENAAFPTSLIKNLMKSPCVSTSVFIARR 247 MSENAAFPTSLIKNLMKSPCVSTSVFI + Sbjct: 1 MSENAAFPTSLIKNLMKSPCVSTSVFICNQ 30 [14][TOP] >UniRef100_UPI000198424F PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI000198424F Length = 801 Score = 202 bits (513), Expect = 2e-50 Identities = 113/187 (60%), Positives = 131/187 (70%), Gaps = 8/187 (4%) Frame = -2 Query: 543 PPPHPP------PPPPLLHQPPPPPSVSKAPPPPPPPPPPK-SLSIASAKVRRVPEVVEF 385 PPP P P +L Q PPPP PPPPPPPPPPK S + V+R P+VVEF Sbjct: 472 PPPRPSGALSSGPKEMVLAQIPPPP-----PPPPPPPPPPKFSARSTTGIVQRAPQVVEF 526 Query: 384 YHSLMRRDSTNSRRDSTGGGNAAAEAILANSNAR-DMIGEIENRSVYLLAIKTDVETQGD 208 YHSLM+RDS R+DS+ GG + +N R +MIGEIENRS YLLAIK DVETQG+ Sbjct: 527 YHSLMKRDS---RKDSSNGGIYDTPDV---ANVRSNMIGEIENRSSYLLAIKADVETQGE 580 Query: 207 FIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFC 28 F+ LI+EV NA + +IEDVV FVKWLDDEL +LVDERAVLKHF+WPE+KAD LREAAF Sbjct: 581 FVNSLIREVNNAVYQNIEDVVAFVKWLDDELCFLVDERAVLKHFDWPEKKADTLREAAFG 640 Query: 27 SFVLKDL 7 LK L Sbjct: 641 YRDLKKL 647 [15][TOP] >UniRef100_Q5VPC4 Pherophorin-like protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5VPC4_ORYSJ Length = 591 Score = 201 bits (510), Expect = 4e-50 Identities = 125/219 (57%), Positives = 138/219 (63%), Gaps = 35/219 (15%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSV---SKAPPPPPPPPPPKSLSIASA------KVRR 406 P+ S PP PPPPP P SV + APPPPPPPPP + S A++ +V R Sbjct: 273 PELSKLPPIPPPPPM------PALSVCGRAAAPPPPPPPPPARRTSGAASPAASGPRVTR 326 Query: 405 VPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLA---- 238 VPEVVEFYHSLMRRDS + RD +GGG A +A + RDMIGEIENRS +LLA Sbjct: 327 VPEVVEFYHSLMRRDSRS--RDGSGGGETANGGGVAAT--RDMIGEIENRSAHLLAAIIY 382 Query: 237 ----------------------IKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLD 124 IK+DVE QGDFIRFLIKEV AAF DIEDVV FVKWLD Sbjct: 383 LSAGREFGGGADRNSCMRGVRRIKSDVERQGDFIRFLIKEVEGAAFVDIEDVVTFVKWLD 442 Query: 123 DELSYLVDERAVLKHFEWPEQKADALREAAFCSFVLKDL 7 +ELS LVDERAVLKHFEWPE K DALREAAF LK L Sbjct: 443 NELSRLVDERAVLKHFEWPENKEDALREAAFGYCDLKKL 481 [16][TOP] >UniRef100_B9T6B3 Actin binding protein, putative n=1 Tax=Ricinus communis RepID=B9T6B3_RICCO Length = 791 Score = 200 bits (508), Expect = 7e-50 Identities = 112/191 (58%), Positives = 131/191 (68%), Gaps = 14/191 (7%) Frame = -2 Query: 537 PHPPPPPPL-----------LHQPPPPPSVSKAPPPPPPPPPPK--SLSIASAKVRRVPE 397 P+PPP P + PPPP PPPPPPPPPPK S ++ V+R P+ Sbjct: 473 PNPPPRPSCSMPSETKEECSVQVAPPPP-----PPPPPPPPPPKFSMRSSSAGVVQRAPQ 527 Query: 396 VVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARD-MIGEIENRSVYLLAIKTDVE 220 VVEFYHSLM+RDS R++S+ GG A + +N R MIGEIENRS +LLAIK DVE Sbjct: 528 VVEFYHSLMKRDS---RKESSNGGVCEASDV---ANVRSSMIGEIENRSSHLLAIKADVE 581 Query: 219 TQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALRE 40 TQG+F+ LI+EV NA F +IEDVV FVKWLDDEL +LVDERAVLKHFEWPE+KAD LRE Sbjct: 582 TQGEFVNSLIREVNNAVFQNIEDVVAFVKWLDDELGFLVDERAVLKHFEWPEKKADTLRE 641 Query: 39 AAFCSFVLKDL 7 AAF LK L Sbjct: 642 AAFGYRDLKKL 652 [17][TOP] >UniRef100_B9I0W7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I0W7_POPTR Length = 794 Score = 198 bits (504), Expect = 2e-49 Identities = 109/198 (55%), Positives = 134/198 (67%), Gaps = 15/198 (7%) Frame = -2 Query: 555 QKSIPPPHPPPPPPL-----------LHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK-- 415 ++++ P+PPP P P PPP PPPPPPPPPP S+ S Sbjct: 467 KRTLRVPNPPPRPSCSVSTGPKEEVQAQVPLPPP-----PPPPPPPPPPPKFSVRSTTAG 521 Query: 414 -VRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNAR-DMIGEIENRSVYLL 241 V+R P+VVEFYHSLM+RDS R++S+ GG A + +N R +MIGEIENRS +LL Sbjct: 522 VVQRAPQVVEFYHSLMKRDS---RKESSNGGICEASDV---ANVRSNMIGEIENRSSHLL 575 Query: 240 AIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQ 61 AIK D+ETQG+F+ LI+EV NA + +IEDVV FVKWLDDEL +LVDERAVLKHF+WPE+ Sbjct: 576 AIKADIETQGEFVNSLIREVNNAVYQNIEDVVAFVKWLDDELGFLVDERAVLKHFDWPEK 635 Query: 60 KADALREAAFCSFVLKDL 7 KAD LREAAF LK L Sbjct: 636 KADTLREAAFGFSDLKKL 653 [18][TOP] >UniRef100_C7J8C9 Os11g0105750 protein (Fragment) n=2 Tax=Oryza sativa Japonica Group RepID=C7J8C9_ORYSJ Length = 918 Score = 197 bits (502), Expect = 4e-49 Identities = 103/174 (59%), Positives = 122/174 (70%), Gaps = 1/174 (0%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA-KVRRVPEVVEFYHSL 373 S PPP PP PP PPPPP PPPPPPPP ++A KV R PEVVEFY SL Sbjct: 614 SPPPPRPPGAPP----PPPPPGKPGGPPPPPPPPGSLPRNLAGGDKVHRAPEVVEFYQSL 669 Query: 372 MRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFL 193 M+R++ ++D+T G+ + A SN MIGEIENRS +LLA+K DVETQGDF+ L Sbjct: 670 MKREA---KKDTTSLGSTTSSAFDVRSN---MIGEIENRSTFLLAVKADVETQGDFVESL 723 Query: 192 IKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 EV A+F +I+DVV FV WLD+ELS+LVDERAVLKHF+WPE K DALREAAF Sbjct: 724 ANEVRAASFVNIDDVVAFVNWLDEELSFLVDERAVLKHFDWPESKTDALREAAF 777 [19][TOP] >UniRef100_B8BNT3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BNT3_ORYSI Length = 930 Score = 197 bits (502), Expect = 4e-49 Identities = 103/174 (59%), Positives = 122/174 (70%), Gaps = 1/174 (0%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA-KVRRVPEVVEFYHSL 373 S PPP PP PP PPPPP PPPPPPPP ++A KV R PEVVEFY SL Sbjct: 614 SPPPPRPPGAPP----PPPPPGKPGGPPPPPPPPGSLPRNLAGGDKVHRAPEVVEFYQSL 669 Query: 372 MRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFL 193 M+R++ ++D+T G+ + A SN MIGEIENRS +LLA+K DVETQGDF+ L Sbjct: 670 MKREA---KKDTTSLGSTTSSAFDVRSN---MIGEIENRSTFLLAVKADVETQGDFVESL 723 Query: 192 IKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 EV A+F +I+DVV FV WLD+ELS+LVDERAVLKHF+WPE K DALREAAF Sbjct: 724 ANEVRAASFVNIDDVVAFVNWLDEELSFLVDERAVLKHFDWPESKTDALREAAF 777 [20][TOP] >UniRef100_Q84UR3 Os08g0129600 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q84UR3_ORYSJ Length = 798 Score = 197 bits (501), Expect = 5e-49 Identities = 108/182 (59%), Positives = 127/182 (69%), Gaps = 2/182 (1%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMR 367 IP P P P + H P S + P PPPPPPPPK + + ++R P+V E YHSLMR Sbjct: 484 IPNPPPRPSVSVPHSGPSNGSAANPPKPPPPPPPPKFSTRNAGVMKRAPQVAELYHSLMR 543 Query: 366 RDSTNSRRDSTGGGNAAAEAILANS-NARD-MIGEIENRSVYLLAIKTDVETQGDFIRFL 193 RDS ++D++G G ANS N R MIGEIENRS +L AIK DVETQG+F++ L Sbjct: 544 RDS---KKDTSGSGICET----ANSANVRSSMIGEIENRSSHLQAIKADVETQGEFVKSL 596 Query: 192 IKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSFVLK 13 IKEV NAA+ DIEDVV FVKWLDDEL +LVDERAVLKHF+WPE+KAD LREAAF LK Sbjct: 597 IKEVTNAAYKDIEDVVAFVKWLDDELGFLVDERAVLKHFDWPERKADTLREAAFGYQDLK 656 Query: 12 DL 7 L Sbjct: 657 KL 658 [21][TOP] >UniRef100_A2YQW7 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YQW7_ORYSI Length = 809 Score = 197 bits (501), Expect = 5e-49 Identities = 108/182 (59%), Positives = 127/182 (69%), Gaps = 2/182 (1%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMR 367 IP P P P + H P S + P PPPPPPPPK + + ++R P+V E YHSLMR Sbjct: 495 IPNPPPRPSVSVPHSGPSNGSAANPPKPPPPPPPPKFSTRNAGVMKRAPQVAELYHSLMR 554 Query: 366 RDSTNSRRDSTGGGNAAAEAILANS-NARD-MIGEIENRSVYLLAIKTDVETQGDFIRFL 193 RDS ++D++G G ANS N R MIGEIENRS +L AIK DVETQG+F++ L Sbjct: 555 RDS---KKDTSGSGICET----ANSANVRSSMIGEIENRSSHLQAIKADVETQGEFVKSL 607 Query: 192 IKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSFVLK 13 IKEV NAA+ DIEDVV FVKWLDDEL +LVDERAVLKHF+WPE+KAD LREAAF LK Sbjct: 608 IKEVTNAAYKDIEDVVAFVKWLDDELGFLVDERAVLKHFDWPERKADTLREAAFGYQDLK 667 Query: 12 DL 7 L Sbjct: 668 KL 669 [22][TOP] >UniRef100_B3IYT8 Chloroplast unusual positioning 1B n=1 Tax=Adiantum capillus-veneris RepID=B3IYT8_ADICA Length = 1030 Score = 196 bits (498), Expect = 1e-48 Identities = 102/173 (58%), Positives = 123/173 (71%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLM 370 S PP PPPPPP PPPP APPPPP P K +V+R PEVVEFY SLM Sbjct: 720 SAGPPLPPPPPP-----PPPPRAPGAPPPPPLPGSLKVQGTGKEQVQRAPEVVEFYQSLM 774 Query: 369 RRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLI 190 RR++ ++D++ G A + A+ +MIGEIENRS +LLA+K DVETQGDF++ L Sbjct: 775 RREA---KKDTSLG----ASDVNASDARNNMIGEIENRSAFLLAVKADVETQGDFVQSLA 827 Query: 189 KEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 EV AA++DIEDV+ FV WLD+ELS+LVDERAVLKHF+WPE KADALREAAF Sbjct: 828 TEVREAAYTDIEDVIAFVAWLDEELSFLVDERAVLKHFDWPESKADALREAAF 880 [23][TOP] >UniRef100_C5XF84 Putative uncharacterized protein Sb03g029690 n=1 Tax=Sorghum bicolor RepID=C5XF84_SORBI Length = 692 Score = 195 bits (496), Expect = 2e-48 Identities = 121/239 (50%), Positives = 131/239 (54%), Gaps = 70/239 (29%) Frame = -2 Query: 537 PHPPPPPPLLHQPPPPP----------------------SVSKAPPPPPPPPPPKSLSIA 424 P PPPPPL H PPPPP + + PPPPPPPPP + Sbjct: 296 PPIPPPPPLCHPPPPPPPPPSRSKRFSPSSSARVDGSAAATAAGPPPPPPPPPARRPPFG 355 Query: 423 SAK-------VRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEI 265 +A VRRVPEVVEFYHSLMRR+S +RD G A A +A + RDMIGEI Sbjct: 356 AAPPPSGQCDVRRVPEVVEFYHSLMRRES---KRDGGVGSEATNGAGVATT--RDMIGEI 410 Query: 264 ENRSVYLLA-----------------------------------------IKTDVETQGD 208 ENRS +LLA IK+DVE QGD Sbjct: 411 ENRSAHLLAESLVTHSRRTVEASFSVVYCKITSGLPSLLQDYKRFGWVDTIKSDVERQGD 470 Query: 207 FIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 FIRFLIKEV AAF IEDVV FVKWLDDELS LVDERAVLKHFEWPE KADALREAAF Sbjct: 471 FIRFLIKEVEGAAFVGIEDVVSFVKWLDDELSRLVDERAVLKHFEWPEHKADALREAAF 529 [24][TOP] >UniRef100_B9EYD1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9EYD1_ORYSJ Length = 652 Score = 194 bits (494), Expect = 3e-48 Identities = 125/235 (53%), Positives = 138/235 (58%), Gaps = 51/235 (21%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSV---SKAPPPPPPPPPPKSLSIASA------KVRR 406 P+ S PP PPPPP P SV + APPPPPPPPP + S A++ +V R Sbjct: 273 PELSKLPPIPPPPPM------PALSVCGRAAAPPPPPPPPPARRTSGAASPAASGPRVTR 326 Query: 405 VPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLA---- 238 VPEVVEFYHSLMRRDS + RD +GGG A +A + RDMIGEIENRS +LLA Sbjct: 327 VPEVVEFYHSLMRRDSRS--RDGSGGGETANGGGVAAT--RDMIGEIENRSAHLLADESL 382 Query: 237 --------------------------------------IKTDVETQGDFIRFLIKEVGNA 172 IK+DVE QGDFIRFLIKEV A Sbjct: 383 VAVLTGTAACAESGEYVSDWHRGARCKRSECGIQSVVPIKSDVERQGDFIRFLIKEVEGA 442 Query: 171 AFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSFVLKDL 7 AF DIEDVV FVKWLD+ELS LVDERAVLKHFEWPE K DALREAAF LK L Sbjct: 443 AFVDIEDVVTFVKWLDNELSRLVDERAVLKHFEWPENKEDALREAAFGYCDLKKL 497 [25][TOP] >UniRef100_B8A6T8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8A6T8_ORYSI Length = 668 Score = 194 bits (494), Expect = 3e-48 Identities = 125/235 (53%), Positives = 138/235 (58%), Gaps = 51/235 (21%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSV---SKAPPPPPPPPPPKSLSIASA------KVRR 406 P+ S PP PPPPP P SV + APPPPPPPPP + S A++ +V R Sbjct: 273 PELSKLPPIPPPPPM------PALSVCGRAAAPPPPPPPPPARRTSGAASPAASGPRVTR 326 Query: 405 VPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLA---- 238 VPEVVEFYHSLMRRDS + RD +GGG A +A + RDMIGEIENRS +LLA Sbjct: 327 VPEVVEFYHSLMRRDSRS--RDGSGGGETANGGGVAAT--RDMIGEIENRSAHLLADESL 382 Query: 237 --------------------------------------IKTDVETQGDFIRFLIKEVGNA 172 IK+DVE QGDFIRFLIKEV A Sbjct: 383 VAVLTGTAACAESGEYVSDWHRGARCKRSECGIQSVVPIKSDVERQGDFIRFLIKEVEGA 442 Query: 171 AFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSFVLKDL 7 AF DIEDVV FVKWLD+ELS LVDERAVLKHFEWPE K DALREAAF LK L Sbjct: 443 AFVDIEDVVTFVKWLDNELSRLVDERAVLKHFEWPENKEDALREAAFGYCDLKKL 497 [26][TOP] >UniRef100_A9TGD3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TGD3_PHYPA Length = 955 Score = 194 bits (494), Expect = 3e-48 Identities = 107/195 (54%), Positives = 124/195 (63%), Gaps = 18/195 (9%) Frame = -2 Query: 561 PPQKSIPPPH---------------PPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PP+ S P P PPPPPP PPPP APPPPPPPPP LS Sbjct: 609 PPKPSRPQPSVPAAPQSAGVSGGGVPPPPPP----PPPPRGGPGAPPPPPPPPPMGGLSK 664 Query: 426 ASAK---VRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENR 256 K V R PEVVEFY SLM+RD+ ++ ++ GG N A +MIGEIENR Sbjct: 665 MGKKTDDVHRAPEVVEFYQSLMKRDAKSAVVNTAGGNNPEAR--------NNMIGEIENR 716 Query: 255 SVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF 76 S +LLAIK DVETQG+F+ L EV A + DI+DVV FV WLD+ELS+LVDERAVLKHF Sbjct: 717 STHLLAIKADVETQGEFVMSLAAEVRAAVYGDIKDVVEFVNWLDEELSFLVDERAVLKHF 776 Query: 75 EWPEQKADALREAAF 31 +WPE KADA+REAAF Sbjct: 777 DWPEGKADAMREAAF 791 [27][TOP] >UniRef100_A2V813 Chloroplast unusual positioning 1A n=1 Tax=Physcomitrella patens RepID=A2V813_PHYPA Length = 1130 Score = 194 bits (494), Expect = 3e-48 Identities = 107/195 (54%), Positives = 124/195 (63%), Gaps = 18/195 (9%) Frame = -2 Query: 561 PPQKSIPPPH---------------PPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PP+ S P P PPPPPP PPPP APPPPPPPPP LS Sbjct: 784 PPKPSRPQPSVPAAPQSAGVSGGGVPPPPPP----PPPPRGGPGAPPPPPPPPPMGGLSK 839 Query: 426 ASAK---VRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENR 256 K V R PEVVEFY SLM+RD+ ++ ++ GG N A +MIGEIENR Sbjct: 840 MGKKTDDVHRAPEVVEFYQSLMKRDAKSAVVNTAGGNNPEAR--------NNMIGEIENR 891 Query: 255 SVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF 76 S +LLAIK DVETQG+F+ L EV A + DI+DVV FV WLD+ELS+LVDERAVLKHF Sbjct: 892 STHLLAIKADVETQGEFVMSLAAEVRAAVYGDIKDVVEFVNWLDEELSFLVDERAVLKHF 951 Query: 75 EWPEQKADALREAAF 31 +WPE KADA+REAAF Sbjct: 952 DWPEGKADAMREAAF 966 [28][TOP] >UniRef100_C5YMW5 Putative uncharacterized protein Sb07g002450 n=1 Tax=Sorghum bicolor RepID=C5YMW5_SORBI Length = 797 Score = 194 bits (493), Expect = 4e-48 Identities = 107/182 (58%), Positives = 128/182 (70%), Gaps = 2/182 (1%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMR 367 IP P P P + + P S P PPPPPPPPK S ++ ++R P+V E YHSLMR Sbjct: 483 IPNPPPRPSVSVSNSGPSNGSTVNPPRPPPPPPPPKFSSKSTGVMKRAPQVAELYHSLMR 542 Query: 366 RDSTNSRRDSTGGGNAAAEAILANS-NARD-MIGEIENRSVYLLAIKTDVETQGDFIRFL 193 RD+ ++D++ GG A ANS N R MIGEIENRS +L AIK DVETQG+F++ L Sbjct: 543 RDT---KKDTSSGGICEA----ANSANVRSSMIGEIENRSSHLQAIKADVETQGEFVKSL 595 Query: 192 IKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSFVLK 13 IKEV +AA+ DIEDVV FVKWLDDEL +LVDERAVLKHF+WPE+KAD LREAAF LK Sbjct: 596 IKEVTSAAYKDIEDVVAFVKWLDDELGFLVDERAVLKHFDWPEKKADTLREAAFGYQDLK 655 Query: 12 DL 7 L Sbjct: 656 KL 657 [29][TOP] >UniRef100_B3IYT7 Chloroplast unusual positioning 1A n=1 Tax=Adiantum capillus-veneris RepID=B3IYT7_ADICA Length = 1048 Score = 192 bits (489), Expect = 1e-47 Identities = 99/168 (58%), Positives = 120/168 (71%), Gaps = 1/168 (0%) Frame = -2 Query: 531 PPPPPPLLHQPPPPPSVSKAPPPPPPPPPP-KSLSIASAKVRRVPEVVEFYHSLMRRDST 355 P PPP PPPPP APPPPPPPP KS + KV+R PEVVEFY SLMRR++ Sbjct: 736 PGAPPP----PPPPPRAPGAPPPPPPPPGSLKSQGASGDKVQRAPEVVEFYQSLMRREAK 791 Query: 354 NSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGN 175 N+ + A + + ++IGEIENRS +LLA+K DVETQG+F++ L EV + Sbjct: 792 NNT-------SVGATDVNVSDARNNLIGEIENRSAFLLAVKADVETQGEFVQSLAAEVRD 844 Query: 174 AAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 AA++DIEDVV FV WLD+ELS+LVDERAVLKHF+WPE KADALREAAF Sbjct: 845 AAYTDIEDVVAFVSWLDEELSFLVDERAVLKHFDWPENKADALREAAF 892 [30][TOP] >UniRef100_A3CE59 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3CE59_ORYSJ Length = 929 Score = 191 bits (486), Expect = 3e-47 Identities = 100/172 (58%), Positives = 119/172 (69%), Gaps = 1/172 (0%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA-KVRRVPEVVEFYHSLMR 367 PPP PP PP PPPPP PPPPPP P ++A KV R PEVVEFY SLM+ Sbjct: 616 PPPRPPGAPP----PPPPPGKPGGPPPPPPRPGSLPRNLAGGDKVHRAPEVVEFYQSLMK 671 Query: 366 RDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIK 187 R++ ++D+T G+ + SN MIGEIENRS +LLA+K DVETQGDF+ L Sbjct: 672 REA---KKDTTSLGSTTSSVSDVRSN---MIGEIENRSTFLLAVKVDVETQGDFVESLAN 725 Query: 186 EVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 EV A+F +I+DVV FV WLD+ELS+LVDERAVLKHF+WPE K DALREAAF Sbjct: 726 EVRAASFVNIDDVVAFVNWLDEELSFLVDERAVLKHFDWPESKTDALREAAF 777 [31][TOP] >UniRef100_Q9LI74 Protein CHUP1, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=CHUP1_ARATH Length = 1004 Score = 190 bits (482), Expect = 7e-47 Identities = 105/183 (57%), Positives = 126/183 (68%), Gaps = 6/183 (3%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA---KVRRVPEVV 391 PP PP PPPPP PPPPP PPPPPPPP +L + KV R PE+V Sbjct: 672 PPLPGGGPPPPPPPPG--GGPPPPPGGG----PPPPPPPPGALGRGAGGGNKVHRAPELV 725 Query: 390 EFYHSLMRRDSTNSRRDS---TGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVE 220 EFY SLM+R+S S +G GN++A A +N MIGEIENRS +LLA+K DVE Sbjct: 726 EFYQSLMKRESKKEGAPSLISSGTGNSSA----ARNN---MIGEIENRSTFLLAVKADVE 778 Query: 219 TQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALRE 40 TQGDF++ L EV ++F+DIED++ FV WLD+ELS+LVDERAVLKHF+WPE KADALRE Sbjct: 779 TQGDFVQSLATEVRASSFTDIEDLLAFVSWLDEELSFLVDERAVLKHFDWPEGKADALRE 838 Query: 39 AAF 31 AAF Sbjct: 839 AAF 841 [32][TOP] >UniRef100_A9S734 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9S734_PHYPA Length = 888 Score = 189 bits (480), Expect = 1e-46 Identities = 106/192 (55%), Positives = 126/192 (65%), Gaps = 17/192 (8%) Frame = -2 Query: 555 QKSIPPP--HPPPPPPLLHQPPPPPSVSKAPPPPP-------PPPPPKSLSIASAK---- 415 +K+ PPP +PP P + P P PPPPP PPPPP SL + ++ Sbjct: 554 RKANPPPKLNPPHPSQAVPSPGGAPGGFVIPPPPPRGPGALLPPPPPPSLKGSLSRTQGN 613 Query: 414 ----VRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVY 247 V R PEVVEFYHSLM+RDS ++ +S GG + A +MIGEIENRS + Sbjct: 614 HSDDVHRAPEVVEFYHSLMKRDSKSAVSNSGGGTDPTAR--------NNMIGEIENRSAH 665 Query: 246 LLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWP 67 LLAIK DVETQGDF+ L EV A F+DIEDVV FV+WLDDELSYLVDERAVLKHF+WP Sbjct: 666 LLAIKADVETQGDFVMSLAVEVRAAEFTDIEDVVNFVRWLDDELSYLVDERAVLKHFDWP 725 Query: 66 EQKADALREAAF 31 E KADA+REA+F Sbjct: 726 EGKADAMREASF 737 [33][TOP] >UniRef100_A2V814 Chloroplast unusual positioning 1B n=1 Tax=Physcomitrella patens RepID=A2V814_PHYPA Length = 1141 Score = 189 bits (480), Expect = 1e-46 Identities = 106/192 (55%), Positives = 126/192 (65%), Gaps = 17/192 (8%) Frame = -2 Query: 555 QKSIPPP--HPPPPPPLLHQPPPPPSVSKAPPPPP-------PPPPPKSLSIASAK---- 415 +K+ PPP +PP P + P P PPPPP PPPPP SL + ++ Sbjct: 807 RKANPPPKLNPPHPSQAVPSPGGAPGGFVIPPPPPRGPGALLPPPPPPSLKGSLSRTQGN 866 Query: 414 ----VRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVY 247 V R PEVVEFYHSLM+RDS ++ +S GG + A +MIGEIENRS + Sbjct: 867 HSDDVHRAPEVVEFYHSLMKRDSKSAVSNSGGGTDPTAR--------NNMIGEIENRSAH 918 Query: 246 LLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWP 67 LLAIK DVETQGDF+ L EV A F+DIEDVV FV+WLDDELSYLVDERAVLKHF+WP Sbjct: 919 LLAIKADVETQGDFVMSLAVEVRAAEFTDIEDVVNFVRWLDDELSYLVDERAVLKHFDWP 978 Query: 66 EQKADALREAAF 31 E KADA+REA+F Sbjct: 979 EGKADAMREASF 990 [34][TOP] >UniRef100_B9SEH5 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9SEH5_RICCO Length = 998 Score = 187 bits (475), Expect = 5e-46 Identities = 99/179 (55%), Positives = 128/179 (71%), Gaps = 3/179 (1%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA---KVRRVPEVVE 388 P +PPP PPPPP + PPPPP PP PPPPP SL + KV R PE+VE Sbjct: 679 PSSGLPPP--PPPPPGIPAPPPPPG-----GPPRPPPPPGSLPRGAGSGDKVHRAPELVE 731 Query: 387 FYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGD 208 FY SLM+R++ ++D++ ++ + A A SN MIGEIENRS +LLA+K DVE+QG+ Sbjct: 732 FYQSLMKREA---KKDTSSLISSTSNASEARSN---MIGEIENRSSFLLAVKADVESQGE 785 Query: 207 FIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 F++ L EV ++F++IED++ FV WLD+ELS+LVDERAVLKHF+WPE KADALREAAF Sbjct: 786 FVQSLATEVRASSFTNIEDLLAFVNWLDEELSFLVDERAVLKHFDWPESKADALREAAF 844 [35][TOP] >UniRef100_UPI000198360D PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI000198360D Length = 433 Score = 186 bits (473), Expect = 8e-46 Identities = 108/191 (56%), Positives = 126/191 (65%), Gaps = 7/191 (3%) Frame = -2 Query: 558 PQKSIPPPHPPPPP-PLLHQPPPPPSVSK-----APPPPPPPPPPKSLSIASAKVRRVPE 397 P+K P P PPP P PP V+ APPPP PPP P L S VRRVPE Sbjct: 106 PRKERPARIPKPPPRPTTATPPSLKEVNGNKVPLAPPPPRPPPLPSKLLAGSKAVRRVPE 165 Query: 396 VVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVET 217 V+EFY SL RRD R + G I N+R+MIGEIENRS +L+AIK+DVET Sbjct: 166 VMEFYRSLTRRDPQVERANPVG--------IPTVGNSRNMIGEIENRSSHLMAIKSDVET 217 Query: 216 QGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALRE 40 QG+FI L +EV AA+++I DV FVKWLD+ELSYLVDERAVLKHF +WPE+KADALRE Sbjct: 218 QGEFINSLTREVEAAAYTEISDVEAFVKWLDEELSYLVDERAVLKHFPKWPERKADALRE 277 Query: 39 AAFCSFVLKDL 7 AAF LK+L Sbjct: 278 AAFSYRDLKNL 288 [36][TOP] >UniRef100_B9HWM8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HWM8_POPTR Length = 955 Score = 186 bits (473), Expect = 8e-46 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (1%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA---KVRRVPEVVE 388 P +PPP P PPP PPPPP PP PPPPP SL + KV R PE+VE Sbjct: 638 PSGGVPPPPPGAPPP----PPPPPG-----GPPRPPPPPGSLPRGAGSGDKVHRAPELVE 688 Query: 387 FYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGD 208 FY SLM+R++ ++D++ ++ + A SN MIGEIENRS +LLA+K DVETQGD Sbjct: 689 FYQSLMKREA---KKDTSSLISSTSNVSHARSN---MIGEIENRSSFLLAVKADVETQGD 742 Query: 207 FIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 F++ L EV A+FS I+D+V FV WLD+ELS+LVDERAVLKHF+WPE KADALREAAF Sbjct: 743 FVQSLATEVRAASFSTIDDLVAFVNWLDEELSFLVDERAVLKHFDWPESKADALREAAF 801 [37][TOP] >UniRef100_A7NYC2 Chromosome chr6 scaffold_3, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7NYC2_VITVI Length = 435 Score = 186 bits (473), Expect = 8e-46 Identities = 108/191 (56%), Positives = 126/191 (65%), Gaps = 7/191 (3%) Frame = -2 Query: 558 PQKSIPPPHPPPPP-PLLHQPPPPPSVSK-----APPPPPPPPPPKSLSIASAKVRRVPE 397 P+K P P PPP P PP V+ APPPP PPP P L S VRRVPE Sbjct: 106 PRKERPARIPKPPPRPTTATPPSLKEVNGNKVPLAPPPPRPPPLPSKLLAGSKAVRRVPE 165 Query: 396 VVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVET 217 V+EFY SL RRD R + G I N+R+MIGEIENRS +L+AIK+DVET Sbjct: 166 VMEFYRSLTRRDPQVERANPVG--------IPTVGNSRNMIGEIENRSSHLMAIKSDVET 217 Query: 216 QGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALRE 40 QG+FI L +EV AA+++I DV FVKWLD+ELSYLVDERAVLKHF +WPE+KADALRE Sbjct: 218 QGEFINSLTREVEAAAYTEISDVEAFVKWLDEELSYLVDERAVLKHFPKWPERKADALRE 277 Query: 39 AAFCSFVLKDL 7 AAF LK+L Sbjct: 278 AAFSYRDLKNL 288 [38][TOP] >UniRef100_UPI0001982883 PREDICTED: similar to CHUP1 (CHLOROPLAST UNUSUAL POSITIONING 1) n=1 Tax=Vitis vinifera RepID=UPI0001982883 Length = 989 Score = 185 bits (470), Expect = 2e-45 Identities = 100/179 (55%), Positives = 124/179 (69%), Gaps = 3/179 (1%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA---KVRRVPEVVE 388 P +PPP PPPPP PPPPP PP PPPPP SL + KV R PE+VE Sbjct: 671 PSSGVPPP--PPPPPGAPPPPPPPG-----GPPRPPPPPGSLPRGAGSGDKVHRAPELVE 723 Query: 387 FYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGD 208 FY +LM+R++ ++D+ ++ + A A SN MIGEI N+S +LLA+K DVETQGD Sbjct: 724 FYQTLMKREA---KKDTPSLVSSTSNAADARSN---MIGEIANKSSFLLAVKADVETQGD 777 Query: 207 FIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 F++ L EV A+F+ IED+V FV WLD+ELS+LVDERAVLKHF+WPE KADALREAAF Sbjct: 778 FVQSLATEVRAASFTKIEDLVAFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAF 836 [39][TOP] >UniRef100_B6U9R6 Pherophorin like protein n=1 Tax=Zea mays RepID=B6U9R6_MAIZE Length = 420 Score = 184 bits (467), Expect = 4e-45 Identities = 101/182 (55%), Positives = 123/182 (67%), Gaps = 5/182 (2%) Frame = -2 Query: 537 PHPPPPPPLLHQPPPPPSVSK----APPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLM 370 P P PPP P +V K APPPPPPPP P L ++ ++RVPEVVE Y SL+ Sbjct: 113 PRVPNPPPNPTCTQPKTTVRKEGCMAPPPPPPPPLPSKLQRSAKAIQRVPEVVELYRSLV 172 Query: 369 RRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLI 190 R + N + + G I A +++R+MIGEIENRS Y+LAIK+DVE QG+F+ FL Sbjct: 173 RPEGKNDAKSGSVG-------IPAATSSREMIGEIENRSAYVLAIKSDVENQGNFVNFLA 225 Query: 189 KEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFCSFVLK 13 EV NAA+ +I DV FVKWLD ELSYLVDERAVLKHF WPE+KADA+REAAF LK Sbjct: 226 SEVQNAAYKEIADVEEFVKWLDGELSYLVDERAVLKHFPNWPEKKADAMREAAFNYRDLK 285 Query: 12 DL 7 +L Sbjct: 286 NL 287 [40][TOP] >UniRef100_C0HEI5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0HEI5_MAIZE Length = 420 Score = 184 bits (466), Expect = 5e-45 Identities = 101/182 (55%), Positives = 123/182 (67%), Gaps = 5/182 (2%) Frame = -2 Query: 537 PHPPPPPPLLHQPPPPPSVSK----APPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLM 370 P P PPP P +V K APPPPPPPP P L ++ ++RVPEVVE Y SL+ Sbjct: 113 PRVPNPPPNPTCTQPKTTVRKEGCMAPPPPPPPPLPSKLQRSAKAIQRVPEVVELYRSLV 172 Query: 369 RRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLI 190 R + N + + G I A +++R+MIGEIENRS Y+LAIK+DVE QG+F+ FL Sbjct: 173 RPEGKNDAKSGSVG-------IPAATSSREMIGEIENRSAYVLAIKSDVENQGNFVNFLA 225 Query: 189 KEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFCSFVLK 13 EV NAA+ +I DV FVKWLD ELSYLVDERAVLKHF WPE+KADA+REAAF LK Sbjct: 226 SEVQNAAYREIADVEEFVKWLDGELSYLVDERAVLKHFPNWPEKKADAMREAAFNYRDLK 285 Query: 12 DL 7 +L Sbjct: 286 NL 287 [41][TOP] >UniRef100_B8AWV5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AWV5_ORYSI Length = 495 Score = 184 bits (466), Expect = 5e-45 Identities = 102/130 (78%), Positives = 106/130 (81%), Gaps = 2/130 (1%) Frame = -2 Query: 414 VRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILAN--SNARDMIGEIENRSVYLL 241 VRRVPEVVEFYHSLMRRDS +RD GGG EA + ARDMIGEIENRS +LL Sbjct: 209 VRRVPEVVEFYHSLMRRDS---KRDG-GGGGGGPEACPGGGAAAARDMIGEIENRSAHLL 264 Query: 240 AIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQ 61 AIK+DVE QGDFIRFLIKEV AAF DIEDVV FVKWLD ELS LVDERAVLKHFEWPEQ Sbjct: 265 AIKSDVERQGDFIRFLIKEVEGAAFVDIEDVVTFVKWLDVELSRLVDERAVLKHFEWPEQ 324 Query: 60 KADALREAAF 31 KADALREAAF Sbjct: 325 KADALREAAF 334 [42][TOP] >UniRef100_A9RCD6 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RCD6_PHYPA Length = 875 Score = 182 bits (463), Expect = 1e-44 Identities = 103/180 (57%), Positives = 125/180 (69%), Gaps = 3/180 (1%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA--KVRRVPEVVE 388 P + + P PPPPP PPPPP A PPPPPP P SL S K++R P VVE Sbjct: 566 PLGRKVAGPLGPPPPP----PPPPPLTPGALCPPPPPPTPGSLIKGSGAEKMQRAPGVVE 621 Query: 387 FYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARD-MIGEIENRSVYLLAIKTDVETQG 211 FY SLM+RD+ S S+ GG ++NS AR+ +IGEIENRS +LLAIK DVETQG Sbjct: 622 FYQSLMKRDAKQSL--SSPGGT------VSNSEARNNIIGEIENRSTHLLAIKADVETQG 673 Query: 210 DFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 +F+ L EV A+FS+IE+VV FV WLD+ELS+LVDERAVLK+F+WPE K DALREA+F Sbjct: 674 EFVESLAAEVRAASFSNIEEVVEFVVWLDEELSFLVDERAVLKYFDWPEGKVDALREASF 733 [43][TOP] >UniRef100_C0HDZ9 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0HDZ9_MAIZE Length = 417 Score = 178 bits (452), Expect = 2e-43 Identities = 99/181 (54%), Positives = 120/181 (66%), Gaps = 4/181 (2%) Frame = -2 Query: 537 PHPPPPPPLLHQPPPPPSVSKA---PPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMR 367 P P PP P +V K PPPPPPP P L ++ ++RVPEVVE Y SL+R Sbjct: 111 PRVPNQPPNPTSTQPKATVRKEGCMAPPPPPPPLPSKLQRSTKAIQRVPEVVELYRSLVR 170 Query: 366 RDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIK 187 R+ N+ + + G I A +N+R+MIGEIENRS Y+LAIK+DVE QG+F+ FL Sbjct: 171 REGKNNAKSGSVG-------IPAATNSREMIGEIENRSAYVLAIKSDVENQGNFVNFLAS 223 Query: 186 EVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFCSFVLKD 10 EV NAA+ I DV FVKWLD ELSYLVDERAVLK F WPE+KADALREAAF LK+ Sbjct: 224 EVQNAAYKKIADVEEFVKWLDGELSYLVDERAVLKQFPNWPEKKADALREAAFNYRDLKN 283 Query: 9 L 7 + Sbjct: 284 I 284 [44][TOP] >UniRef100_B9HND5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HND5_POPTR Length = 388 Score = 176 bits (447), Expect = 8e-43 Identities = 100/167 (59%), Positives = 118/167 (70%), Gaps = 1/167 (0%) Frame = -2 Query: 528 PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDSTNS 349 P P ++ P+ + AP PPPPPPPPK +S+ S VRRVPEV EFY + RRD Sbjct: 87 PSSPKEVNSNKLSPAPAPAPAPPPPPPPPK-MSVGSKTVRRVPEVAEFYRLVTRRDVHME 145 Query: 348 RRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAA 169 R N+AA ++A + + MIGEIENRS YL AIK+DVE Q +FI FLIKEV +AA Sbjct: 146 NRI-----NSAAIPVVAFTPS--MIGEIENRSTYLSAIKSDVEKQKEFINFLIKEVESAA 198 Query: 168 FSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAF 31 F +I DV FVKWLDDELS LVDERAVLKHF +WPE+KADALREAAF Sbjct: 199 FKEISDVKAFVKWLDDELSSLVDERAVLKHFPQWPERKADALREAAF 245 [45][TOP] >UniRef100_A9NUN1 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NUN1_PICSI Length = 314 Score = 176 bits (446), Expect = 1e-42 Identities = 95/177 (53%), Positives = 119/177 (67%), Gaps = 5/177 (2%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP-----KSLSIASAKVRRVPEVVEFY 382 +PPP PPP P AP PPPPPPP KS + KV R PE+VEFY Sbjct: 1 MPPPRPPPRPG-------------APGVPPPPPPPLGGMLKSQGPSGNKVHRAPELVEFY 47 Query: 381 HSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFI 202 SLM+R++ ++++ +AA+ +N MIGEIENRS +LL++K DVETQGDF+ Sbjct: 48 QSLMKREA---KKEAATMASAASNVADVRNN---MIGEIENRSAFLLSVKADVETQGDFV 101 Query: 201 RFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 + L EV +A+ +IEDVV FV WLD+ELS+LVDERAVLKHF+WPE KADALREAAF Sbjct: 102 QALATEVRASAYKNIEDVVAFVNWLDEELSFLVDERAVLKHFDWPESKADALREAAF 158 [46][TOP] >UniRef100_UPI0000E12022 Os03g0294100 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E12022 Length = 435 Score = 175 bits (444), Expect = 2e-42 Identities = 95/178 (53%), Positives = 116/178 (65%), Gaps = 1/178 (0%) Frame = -2 Query: 537 PHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDS 358 P+PPP P PPPPPPP P L ++ V+RVP+VVE Y L+RR+ Sbjct: 113 PNPPPSPTYTQPIVNARKEGGMAPPPPPPPLPSRLLKSTKAVQRVPDVVELYRLLVRREG 172 Query: 357 TNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVG 178 N + + G I A +N+R+MIGEIEN+S Y+LAIK+DVE Q +FI FL EV Sbjct: 173 KNDAKSGSMG-------IPAATNSREMIGEIENKSAYVLAIKSDVENQSEFINFLAVEVK 225 Query: 177 NAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFCSFVLKDL 7 NAA+ +I DV FVKWLD ELSYLVDERAVLKHF WPE+KAD +REAAF LK+L Sbjct: 226 NAAYKEIADVEEFVKWLDGELSYLVDERAVLKHFPNWPEKKADTMREAAFTYRDLKNL 283 [47][TOP] >UniRef100_Q10MV6 Pherophorin, putative, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q10MV6_ORYSJ Length = 416 Score = 175 bits (444), Expect = 2e-42 Identities = 95/178 (53%), Positives = 116/178 (65%), Gaps = 1/178 (0%) Frame = -2 Query: 537 PHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDS 358 P+PPP P PPPPPPP P L ++ V+RVP+VVE Y L+RR+ Sbjct: 113 PNPPPSPTYTQPIVNARKEGGMAPPPPPPPLPSRLLKSTKAVQRVPDVVELYRLLVRREG 172 Query: 357 TNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVG 178 N + + G I A +N+R+MIGEIEN+S Y+LAIK+DVE Q +FI FL EV Sbjct: 173 KNDAKSGSMG-------IPAATNSREMIGEIENKSAYVLAIKSDVENQSEFINFLAVEVK 225 Query: 177 NAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFCSFVLKDL 7 NAA+ +I DV FVKWLD ELSYLVDERAVLKHF WPE+KAD +REAAF LK+L Sbjct: 226 NAAYKEIADVEEFVKWLDGELSYLVDERAVLKHFPNWPEKKADTMREAAFTYRDLKNL 283 [48][TOP] >UniRef100_B9F7T3 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9F7T3_ORYSJ Length = 1067 Score = 175 bits (444), Expect = 2e-42 Identities = 95/178 (53%), Positives = 116/178 (65%), Gaps = 1/178 (0%) Frame = -2 Query: 537 PHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDS 358 P+PPP P PPPPPPP P L ++ V+RVP+VVE Y L+RR+ Sbjct: 113 PNPPPSPTYTQPIVNARKEGGMAPPPPPPPLPSRLLKSTKAVQRVPDVVELYRLLVRREG 172 Query: 357 TNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVG 178 N + + G I A +N+R+MIGEIEN+S Y+LAIK+DVE Q +FI FL EV Sbjct: 173 KNDAKSGSMG-------IPAATNSREMIGEIENKSAYVLAIKSDVENQSEFINFLAVEVK 225 Query: 177 NAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFCSFVLKDL 7 NAA+ +I DV FVKWLD ELSYLVDERAVLKHF WPE+KAD +REAAF LK+L Sbjct: 226 NAAYKEIADVEEFVKWLDGELSYLVDERAVLKHFPNWPEKKADTMREAAFTYRDLKNL 283 [49][TOP] >UniRef100_A7Q4U9 Chromosome chr10 scaffold_50, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7Q4U9_VITVI Length = 781 Score = 172 bits (436), Expect = 2e-41 Identities = 99/164 (60%), Positives = 118/164 (71%), Gaps = 11/164 (6%) Frame = -2 Query: 465 PPPPPPPPKSLS-----IASAK-----VRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAA 316 P PPP P +LS + SA+ V+R P+VVEFYHSLM+RDS R+DS+ GG Sbjct: 470 PNPPPRPSGALSSGPKEMFSARSTTGIVQRAPQVVEFYHSLMKRDS---RKDSSNGGIYD 526 Query: 315 AEAILANSNAR-DMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPF 139 + +N R +MIGEIENRS YLLAIK DVETQG+F+ LI+EV NA + +IEDVV F Sbjct: 527 TPDV---ANVRSNMIGEIENRSSYLLAIKADVETQGEFVNSLIREVNNAVYQNIEDVVAF 583 Query: 138 VKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSFVLKDL 7 VKWLDDEL +LVDERAVLKHF+WPE+KAD LREAAF LK L Sbjct: 584 VKWLDDELCFLVDERAVLKHFDWPEKKADTLREAAFGYRDLKKL 627 [50][TOP] >UniRef100_C6TG51 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TG51_SOYBN Length = 371 Score = 163 bits (413), Expect = 7e-39 Identities = 95/180 (52%), Positives = 115/180 (63%), Gaps = 7/180 (3%) Frame = -2 Query: 540 PPHPPPPPPLLHQPPPPPSVSKAP------PPPPPPPPPKSLSIASAKVRRVPEVVEFYH 379 PP P PLL + P PPPPP PPKSL + VRRVPEV+E Y Sbjct: 163 PPPAPSSNPLLPSHKTEKGMKVQPLALPRTAPPPPPTPPKSL-VGLKSVRRVPEVIELYR 221 Query: 378 SLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIR 199 SL R+D+ N + ST G AAA R+MI EIENRS +L AIK++V+ Q +FI Sbjct: 222 SLTRKDANNDNKISTNGTPAAAFT-------RNMIEEIENRSTFLSAIKSEVQRQREFIS 274 Query: 198 FLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFCSF 22 FLIKEV +A ++DI +V FVKWLD ELS LVDER+VLKHF WPEQK DALREA+ C++ Sbjct: 275 FLIKEVESATYADISEVEAFVKWLDGELSSLVDERSVLKHFPHWPEQKTDALREAS-CNY 333 [51][TOP] >UniRef100_B9S019 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9S019_RICCO Length = 532 Score = 162 bits (410), Expect = 2e-38 Identities = 91/185 (49%), Positives = 116/185 (62%), Gaps = 4/185 (2%) Frame = -2 Query: 549 SIPPPHPPPPPPLLH----QPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 S+ P PPPP +H PS PPPPPPPPP + L+ A A + P +VEFY Sbjct: 202 SVKTPSPPPPSRPIHLLSKAETKAPSCPSLPPPPPPPPPLRPLARA-ATAPKTPAIVEFY 260 Query: 381 HSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFI 202 SL + +R G N + + ++ ++GEI+NRS +LLAIK+D+ET+GDFI Sbjct: 261 QSLRKH---GEKRHVQGHENQYKPVVTSAHSS--VVGEIQNRSAHLLAIKSDIETKGDFI 315 Query: 201 RFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSF 22 LIK+V A++DIEDV+ FV WLD ELS L DERAVLKHF WPE+KADA+REAA Sbjct: 316 NGLIKKVLAVAYTDIEDVLKFVDWLDGELSTLADERAVLKHFNWPERKADAIREAAIEYR 375 Query: 21 VLKDL 7 LK L Sbjct: 376 SLKQL 380 [52][TOP] >UniRef100_A7P320 Chromosome chr1 scaffold_5, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7P320_VITVI Length = 959 Score = 159 bits (402), Expect = 1e-37 Identities = 87/160 (54%), Positives = 111/160 (69%), Gaps = 3/160 (1%) Frame = -2 Query: 501 PPPPPSVSKAPPPPPPPPPPKSLSIASA---KVRRVPEVVEFYHSLMRRDSTNSRRDSTG 331 P PPP S P P P +SL + KV R PE+VEFY +LM+R++ ++D+ Sbjct: 653 PRPPPKPSGGAPAGPGANPSRSLPRGAGSGDKVHRAPELVEFYQTLMKREA---KKDTPS 709 Query: 330 GGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIED 151 ++ + A A SN MIGEI N+S +LLA+K DVETQGDF++ L EV A+F+ IED Sbjct: 710 LVSSTSNAADARSN---MIGEIANKSSFLLAVKADVETQGDFVQSLATEVRAASFTKIED 766 Query: 150 VVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 +V FV WLD+ELS+LVDERAVLKHF+WPE KADALREAAF Sbjct: 767 LVAFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAF 806 [53][TOP] >UniRef100_UPI00019831F7 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019831F7 Length = 570 Score = 153 bits (387), Expect = 8e-36 Identities = 83/166 (50%), Positives = 108/166 (65%) Frame = -2 Query: 531 PPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDSTN 352 P P + Q PP + PPP PPP PP +A R+ P +VEFYHSL + Sbjct: 255 PRVPRAMDSQRKVPPCPAPPPPPLPPPQPPAR----AAATRKAPTLVEFYHSLTKGVG-- 308 Query: 351 SRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNA 172 +RD GN ++ +S ++GEI+NRS + LAIK D+ET+GDFI LI+ V A Sbjct: 309 -KRDFAQSGNH--NKLVVSSAHSSIVGEIQNRSAHQLAIKADIETKGDFINGLIQRVLAA 365 Query: 171 AFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAA 34 ++SD+ED+V FV WLD+ELS L DERAVLKHF+WPE+KADA+REAA Sbjct: 366 SYSDMEDIVKFVDWLDNELSTLADERAVLKHFKWPEKKADAMREAA 411 [54][TOP] >UniRef100_Q9SX62 F11A17.16 n=1 Tax=Arabidopsis thaliana RepID=Q9SX62_ARATH Length = 558 Score = 153 bits (387), Expect = 8e-36 Identities = 82/183 (44%), Positives = 112/183 (61%), Gaps = 8/183 (4%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLL--------HQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRV 403 P S PP PP P L+ P PPPPPPPPPP+ L+ A A+ ++ Sbjct: 224 PSPSRLPPTPPLPKFLVSPASSLGKRDENSSPFAPPTPPPPPPPPPPRPLAKA-ARAQKS 282 Query: 402 PEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDV 223 P V + + L ++D++ + S G + NS ++GEI+NRS +L+AIK D+ Sbjct: 283 PPVSQLFQLLNKQDNSRNLSQSVNGNKSQV-----NSAHNSIVGEIQNRSAHLIAIKADI 337 Query: 222 ETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALR 43 ET+G+FI LI++V FSD+EDV+ FV WLD EL+ L DERAVLKHF+WPE+KAD L+ Sbjct: 338 ETKGEFINDLIQKVLTTCFSDMEDVMKFVDWLDKELATLADERAVLKHFKWPEKKADTLQ 397 Query: 42 EAA 34 EAA Sbjct: 398 EAA 400 [55][TOP] >UniRef100_A7NW01 Chromosome chr5 scaffold_2, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7NW01_VITVI Length = 491 Score = 153 bits (387), Expect = 8e-36 Identities = 83/166 (50%), Positives = 108/166 (65%) Frame = -2 Query: 531 PPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDSTN 352 P P + Q PP + PPP PPP PP +A R+ P +VEFYHSL + Sbjct: 176 PRVPRAMDSQRKVPPCPAPPPPPLPPPQPPAR----AAATRKAPTLVEFYHSLTKGVG-- 229 Query: 351 SRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNA 172 +RD GN ++ +S ++GEI+NRS + LAIK D+ET+GDFI LI+ V A Sbjct: 230 -KRDFAQSGNH--NKLVVSSAHSSIVGEIQNRSAHQLAIKADIETKGDFINGLIQRVLAA 286 Query: 171 AFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAA 34 ++SD+ED+V FV WLD+ELS L DERAVLKHF+WPE+KADA+REAA Sbjct: 287 SYSDMEDIVKFVDWLDNELSTLADERAVLKHFKWPEKKADAMREAA 332 [56][TOP] >UniRef100_Q0DFS4 Os05g0573900 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=Q0DFS4_ORYSJ Length = 131 Score = 150 bits (379), Expect = 6e-35 Identities = 81/100 (81%), Positives = 83/100 (83%) Frame = -2 Query: 330 GGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIED 151 GG AAA ARDMIGEIENRS +LLAIK+DVE QGDFIRFLIKEV AAF DIED Sbjct: 4 GGGAAA--------ARDMIGEIENRSAHLLAIKSDVERQGDFIRFLIKEVEGAAFVDIED 55 Query: 150 VVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 VV FVKWLD ELS LVDERAVLKHFEWPEQKADALREAAF Sbjct: 56 VVTFVKWLDVELSRLVDERAVLKHFEWPEQKADALREAAF 95 [57][TOP] >UniRef100_B9HXB3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HXB3_POPTR Length = 301 Score = 150 bits (378), Expect = 8e-35 Identities = 79/147 (53%), Positives = 104/147 (70%), Gaps = 1/147 (0%) Frame = -2 Query: 471 PPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDSTNSRRDSTG-GGNAAAEAILAN 295 PPPPPPP PP + + P +VEFY+S+ +++ +RDS G E A+ Sbjct: 2 PPPPPPPLPPMRPLARATTAPKTPAIVEFYNSIRKQEG---KRDSPGLRSQYKPEKTSAH 58 Query: 294 SNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDEL 115 S+ ++GEI+NRS +LLAIK D+ET+GDFI LI++V AA++DIEDV+ FV WLD EL Sbjct: 59 SS---IVGEIQNRSTHLLAIKADIETKGDFINGLIQKVLAAAYTDIEDVLKFVDWLDGEL 115 Query: 114 SYLVDERAVLKHFEWPEQKADALREAA 34 S L DERAVLKHF+WPE+KADA+REAA Sbjct: 116 SSLADERAVLKHFKWPEKKADAIREAA 142 [58][TOP] >UniRef100_Q9LMK4 F10K1.18 protein n=1 Tax=Arabidopsis thaliana RepID=Q9LMK4_ARATH Length = 392 Score = 149 bits (376), Expect = 1e-34 Identities = 82/167 (49%), Positives = 108/167 (64%), Gaps = 4/167 (2%) Frame = -2 Query: 510 LHQPPPPPSV---SKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDSTNSRRD 340 + P P P++ S A PPPPPP P ++ VRR PEVVEFY +L +R+S + Sbjct: 93 VRNPNPKPTIQGQSTATKPPPPPPLPSKRTLGKRSVRRAPEVVEFYRALTKRESHMGNKI 152 Query: 339 STGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSD 160 + G +L+ + R+MIGEIENRS YL IK+D + D I LI +V A F+D Sbjct: 153 NQNG-------VLSPAFNRNMIGEIENRSKYLSDIKSDTDRHRDHIHILISKVEAATFTD 205 Query: 159 IEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFCSF 22 I +V FVKW+D+ELS LVDERAVLKHF +WPE+K D+LREAA C++ Sbjct: 206 ISEVETFVKWIDEELSSLVDERAVLKHFPKWPERKVDSLREAA-CNY 251 [59][TOP] >UniRef100_B8ALZ6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8ALZ6_ORYSI Length = 411 Score = 148 bits (374), Expect = 2e-34 Identities = 85/178 (47%), Positives = 106/178 (59%), Gaps = 1/178 (0%) Frame = -2 Query: 537 PHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDS 358 P+PPP P PPPPPPP P L ++ V+RVP+VVE Y L+RR+ Sbjct: 113 PNPPPSPTYTQPIVNARKEGGMAPPPPPPPLPSRLLKSTKAVQRVPDVVELYRLLVRREG 172 Query: 357 TNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVG 178 N + + G I A +N+R+MIGEIEN+S Y+LA + + EV Sbjct: 173 KNDAKSGSMG-------IPAATNSREMIGEIENKSAYVLAFDDSTQLFSGKV-----EVK 220 Query: 177 NAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFCSFVLKDL 7 NAA+ +I DV FVKWLD ELSYLVDERAVLKHF WPE+KAD +REAAF LK+L Sbjct: 221 NAAYKEIADVEEFVKWLDGELSYLVDERAVLKHFPNWPEKKADTMREAAFTYRDLKNL 278 [60][TOP] >UniRef100_B8Q8B8 SKIP interacting protein 32 (Fragment) n=1 Tax=Oryza sativa Indica Group RepID=B8Q8B8_ORYSI Length = 261 Score = 142 bits (357), Expect = 2e-32 Identities = 77/132 (58%), Positives = 94/132 (71%), Gaps = 1/132 (0%) Frame = -2 Query: 399 EVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVE 220 +VVE Y L+RR+ N + + G I A +N+R+MIGEIEN+S Y+LAIK+DVE Sbjct: 4 DVVELYRLLVRREGKNDAKSGSMG-------IPAATNSREMIGEIENKSAYVLAIKSDVE 56 Query: 219 TQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALR 43 Q +FI FL EV NAA+ +I DV FVKWLD ELSYLVDERAVLKHF WPE+KAD +R Sbjct: 57 NQSEFINFLAVEVKNAAYKEIADVEEFVKWLDGELSYLVDERAVLKHFPNWPEKKADTMR 116 Query: 42 EAAFCSFVLKDL 7 EAAF LK+L Sbjct: 117 EAAFTYRDLKNL 128 [61][TOP] >UniRef100_A5B731 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B731_VITVI Length = 955 Score = 132 bits (333), Expect = 1e-29 Identities = 74/146 (50%), Positives = 99/146 (67%) Frame = -2 Query: 468 PPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSN 289 PP K L A + + + +E +LM+R++ ++D+ ++ + A A SN Sbjct: 644 PPKLAKIKEKPLVSADSSDQSIDSKMEDSQTLMKREA---KKDTPSLVSSTSNAADARSN 700 Query: 288 ARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSY 109 MIGEI N+S +LLA+K DVETQGDF++ L EV A+F+ IED+V FV WLD+ELS+ Sbjct: 701 ---MIGEIANKSSFLLAVKADVETQGDFVQSLATEVRAASFTKIEDLVAFVNWLDEELSF 757 Query: 108 LVDERAVLKHFEWPEQKADALREAAF 31 LVDERAVLKHF+WPE KADALREAAF Sbjct: 758 LVDERAVLKHFDWPEGKADALREAAF 783 [62][TOP] >UniRef100_B4FV21 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FV21_MAIZE Length = 421 Score = 132 bits (332), Expect = 2e-29 Identities = 72/171 (42%), Positives = 99/171 (57%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMR 367 + PP PPPPPP PPPPP + + P P S A+A +V+ Y+SL Sbjct: 129 VAPPPPPPPPP----PPPPPHLKQRGVRFPSAPSTSPASKATA-------LVDMYNSLQA 177 Query: 366 RDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIK 187 + + R D + S+ ++ E++NRS +LLAIK DVET+ +FI +LI Sbjct: 178 SNKPSKRTDKS-------------SSHSSIVDELQNRSRHLLAIKADVETKAEFINYLID 224 Query: 186 EVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAA 34 + + ++ +E V+ FV WLD +LS L DE AVLKHF WPE+KADALREAA Sbjct: 225 RIHTSTYTGVEQVLTFVDWLDQQLSTLTDESAVLKHFNWPERKADALREAA 275 [63][TOP] >UniRef100_B8BNS9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BNS9_ORYSI Length = 238 Score = 132 bits (331), Expect = 2e-29 Identities = 66/107 (61%), Positives = 81/107 (75%) Frame = -2 Query: 351 SRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNA 172 +++D+T G+ + SN MIGEIENRS +LLA+K DVETQGDF+ L EV A Sbjct: 5 AKKDTTSLGSTTSSVSDVRSN---MIGEIENRSTFLLAVKVDVETQGDFVESLANEVRAA 61 Query: 171 AFSDIEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAF 31 +F +I+DVV FV WLD+ELS+LVDERAVLKHF+WPE K DALREAAF Sbjct: 62 SFVNIDDVVAFVNWLDEELSFLVDERAVLKHFDWPESKTDALREAAF 108 [64][TOP] >UniRef100_B7FN89 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FN89_MEDTR Length = 268 Score = 132 bits (331), Expect = 2e-29 Identities = 66/89 (74%), Positives = 77/89 (86%), Gaps = 1/89 (1%) Frame = -2 Query: 294 SNARD-MIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDE 118 S+AR+ MIGEIENRS +LLA+K DVETQGDF+ L EV ++FSDIED+V FV WLD+E Sbjct: 21 SDARNNMIGEIENRSTFLLAVKADVETQGDFVTSLATEVRASSFSDIEDLVAFVNWLDEE 80 Query: 117 LSYLVDERAVLKHFEWPEQKADALREAAF 31 LS+LVDERAVLKHF+WPE KADALREAAF Sbjct: 81 LSFLVDERAVLKHFDWPEGKADALREAAF 109 [65][TOP] >UniRef100_B9S6J5 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9S6J5_RICCO Length = 326 Score = 130 bits (328), Expect = 5e-29 Identities = 75/130 (57%), Positives = 92/130 (70%), Gaps = 1/130 (0%) Frame = -2 Query: 417 KVRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLA 238 K+RRV EVVEFY L ++++ + GN+ + A + +MIGEIENRS +L A Sbjct: 61 KMRRVLEVVEFYRFLTKKNANLENK-----GNSVTTPVTAFT--LNMIGEIENRSSHLSA 113 Query: 237 IKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EWPEQ 61 IK+DVE + +FI +LIKEV A F DI V FVKWLD EL+ LVDERAVLKHF EWPE+ Sbjct: 114 IKSDVEKRREFINYLIKEVETATFKDISQVEKFVKWLDVELNSLVDERAVLKHFPEWPER 173 Query: 60 KADALREAAF 31 KADALREAAF Sbjct: 174 KADALREAAF 183 [66][TOP] >UniRef100_B6U646 Pherophorin like protein n=1 Tax=Zea mays RepID=B6U646_MAIZE Length = 412 Score = 108 bits (270), Expect = 3e-22 Identities = 66/140 (47%), Positives = 74/140 (52%), Gaps = 29/140 (20%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPS-------VSKAPPPPPPPPPPK------------ 439 PP PPP PPPPPP + PPS + APPPPPPPPPP Sbjct: 274 PPIPPPPPPCPPPPPPSRSKRSSPPSSASVDGSAAAAPPPPPPPPPPPPPPARRQFGAAP 333 Query: 438 ----SLSIASAKVRRVPEVVEFYHSLMRRDS------TNSRRDSTGGGNAAAEAILANSN 289 S VRRVPEVVEFYHSLMRR+S T S + GGG AAA Sbjct: 334 APPAGASSGQGDVRRVPEVVEFYHSLMRRESKRDGSATASEAANGGGGGAAA-------- 385 Query: 288 ARDMIGEIENRSVYLLAIKT 229 RDMIGEI+NRS +LLA++T Sbjct: 386 TRDMIGEIDNRSAHLLAVRT 405 [67][TOP] >UniRef100_Q0DSR0 Os03g0294100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q0DSR0_ORYSJ Length = 112 Score = 102 bits (254), Expect = 2e-20 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%) Frame = -2 Query: 246 LLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHF-EW 70 L IK+DVE Q +FI FL EV NAA+ +I DV FVKWLD ELSYLVDERAVLKHF W Sbjct: 4 LQQIKSDVENQSEFINFLAVEVKNAAYKEIADVEEFVKWLDGELSYLVDERAVLKHFPNW 63 Query: 69 PEQKADALREAAFCSFVLKDL 7 PE+KAD +REAAF LK+L Sbjct: 64 PEKKADTMREAAFTYRDLKNL 84 [68][TOP] >UniRef100_B9H259 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H259_POPTR Length = 788 Score = 88.6 bits (218), Expect = 3e-16 Identities = 62/190 (32%), Positives = 88/190 (46%), Gaps = 14/190 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPL---------LHQPPPPPSVSKAPPPPPPPPPPKSL--SIASAK 415 PPQ S PPPPPPL L PPP P + A PPPPPP +SL A K Sbjct: 482 PPQTSTARNAPPPPPPLMMSSKGTMPLPPPPPMPLGNGAAPPPPPPGAARSLRPKKAQTK 541 Query: 414 VRRVPEVVEFYHSLMRRDSTNSR--RDSTGGGNAAAEAILANSNARDMIGEIENRSVYLL 241 ++R ++ Y L + ++ + TG A+ + D + EI RS Y Sbjct: 542 LKRSSQMGNLYRVLKGKVEGGNQLTKSPTGRKGPASSSAGGKQGMADALAEITKRSAYFQ 601 Query: 240 AIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFE-WPE 64 I+ DV+ I L + D+ +++ F K ++ L L DE VL FE +P+ Sbjct: 602 QIEEDVQKYSKEITELKAAISTFKTKDMTELIKFHKHVESILEKLTDETQVLARFEGFPQ 661 Query: 63 QKADALREAA 34 +K +ALR AA Sbjct: 662 KKLEALRTAA 671 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 12/54 (22%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPP---------PPPSVSK---APPPPPPPPPPKSLSIASA 418 PPP PPPPPP + QP PPP++S+ APP PPPPPP S + A+A Sbjct: 399 PPPTPPPPPPFVLQPATFTVASVPRPPPTMSRTVTAPPLPPPPPPMASGTAAAA 452 [69][TOP] >UniRef100_C6JS82 Putative uncharacterized protein Sb0120s002010 n=1 Tax=Sorghum bicolor RepID=C6JS82_SORBI Length = 330 Score = 86.3 bits (212), Expect = 1e-15 Identities = 52/147 (35%), Positives = 72/147 (48%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRR 364 PPP PPPPP PPPPP P P P S + A +VE Y+SL Sbjct: 136 PPPPPPPPP-----PPPPPRYQNQRVPSAPSTSPVSKATA---------LVEMYNSLQTS 181 Query: 363 DSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKE 184 + S+ + +I + E++NRS + LAIK DVET+ +FI LI + Sbjct: 182 NKKPSKHTDKSRSHHQHSSI---------VDELQNRSRHQLAIKEDVETKAEFINHLINK 232 Query: 183 VGNAAFSDIEDVVPFVKWLDDELSYLV 103 + + ++ +E VV FV WLD LS L+ Sbjct: 233 IHTSTYTGVEQVVTFVDWLDQHLSTLM 259 [70][TOP] >UniRef100_B9HYL6 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HYL6_POPTR Length = 792 Score = 84.0 bits (206), Expect = 7e-15 Identities = 58/190 (30%), Positives = 88/190 (46%), Gaps = 14/190 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPP---------LLHQPPPPPSVSKAPPPPPPPPPPKSL--SIASAK 415 PPQ S PPPPP L PPP P + A PPPPPP +SL K Sbjct: 451 PPQTSTARTASPPPPPPMMSSKGSMPLPPPPPMPLGNGAAPPPPPPGAARSLRPKKTQTK 510 Query: 414 VRRVPEVVEFYHSLMRRDSTNSR--RDSTGGGNAAAEAILANSNARDMIGEIENRSVYLL 241 ++R ++ Y +L + ++ + S+G A+ + D + EI RS Y Sbjct: 511 LKRSSQMGTLYRALKGKVEGGNQVTKSSSGRKGPASSSAGGKQGMADALAEITKRSAYFQ 570 Query: 240 AIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFE-WPE 64 I+ DV+ + L + + D+ +++ F K ++ L L DE VL FE +P+ Sbjct: 571 QIEEDVQKHAKAVTELKATISSFKTKDLTELIKFHKHVESILENLTDETQVLARFEGFPQ 630 Query: 63 QKADALREAA 34 +K +ALR AA Sbjct: 631 KKLEALRTAA 640 [71][TOP] >UniRef100_Q9S9T9 T32N4.10 protein n=1 Tax=Arabidopsis thaliana RepID=Q9S9T9_ARATH Length = 681 Score = 83.2 bits (204), Expect = 1e-14 Identities = 60/203 (29%), Positives = 91/203 (44%), Gaps = 31/203 (15%) Frame = -2 Query: 552 KSIPPPHPPPPPPLLHQPPPPPSVSKA-----------------------PPPPPPPPPP 442 +S PPP PP P PPPPP +SKA P PP PP Sbjct: 322 RSQPPPPPPSPEHKAPAPPPPPPMSKASESGEFCQFSKTHSTNGDNAPSMPAPPAPPGSG 381 Query: 441 KSLSIASAKVRRVPEVVEFYHSLM----RRDSTNSRRDSTGGGNAAAE---AILANSNAR 283 +SL A++K+RR ++ Y +L R + ++ G N+ AE +A S Sbjct: 382 RSLKKATSKLRRSAQIANLYWALKGKLEGRGVEGKTKKASKGQNSVAEKSPVKVARSGMA 441 Query: 282 DMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLV 103 D + E+ RS Y I+ DV+ I L + + D+++++ F ++ L L Sbjct: 442 DALAEMTKRSSYFQQIEEDVQKYAKSIEELKSSIHSFQTKDMKELLEFHSKVESILEKLT 501 Query: 102 DERAVLKHFE-WPEQKADALREA 37 DE VL FE +PE+K + +R A Sbjct: 502 DETQVLARFEGFPEKKLEVIRTA 524 [72][TOP] >UniRef100_Q1PEB4 Hydroxyproline-rich glycoprotein family protein n=1 Tax=Arabidopsis thaliana RepID=Q1PEB4_ARATH Length = 724 Score = 83.2 bits (204), Expect = 1e-14 Identities = 60/203 (29%), Positives = 91/203 (44%), Gaps = 31/203 (15%) Frame = -2 Query: 552 KSIPPPHPPPPPPLLHQPPPPPSVSKA-----------------------PPPPPPPPPP 442 +S PPP PP P PPPPP +SKA P PP PP Sbjct: 365 RSQPPPPPPSPEHKAPAPPPPPPMSKASESGEFCQFSKTHSTNGDNAPSMPAPPAPPGSG 424 Query: 441 KSLSIASAKVRRVPEVVEFYHSLM----RRDSTNSRRDSTGGGNAAAE---AILANSNAR 283 +SL A++K+RR ++ Y +L R + ++ G N+ AE +A S Sbjct: 425 RSLKKATSKLRRSAQIANLYWALKGKLEGRGVEGKTKKASKGQNSVAEKSPVKVARSGMA 484 Query: 282 DMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLV 103 D + E+ RS Y I+ DV+ I L + + D+++++ F ++ L L Sbjct: 485 DALAEMTKRSSYFQQIEEDVQKYAKSIEELKSSIHSFQTKDMKELLEFHSKVESILEKLT 544 Query: 102 DERAVLKHFE-WPEQKADALREA 37 DE VL FE +PE+K + +R A Sbjct: 545 DETQVLARFEGFPEKKLEVIRTA 567 [73][TOP] >UniRef100_A5BPY4 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BPY4_VITVI Length = 341 Score = 82.8 bits (203), Expect = 2e-14 Identities = 66/224 (29%), Positives = 94/224 (41%), Gaps = 49/224 (21%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQP-------PPPPSVSKAPPPPPP-------------PPPPK 439 P K+ P PPPPPPL P PPPP APPPPPP PPPP Sbjct: 15 PLKNGAAPSPPPPPPLPMMPLKGSVPPPPPPKNGAAPPPPPPPLPMMPLKGSVPAPPPPV 74 Query: 438 SLSIASA---------------------KVRRVPEVVEFYHSLMRR-DSTNSRRD-STGG 328 L +A +++R ++ Y L ++ + TN G Sbjct: 75 PLKNGAAPPLPPPLFGAAKNLGPKRPTTRLKRSAQMGNLYRVLKKKMEGTNQEGPIPEGR 134 Query: 327 GNAAAEAILANSNA-----RDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFS 163 + A + NSN D I EI +S Y I+ DV+ I + + N Sbjct: 135 SSQARRGLTGNSNGGKQGMADTIAEITKKSSYFQQIEKDVKKHAKSIMEVKGAITNFQTK 194 Query: 162 DIEDVVPFVKWLDDELSYLVDERAVLKHFE-WPEQKADALREAA 34 D+ +++ F K+++ L L+DE VL FE +P +K + LR AA Sbjct: 195 DMTELLKFHKYVESHLEDLIDEGQVLARFEGFPTKKLETLRTAA 238 [74][TOP] >UniRef100_B9GGH1 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9GGH1_POPTR Length = 182 Score = 82.4 bits (202), Expect = 2e-14 Identities = 40/51 (78%), Positives = 43/51 (84%) Frame = -2 Query: 159 IEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAAFCSFVLKDL 7 IEDVV FVKWLDDEL +LVDERAVLKHF+WPE+KAD LREAAF LK L Sbjct: 1 IEDVVAFVKWLDDELGFLVDERAVLKHFDWPEKKADTLREAAFGYSDLKKL 51 [75][TOP] >UniRef100_C4J3C3 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4J3C3_MAIZE Length = 355 Score = 81.3 bits (199), Expect = 5e-14 Identities = 50/105 (47%), Positives = 61/105 (58%), Gaps = 3/105 (2%) Frame = -2 Query: 540 PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI---ASAKVRRVPEVVEFYHSLM 370 P P PPP PPPPP K PPPPPPPP +L KV R PE+VEFY SLM Sbjct: 252 PRAPGAPPP----PPPPPG--KVGGPPPPPPPPGALPRNLGGGDKVHRAPEIVEFYQSLM 305 Query: 369 RRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAI 235 +R++ + T G+ ++ A SN MIGEIENRS +LLA+ Sbjct: 306 KREA----KRETSLGSISSNVSDARSN---MIGEIENRSTFLLAV 343 [76][TOP] >UniRef100_UPI0001984538 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984538 Length = 653 Score = 78.6 bits (192), Expect = 3e-13 Identities = 58/201 (28%), Positives = 93/201 (46%), Gaps = 27/201 (13%) Frame = -2 Query: 555 QKSIPPPHPPPPPPLLH------QPPPP--PSVSKAPPP----------PPPPPPPKSLS 430 +++ PP PP PP L PPPP PS PPP PPPPPP +++ Sbjct: 300 EQATAPPLPPSPPSNLPLNVTTAPPPPPILPSKGSVPPPLAPMPMTKGAAPPPPPPLAVA 359 Query: 429 ------IASAKVRRVPEVVEFYHSLMRR--DSTNSRRDSTGGGNAAAEAILANSNARDMI 274 A+ K++R + Y +L + S+ ++S G +A ++ D + Sbjct: 360 KALRPRKANNKLKRSTHMGNLYRTLKGKVEGSSLQGKNSQGRTSAIGDSAGGKQGMADAL 419 Query: 273 GEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDER 94 E+ RS Y I+ DV+ G I + + + D+++++ F K ++ L L DE Sbjct: 420 AEMTKRSAYFQQIEEDVQKHGKVIMEIKVAISSFQTKDMDELLKFQKHVEQHLEELTDET 479 Query: 93 AVLKHFE-WPEQKADALREAA 34 VL FE +P +K + LR AA Sbjct: 480 QVLARFEDFPMKKLETLRMAA 500 [77][TOP] >UniRef100_A3C7Q4 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3C7Q4_ORYSJ Length = 341 Score = 78.6 bits (192), Expect = 3e-13 Identities = 45/130 (34%), Positives = 66/130 (50%), Gaps = 5/130 (3%) Frame = -2 Query: 471 PPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANS 292 P PPPPPPPP + +S +SRR+ G A A + NS Sbjct: 97 PVPPPPPPPPNT----------------------NGNSKSSRRNQQGPSKATALVNMYNS 134 Query: 291 -----NARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWL 127 A ++GE++NRS +LLAIK DV+ + I LI ++ F+D++ V+ FV WL Sbjct: 135 FNTNIAASGIVGELQNRSTHLLAIKADVQAKAGLINHLIAKLQQITFADVDQVLTFVDWL 194 Query: 126 DDELSYLVDE 97 D +LS L+ + Sbjct: 195 DQQLSTLISK 204 [78][TOP] >UniRef100_A5AZ43 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AZ43_VITVI Length = 1452 Score = 78.2 bits (191), Expect = 4e-13 Identities = 58/201 (28%), Positives = 93/201 (46%), Gaps = 27/201 (13%) Frame = -2 Query: 555 QKSIPPPHPPPPPPLLH------QPPPP--PSVSKAPPP----------PPPPPPPKSLS 430 +++ PP PP PP L PPPP PS PPP PPPPPP +++ Sbjct: 558 EQATAPPLPPSPPSNLPLNVTTAPPPPPILPSKGSVPPPLAPMPMTKGAAPPPPPPLAVA 617 Query: 429 ------IASAKVRRVPEVVEFYHSLMRR--DSTNSRRDSTGGGNAAAEAILANSNARDMI 274 A+ K++R + Y +L + S+ ++S G +A ++ D + Sbjct: 618 KALRPRKANNKLKRSTHMGNLYRTLKGKVEGSSLQGKNSQGRTSAIGDSAGGKQGMADAL 677 Query: 273 GEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDER 94 E+ RS Y I+ DV+ G I + + + D+++++ F K ++ L L DE Sbjct: 678 AEMTKRSAYFQQIEEDVQKHGKVIXEIKVAISSFQTKDMDELLKFQKHVEQXLEELTDET 737 Query: 93 AVLKHFE-WPEQKADALREAA 34 VL FE +P +K + LR AA Sbjct: 738 QVLARFEDFPMKKLETLRMAA 758 [79][TOP] >UniRef100_Q9C946 Putative uncharacterized protein T7P1.21 n=1 Tax=Arabidopsis thaliana RepID=Q9C946_ARATH Length = 907 Score = 77.0 bits (188), Expect = 9e-13 Identities = 60/198 (30%), Positives = 89/198 (44%), Gaps = 30/198 (15%) Frame = -2 Query: 540 PPHPPPPPPLLH---QPPPPPSVSKA-----PPPPPP----------PPPP----KSL-- 433 PP PPPP PL + PPPPP ++ A PPPPPP PPPP +SL Sbjct: 590 PPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPPGAARSLRP 649 Query: 432 SIASAKVRRVPEVVEFYHSLMRRDSTNSRRDSTGGGN-----AAAEAILANSNARDMIGE 268 A+ K++R ++ Y L + TG G+ A + D + E Sbjct: 650 KKAATKLKRSTQLGNLYRILKGKVEGRDPNAKTGSGSGRKAGAGSAPAGGKQGMADALAE 709 Query: 267 IENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAV 88 I +S Y L I+ D+ I L E+ D+ +++ F + ++ L L DE V Sbjct: 710 ITKKSAYFLQIQADIAKYMTSINELKIEITKFQTKDMTELLSFHRRVESVLENLTDESQV 769 Query: 87 LKHFE-WPEQKADALREA 37 L E +P++K +A+R A Sbjct: 770 LARCEGFPQKKLEAMRMA 787 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/41 (56%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLL---HQPPPPPSVSKAPPPPPPPP 448 PP+ ++ PP PPPPP PPPPP APPPPPPPP Sbjct: 529 PPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 14/48 (29%) Frame = -2 Query: 543 PPPHPPPPPPL---------LHQPPPPP-----SVSKAPPPPPPPPPP 442 PPP PPPPPPL L PPP P ++S PPPPPPPPPP Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPP 464 Score = 55.5 bits (132), Expect = 3e-06 Identities = 22/40 (55%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PPP PPPP + PPPPP A PPPPPPPP Sbjct: 517 PTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 54.3 bits (129), Expect = 6e-06 Identities = 24/47 (51%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPP-PPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIA 424 P + S PPP PPPP P + PPPPP +A PPPPPPP + A Sbjct: 502 PLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAA 548 [80][TOP] >UniRef100_A2Q4Q2 Phosphoinositide-binding clathrin adaptor, N-terminal; Wiscott-Aldrich syndrome, C-terminal n=1 Tax=Medicago truncatula RepID=A2Q4Q2_MEDTR Length = 633 Score = 75.9 bits (185), Expect = 2e-12 Identities = 61/216 (28%), Positives = 95/216 (43%), Gaps = 40/216 (18%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVS------KAPPPPP------------------- 457 PP +PP P PP + PPPPP +S PPPPP Sbjct: 273 PPPPPLPPSTPQLPPVKIPPPPPPPPLSLGLSSVALPPPPPLSMKPGSTPAPAPPPPMLR 332 Query: 456 ------PPPPP----KSL-SIASAKVRRVPEVVEFYHSLMRR-DSTNSRRDSTGGGNAA- 316 PPPPP +SL + A+ K++R ++ Y +L + + ++ + S+ G N A Sbjct: 333 GNGGSAPPPPPLGAGRSLRARATTKLKRSTQLGNLYRTLKGKVEGSSLKGKSSSGRNTAI 392 Query: 315 -AEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPF 139 A+ D + E+ RS Y I+ DV+ I L + N ++ +++ F Sbjct: 393 GAKNTGGKQGMADALAEMTKRSSYFQQIEEDVQKYTKHIIELRSSITNFKTKEMTELIKF 452 Query: 138 VKWLDDELSYLVDERAVLKHFE-WPEQKADALREAA 34 K ++ L DE VL FE +P +K +A+R AA Sbjct: 453 HKEVESVFEKLTDESQVLSRFEGFPSKKLEAIRMAA 488 [81][TOP] >UniRef100_B9RW33 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RW33_RICCO Length = 584 Score = 72.0 bits (175), Expect = 3e-11 Identities = 53/192 (27%), Positives = 87/192 (45%), Gaps = 7/192 (3%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP---PKSL-SIASAKVRRVPEV 394 P ++PP P PP PP P++ PPPPPP K+L + K++R + Sbjct: 249 PSYGTVPPSTPAPPSRGSVSEPPIPTLQAKGAEPPPPPPLIEAKALRPKKNTKLKRSSNM 308 Query: 393 VEFYHSLMRR--DSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVE 220 Y L + S+ + + S GG ++ D + E+ RS Y I+ DV Sbjct: 309 ANLYRLLKGKVEGSSLNGKPSEGGRPQLGKSAGGKQGMADALAEMTKRSAYFQQIEEDVR 368 Query: 219 TQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFE-WPEQKADALR 43 I + + + D+ ++V F K ++ +L L DE VL FE +P +K ++LR Sbjct: 369 KHAKLIMEIKDAIKSFQTKDMAELVKFHKHVEQQLEKLTDETQVLVKFEGFPIKKLESLR 428 Query: 42 EAAFCSFVLKDL 7 AA L+++ Sbjct: 429 TAASLYLKLEEI 440 [82][TOP] >UniRef100_A5BHT2 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BHT2_VITVI Length = 201 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -2 Query: 159 IEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAA 34 +ED+V FV WLD+ELS L DERAVLKHF+WPE+KADA+REAA Sbjct: 1 MEDIVKFVDWLDNELSTLADERAVLKHFKWPEKKADAMREAA 42 [83][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 71.6 bits (174), Expect = 4e-11 Identities = 30/54 (55%), Positives = 31/54 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVP 400 PP PPP PPPPPP PPPPP PPPPPPPPPP+ I A R P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILPAPANRAP 58 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 [84][TOP] >UniRef100_B9RWE4 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RWE4_RICCO Length = 542 Score = 71.2 bits (173), Expect = 5e-11 Identities = 59/192 (30%), Positives = 86/192 (44%), Gaps = 16/192 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLL-HQPPPPPSVS----KAPPPPPPPPPPKSL--SIASAKVRRV 403 P Q +P P PPP PP+L + P SV PP PPPP P K L A K+ R Sbjct: 210 PAQSRLPLPPPPPSPPMLPAKGSIPASVPLKNYPGPPLPPPPGPGKFLPKKKAITKLNRS 269 Query: 402 PEVVEFYHSLMRR--------DSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVY 247 +++ + L + S N R+ GG + A + E+ RS Y Sbjct: 270 TQMLNLFRKLKDKMEGSSLAIKSANMRKLQLGGSTGGKAGLAAT------LAELTKRSPY 323 Query: 246 LLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLVDERAVLKHFE-W 70 + I+ DV+ I LI + + +D+ ++ F L+ L L DE VL FE + Sbjct: 324 VQQIEEDVQKYKKPILELIVAINSFQTNDMVKLLKFRNNLESVLGVLTDESQVLAKFEGF 383 Query: 69 PEQKADALREAA 34 P +K ++LR AA Sbjct: 384 PSKKLESLRAAA 395 [85][TOP] >UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019841A9 Length = 525 Score = 70.9 bits (172), Expect = 6e-11 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP P PPPP ++ PPPPP V PPPPPPPPPP Sbjct: 443 PPPPSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPP 482 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/48 (58%), Positives = 29/48 (60%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKSIPPPHP--------PPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP P PPPPP+ PPPPP S PPPPPPPPPP Sbjct: 437 PPVLSSPPP-PSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPP 483 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 6/46 (13%) Frame = -2 Query: 561 PPQKSIPPP---HPPPPPPLLHQPPPPPSVSKAPPPPPPP---PPP 442 PP S PPP PPPPPP+ PPPPP PPPPPPP PPP Sbjct: 450 PPSPSPPPPPVYSPPPPPPVYSPPPPPP-----PPPPPPPVXSPPP 490 [86][TOP] >UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PES6_VITVI Length = 486 Score = 70.9 bits (172), Expect = 6e-11 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP P PPPP ++ PPPPP V PPPPPPPPPP Sbjct: 443 PPPPSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPP 482 Score = 61.2 bits (147), Expect = 5e-08 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 8/51 (15%) Frame = -2 Query: 561 PPQKSIPPPHP--------PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP S PPP P PPPPP+ PPPPP S PPPPPPPPPP L Sbjct: 437 PPVLSSPPP-PSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPPPVL 486 [87][TOP] >UniRef100_UPI00016E10B6 UPI00016E10B6 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B6 Length = 1270 Score = 70.5 bits (171), Expect = 8e-11 Identities = 44/134 (32%), Positives = 61/134 (45%), Gaps = 4/134 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP----PPPPPKSLSIASAKVRRVPEV 394 PP PPP PPPPP LL PPPPP PPPPP PPPPP SA ++ V Sbjct: 683 PPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQKKKTV 742 Query: 393 VEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQ 214 F+ L + D+ R G A+ + + + + + E+++ L K ET+ Sbjct: 743 KLFWRELRQADAPQKCRFGRGTVWASLDKVTVDKARLEHL--FESKAKELPVSKKGPETK 800 Query: 213 GDFIRFLIKEVGNA 172 + L + NA Sbjct: 801 KSELLVLDPKRSNA 814 [88][TOP] >UniRef100_UPI00016E10B5 UPI00016E10B5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B5 Length = 1246 Score = 70.5 bits (171), Expect = 8e-11 Identities = 44/134 (32%), Positives = 61/134 (45%), Gaps = 4/134 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP----PPPPPKSLSIASAKVRRVPEV 394 PP PPP PPPPP LL PPPPP PPPPP PPPPP SA ++ V Sbjct: 659 PPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQKKKTV 718 Query: 393 VEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQ 214 F+ L + D+ R G A+ + + + + + E+++ L K ET+ Sbjct: 719 KLFWRELRQADAPQKCRFGRGTVWASLDKVTVDKARLEHL--FESKAKELPVSKKGPETK 776 Query: 213 GDFIRFLIKEVGNA 172 + L + NA Sbjct: 777 KSELLVLDPKRSNA 790 Score = 57.0 bits (136), Expect = 1e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + P PPPPP PPPPP A PPPPPPPPP Sbjct: 648 PPGAGLGAPPAPPPPPPPPPPPPPPPALLASPPPPPPPPP 687 [89][TOP] >UniRef100_UPI00016E10B4 UPI00016E10B4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B4 Length = 1323 Score = 70.5 bits (171), Expect = 8e-11 Identities = 44/134 (32%), Positives = 61/134 (45%), Gaps = 4/134 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP----PPPPPKSLSIASAKVRRVPEV 394 PP PPP PPPPP LL PPPPP PPPPP PPPPP SA ++ V Sbjct: 736 PPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQKKKTV 795 Query: 393 VEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQ 214 F+ L + D+ R G A+ + + + + + E+++ L K ET+ Sbjct: 796 KLFWRELRQADAPQKCRFGRGTVWASLDKVTVDKARLEHL--FESKAKELPVSKKGPETK 853 Query: 213 GDFIRFLIKEVGNA 172 + L + NA Sbjct: 854 KSELLVLDPKRSNA 867 Score = 57.0 bits (136), Expect = 1e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + P PPPPP PPPPP A PPPPPPPPP Sbjct: 725 PPGAGLGAPPAPPPPPPPPPPPPPPPALLASPPPPPPPPP 764 [90][TOP] >UniRef100_UPI00016E10A1 UPI00016E10A1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10A1 Length = 1396 Score = 70.5 bits (171), Expect = 8e-11 Identities = 44/134 (32%), Positives = 61/134 (45%), Gaps = 4/134 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP----PPPPPKSLSIASAKVRRVPEV 394 PP PPP PPPPP LL PPPPP PPPPP PPPPP SA ++ V Sbjct: 809 PPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAPSAPTQKKKTV 868 Query: 393 VEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQ 214 F+ L + D+ R G A+ + + + + + E+++ L K ET+ Sbjct: 869 KLFWRELRQADAPQKCRFGRGTVWASLDKVTVDKARLEHL--FESKAKELPVSKKGPETK 926 Query: 213 GDFIRFLIKEVGNA 172 + L + NA Sbjct: 927 KSELLVLDPKRSNA 940 [91][TOP] >UniRef100_A1CMR3 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus clavatus RepID=A1CMR3_ASPCL Length = 642 Score = 70.5 bits (171), Expect = 8e-11 Identities = 29/42 (69%), Positives = 30/42 (71%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPP--PPPSVSKAPPPPPPPPPP 442 PP SIPPP PPPPPP+ H PP PPP S PPPPPPPPP Sbjct: 487 PPSASIPPPPPPPPPPVSHVPPPRPPPPPSSGGPPPPPPPPP 528 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSK----APPPPPPPPP 445 PP +PPP PPPPP PPPPP APPPPPPPPP Sbjct: 501 PPVSHVPPPRPPPPPSSGGPPPPPPPPPAPGGFAPPPPPPPPP 543 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKA--PPPPPPPPPPKSLSI 427 P + I P PPPP P +P PPP + A PPPPPPPPPP S SI Sbjct: 446 PARNPISSPPPPPPVPAASRPIPPPPAASAVPPPPPPPPPPPPSASI 492 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQ------PPPPPSVSKAPPPPPPPPP 445 P ++PPP PPPPPP PPPPP VS PPP PPPPP Sbjct: 471 PAASAVPPPPPPPPPPPPSASIPPPPPPPPPPVSHVPPPRPPPPP 515 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Frame = -2 Query: 552 KSIPPPH-----PPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 + IPPP PPPPPP PPPPP + PPPPPPPPPP S Sbjct: 465 RPIPPPPAASAVPPPPPP----PPPPPPSASIPPPPPPPPPPVS 504 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PP PPPP PPPPPS S PPPPPPPPP Sbjct: 470 PPAASAVPPPPPPP------PPPPPSASIPPPPPPPPPP 502 [92][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 69.3 bits (168), Expect = 2e-10 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + PPP PPPPPP + PPPPP+ PPPPPPPPPP Sbjct: 111 PPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPP 150 Score = 69.3 bits (168), Expect = 2e-10 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP + PPPPP+ PPPPPPPPPP Sbjct: 134 PPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 173 Score = 69.3 bits (168), Expect = 2e-10 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP + PPPPP+ PPPPPPPPPP Sbjct: 157 PPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 196 Score = 69.3 bits (168), Expect = 2e-10 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP + PPPPP+ PPPPPPPPPP Sbjct: 180 PPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 219 Score = 69.3 bits (168), Expect = 2e-10 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP + PPPPP+ PPPPPPPPPP Sbjct: 203 PPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 242 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPPPP + PPPPP+ PPPPPPPPP Sbjct: 241 PPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPP 279 Score = 64.7 bits (156), Expect = 5e-09 Identities = 26/43 (60%), Positives = 30/43 (69%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHP---PPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + PPP P PPPPP + PPPPP+ + PPPPPPPPPP Sbjct: 85 PPVYAPPPPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPP 127 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = -2 Query: 561 PPQKSIPPPH----PPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP + PPPPP+ PPPPPPPPP Sbjct: 296 PPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPP 339 Score = 61.6 bits (148), Expect = 4e-08 Identities = 24/37 (64%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPP---PPPP 442 PPP PPPPPP + PPPPP+ PPPPPP PPPP Sbjct: 287 PPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPP 323 Score = 61.6 bits (148), Expect = 4e-08 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP----PPPPPPK 439 PP P P PPPPPP + PPPPP PPPP PPPPPPK Sbjct: 323 PPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPK 367 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/53 (49%), Positives = 28/53 (52%), Gaps = 13/53 (24%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPP-------------PPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP + PP PPP + PPPPPPPPPP Sbjct: 226 PPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPP 278 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/46 (56%), Positives = 29/46 (63%), Gaps = 6/46 (13%) Frame = -2 Query: 561 PPQKSIPPP--HPPPPPPLLHQPPPPPSVSKAPPP----PPPPPPP 442 PP + PPP PPPPPP PPPPP+ + PPP PPPPPPP Sbjct: 78 PPAYAPPPPVYAPPPPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPP 123 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/52 (51%), Positives = 29/52 (55%), Gaps = 12/52 (23%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH---------QPPPPPSVSKAPPP---PPPPPPP 442 PP PPP PPPPPP + PPPPP+ S PPP PPPPPPP Sbjct: 264 PPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPP 315 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -2 Query: 561 PPQKSIPPPH---PPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPP PPPPPP PPPPP+ S PPPPPPPPP Sbjct: 218 PPAYGPPPPPAYGPPPPPP---PPPPPPAYSPPPPPPPPPPP 256 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/46 (54%), Positives = 27/46 (58%), Gaps = 6/46 (13%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP------PPPPP 442 PP PP + PPPPP PPPPP + APPPPP PPPPP Sbjct: 290 PPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPP 335 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/44 (54%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLL----HQPPPPPSVSKAPPPPPPPPPP 442 PP PP + PPPPP PPPPP + +PPPPPPPPPP Sbjct: 212 PPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPP 255 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 6/46 (13%) Frame = -2 Query: 561 PPQKSIPPPH---PPPPPPLLHQPPPPPSVSKAPPP---PPPPPPP 442 PP + PPP PPPPPP PPPPPS PPP PPPPPPP Sbjct: 103 PPAYAPPPPPAYAPPPPPP---PPPPPPSYGPPPPPAYGPPPPPPP 145 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/55 (49%), Positives = 29/55 (52%), Gaps = 12/55 (21%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAP--------PPPPPPPPPKSL 433 PP + PPP P PPPPP PPPPP S AP PPPPPP P + L Sbjct: 338 PPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVVYGPPAPPPPPPAPKRKL 392 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 14/54 (25%) Frame = -2 Query: 561 PPQKSIPPPHPP---PPPPLLHQPPPPPSVSKAPP-----------PPPPPPPP 442 PP PPP PP PPPP + PPPPP PP PPPPPPPP Sbjct: 93 PPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPP 146 Score = 54.3 bits (129), Expect = 6e-06 Identities = 24/54 (44%), Positives = 26/54 (48%), Gaps = 14/54 (25%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP--------------PPPPP 442 PP PP + PPPPP + PPPPP PPPPP PPPPP Sbjct: 332 PPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVVYGPPAPPPPP 385 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 14/54 (25%) Frame = -2 Query: 561 PPQKSIPPPHPP---PPPPLLHQPPPPPSVSKAPP-----------PPPPPPPP 442 PP PPP PP PPPP + PPPPP PP PPPPPPPP Sbjct: 116 PPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPP 169 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 14/54 (25%) Frame = -2 Query: 561 PPQKSIPPPHPP---PPPPLLHQPPPPPSVSKAPP-----------PPPPPPPP 442 PP PPP PP PPPP + PPPPP PP PPPPPPPP Sbjct: 139 PPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPP 192 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 14/54 (25%) Frame = -2 Query: 561 PPQKSIPPPHPP---PPPPLLHQPPPPPSVSKAPP-----------PPPPPPPP 442 PP PPP PP PPPP + PPPPP PP PPPPPPPP Sbjct: 162 PPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPP 215 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 14/54 (25%) Frame = -2 Query: 561 PPQKSIPPPHPP---PPPPLLHQPPPPPSVSKAPP-----------PPPPPPPP 442 PP PPP PP PPPP + PPPPP PP PPPPPPPP Sbjct: 185 PPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPP 238 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 7/47 (14%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPL----LHQPPPPPSVSKAPPPPPP---PPPP 442 PP PP + PPPPP PPPPP + APPPPPP PPPP Sbjct: 309 PPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPP 355 [93][TOP] >UniRef100_A7R148 Chromosome undetermined scaffold_337, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R148_VITVI Length = 303 Score = 69.3 bits (168), Expect = 2e-10 Identities = 48/163 (29%), Positives = 76/163 (46%), Gaps = 7/163 (4%) Frame = -2 Query: 501 PPPPPSVSKAPPPPPPPPPPKSLSI----ASAKVRRVPEVVEFYHSLMRR--DSTNSRRD 340 PPPPP + PPPPPP + ++ A+ K++R ++ Y L + S+ + Sbjct: 10 PPPPPMLLTKGGAPPPPPPGGAKNLRPRKAATKLKRSTQMGNLYRVLKGKVEGSSLQGQS 69 Query: 339 STGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSD 160 S G A + D + E+ RS Y I+ DV+ I L + + D Sbjct: 70 SNGRKGLAGSSAGGKQGMADALAEMTKRSAYFQQIEEDVQKHAKSIMELKAAISSFQTKD 129 Query: 159 IEDVVPFVKWLDDELSYLVDERAVLKHFE-WPEQKADALREAA 34 + +++ F K ++ L L DE VL FE +P +K +ALR AA Sbjct: 130 MNEMLKFHKHVESCLEELTDESQVLARFEGFPTKKLEALRMAA 172 [94][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 69.3 bits (168), Expect = 2e-10 Identities = 29/53 (54%), Positives = 31/53 (58%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRV 403 PP PPP PPPPPP PPPPP PPPPPPPPPP L K R++ Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLCCFGRKSRKL 94 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 [95][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPP+ APPPPPPPPPP S Sbjct: 1415 PPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPIS 1456 Score = 65.5 bits (158), Expect = 3e-09 Identities = 29/68 (42%), Positives = 36/68 (52%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PP PPP PPPPPP PPPPP + P PPPPPPPP +S + V Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTGLFPTVATTFNQT 1472 Query: 381 HSLMRRDS 358 ++ +R D+ Sbjct: 1473 NAAIRLDN 1480 Score = 64.3 bits (155), Expect = 6e-09 Identities = 27/47 (57%), Positives = 28/47 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIAS 421 PP PPP PPPPPP PPPPP PPP PPPPPP I+S Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISS 1457 Score = 61.2 bits (147), Expect = 5e-08 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PPP PPPPPP PPPPP PPPPPPP PP Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PPP PPPPPP PPPPP PPPPPP PPP Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 [96][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPPL PPPPP PPPPPPPPPP Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 67.8 bits (164), Expect = 5e-10 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP + +PPPPPPPPPP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 67.4 bits (163), Expect = 7e-10 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP P PPPPL PPPPP PPPPPPPPPP Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 67.4 bits (163), Expect = 7e-10 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP PPPPPP PPPPP PPPPPPPPPP L Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 675 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP L PPPP PPPPPPPPPP Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 63.9 bits (154), Expect = 8e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPP S PPPPPPPPPP Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 63.9 bits (154), Expect = 8e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PP PPS PPPPPPPPPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPP PPPPPPPP P S Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PP PPPPPPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP P PPPPPPPP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPP Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PP PPP PPPP PPPPPPPPPP Sbjct: 211 PPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPP 250 Score = 60.1 bits (144), Expect = 1e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP +PP PPPPPP PPPPP PPPPPP PPP S Sbjct: 670 PPPPPLPPSPPPPPPP---PPPPPPPPPPPPPPPPPHPPPPS 708 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 10/44 (22%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPP----------PSVSKAPPPPPPPPPP 442 PPP PPPPPPL PPPP P + PPPPPPPPPP Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPP 253 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 561 PPQKSIPPPHP-PPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP P PP PP PPPPPS PPPPPPPPP Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPP 249 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S PPP PPPPPP PPPP PPPPPPPPPP Sbjct: 219 PLPPSPPPPSPPPPPP----SPPPPLPPPPPPPPPPPPPP 254 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 P S PPP PPPPPP PPPPP PPP PPPP P L Sbjct: 674 PLPPSPPPPPPPPPPP----PPPPPPPPPPPPPHPPPPSPPPL 712 [97][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 68.6 bits (166), Expect = 3e-10 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPP +PPPPPPPPPP S Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 252 Score = 67.4 bits (163), Expect = 7e-10 Identities = 30/46 (65%), Positives = 30/46 (65%), Gaps = 4/46 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPP----PPPPPPPKS 436 PP S PPP PPPPPP PPPPPS S PPP PPPPPPP S Sbjct: 236 PPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPS 281 Score = 65.1 bits (157), Expect = 4e-09 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PPP PPPPPP PPPPP +PPPPPPPPPP S Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 240 Score = 64.3 bits (155), Expect = 6e-09 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP +PPPPPPPP P Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP P P PPPPPP PPPPPS S PPPPPP PPP Sbjct: 245 PPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPP 284 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP-----PPPPPKSLS 430 PP S PPP PPPPPP PPPPP PPPPP PPPPP S S Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPS 272 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPP S +PPPPPPPP P Sbjct: 243 PPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSP 282 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPPS PPPPPPP PP Sbjct: 207 PPPPPPPPPSPPPPPP----PPPPPSPPPPPPPPPPPSPP 242 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPPS PPPPPPP PP Sbjct: 219 PPPPPPPPPSPPPPPP----PPPPPSPPPPPPPPPPPSPP 254 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PQ PPP PPPP P PPPPP PPPPPPPP P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP P P PPPPPP PPPPP PP PPP PPP Sbjct: 254 PPPPPPPSPSPPPPPPSPSPPPPPP-----PPSPPPAPPP 288 [98][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 68.6 bits (166), Expect = 3e-10 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PPPPPP PPPPPS PPP PPPPPP S Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 459 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPP S PPPPP PPPP Sbjct: 263 PPPPSPPPPSPPPPPP--PSPPPPPPPSPPPPPPPSPPPP 300 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPP S PPPPP PPPP Sbjct: 320 PPPPSPPPPSPPPPPP--PSPPPPPPPSPPPPPPPSPPPP 357 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPP S PPPPP PPPP Sbjct: 364 PPPPSPPPPSPPPPPP--PSPPPPPPPSPPPPPPPSPPPP 401 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPP S PPPPP PPPP Sbjct: 478 PPPPSPPPPSPPPPPP--PSPPPPPPPSPPPPPPPSPPPP 515 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PP PP S PPPPP PPPP Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 266 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PP PP S PPPPP PPPP Sbjct: 245 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 284 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PP PP S PP PPPPPPP Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPP 336 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPP S PPPPP PPPP Sbjct: 310 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 349 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPP S PPPPP PPPP Sbjct: 354 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 393 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPP S PPPPP PPPP Sbjct: 408 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 447 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPP S PPPPP PPPP Sbjct: 468 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 507 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PPP PPPPPP PPPPPS PPP PPPPPP S Sbjct: 432 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 467 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PPPP P PPPPPS PPP PPPPPP S Sbjct: 258 PPPPSPPPPSPPPPSP---PPPPPPSPPPPPPPSPPPPPPPS 296 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PPPP PPPPP S PPPPP PPPP Sbjct: 432 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 471 Score = 61.2 bits (147), Expect = 5e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPP S PP PPPP PP Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 256 Score = 61.2 bits (147), Expect = 5e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPP S PP PPPP PP Sbjct: 517 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 556 Score = 60.8 bits (146), Expect = 7e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PP PP S PP PPPPPPP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 261 Score = 60.8 bits (146), Expect = 7e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PP PP S PP PPPPPPP Sbjct: 240 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 279 Score = 60.8 bits (146), Expect = 7e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PP PP S PPPPP PPPP Sbjct: 302 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 341 Score = 60.8 bits (146), Expect = 7e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PP PP S PP PPPPPPP Sbjct: 341 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 380 Score = 60.8 bits (146), Expect = 7e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PP PP S PP PPPPPPP Sbjct: 455 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 494 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP +PPPP PPPPP Sbjct: 202 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP +PPPPPPP PP Sbjct: 207 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 246 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP +PPPP PPPPP Sbjct: 393 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 432 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP +PPPPPPP PP Sbjct: 398 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 437 Score = 60.1 bits (144), Expect = 1e-07 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PP PPP PPPP PPPPPP PPP S Sbjct: 431 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 472 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP +PPPPPPP PP Sbjct: 507 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 546 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPPS PPPP PPPP Sbjct: 277 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 310 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PP PP S PPPPP PPPP Sbjct: 285 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPPS PPPP PPPP Sbjct: 334 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP PP PPPPPPP Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 388 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPPS PPPP PPPP Sbjct: 378 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 411 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP PP PPPPPPP Sbjct: 403 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 442 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PPPP PPPPP S PP PPPP PP Sbjct: 440 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 479 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPPS PPPP PPPP Sbjct: 448 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 481 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP PP PPPPPPP Sbjct: 463 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 502 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPPS PPPP PPPP Sbjct: 492 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 525 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPP PPP P PPPPPP PPP S Sbjct: 278 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPS 319 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPP PP PPP P PPP PPPPPP S Sbjct: 340 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 381 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPP PP PPP P PPP PPPPPP S Sbjct: 454 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 495 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPPS PPPP PPPP Sbjct: 292 PPPPSPPPPSPPPPSP---PPPPPPSPPPPSPPPPSPPPP 328 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPP--PPPPPPPKS 436 PPP PPPPPP PPPPPS PPP PPP PPP S Sbjct: 440 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 477 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPPS PPPP PPPP Sbjct: 522 PPPPSPPPPSPPPPSP---PPPPPPSPPPPSPPPPSPPPP 558 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/48 (54%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP------PPPPPPKS 436 PP S PPP PPPP P PPPP +PPPP PPPPPP S Sbjct: 197 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 244 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PP PP S PP PPPP PP Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 424 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PP PP S PP PPPP PP Sbjct: 499 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 538 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPP P PPPP +PPPP PPPP Sbjct: 192 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 230 Score = 57.4 bits (137), Expect = 7e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PPPPS PPPP PPPP Sbjct: 447 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 486 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP PP PPPP PP Sbjct: 212 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 251 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP PP PPPP PP Sbjct: 512 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 551 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PP PP PPPP PPPP Sbjct: 284 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 323 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PPPP PPP PPPP P Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 478 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPP PPP P PPP PPPP P Sbjct: 335 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 374 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPP PPP P PPP PPPP P Sbjct: 379 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 418 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PP PPP P PPP PPPP P Sbjct: 384 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 423 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPP PPP P PPP PPPP P Sbjct: 449 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 488 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPP PPP P PPP PPPP P Sbjct: 493 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 532 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PP PPP P PPP PPPP P Sbjct: 498 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 537 [99][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 68.6 bits (166), Expect = 3e-10 Identities = 30/58 (51%), Positives = 33/58 (56%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVE 388 PP PPP PPPPPP PPPPP PPPPPPPPPP S + +R + VE Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVDAVE 77 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 63.2 bits (152), Expect = 1e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -2 Query: 552 KSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 + PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 14 RETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 [100][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 67.0 bits (162), Expect(2) = 3e-10 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PP PPPP PL PPPPP S PPPPPPPPPP Sbjct: 239 PPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPP 278 Score = 21.6 bits (44), Expect(2) = 3e-10 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 Query: 362 TPQTREEIPPAVETPPRKQY 303 TP + PPA PPR + Sbjct: 300 TPARKRPPPPAPPPPPRSDF 319 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/44 (63%), Positives = 28/44 (63%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS 430 PP S PP PPPPPP PPPPP PPPPPPPPPP S S Sbjct: 249 PPPPSPLPPSPPPPPPPSPPPPPPP-----PPPPPPPPPPPSPS 287 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/58 (51%), Positives = 31/58 (53%), Gaps = 16/58 (27%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVS----------------KAPPPPPPPPPPKS 436 PP S PPP PPPPPP PPPPPS S K PPPP PPPPP+S Sbjct: 262 PPPPSPPPPPPPPPPP--PPPPPPPSPSPPPPELPPAQPVTPARKRPPPPAPPPPPRS 317 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPP-PLLHQPPPPPSVSKAPPPPPPPPPP 442 PP P P PPPPP P PPPP + +PPPPPPP PP Sbjct: 228 PPSPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPP 268 Score = 55.5 bits (132), Expect = 3e-06 Identities = 32/89 (35%), Positives = 41/89 (46%), Gaps = 9/89 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK---SLSIASAKVRRVPEV- 394 PP PPP PPPPP PPPPP PPP P PPPP+ + + A+ R P Sbjct: 256 PPSPPPPPPPSPPPPP----PPPPPPPPPPPPPSPSPPPPELPPAQPVTPARKRPPPPAP 311 Query: 393 -----VEFYHSLMRRDSTNSRRDSTGGGN 322 +F +R++ SR +T N Sbjct: 312 PPPPRSDFPFCQCQRNARGSRLMTTASNN 340 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S PP P PPPP PP PP S PP PPPPPPP Sbjct: 226 PQPPSPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPP 265 [101][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 68.2 bits (165), Expect = 4e-10 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPPS PPPPPPPPPP Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 67.0 bits (162), Expect = 9e-10 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVP 400 PP PPP PPPPPP PPPPP PPPPPPPPPP I + +P Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRPEIP 548 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 + PP PPPPPP PPPPPS PPP PPPPPP Sbjct: 484 VSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 54.7 bits (130), Expect = 5e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PPP PPPPPP PPPPP PPP PPPPPP S Sbjct: 486 PPPPPPPPPP----PPPPP-----PPPSPPPPPPPS 512 [102][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 68.2 bits (165), Expect = 4e-10 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PPPPPP PPPPPS PPP PPPPPP S Sbjct: 250 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPS 291 Score = 65.5 bits (158), Expect = 3e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PPPPPP PP PP S PPPPP PPPP S Sbjct: 302 PPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPS 343 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPP S PPPPP PPPP Sbjct: 240 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 279 Score = 63.9 bits (154), Expect = 8e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPP S PPPPP PPPP Sbjct: 352 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 391 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPP PPPP PPPP Sbjct: 362 PPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPP 401 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPP PPPP PPPP Sbjct: 393 PPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPP 432 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PPPPP S PPPPP PPPP Sbjct: 383 PPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 422 Score = 61.6 bits (148), Expect = 4e-08 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PPPPPP PPPPPS PPPPPP PPP S Sbjct: 320 PPPPSPPPPSPPPPPP--PSPPPPPS---PPPPPPPRPPPPS 356 Score = 60.5 bits (145), Expect = 9e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PP PP S PP PPPPPPP Sbjct: 297 PPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPP 336 Score = 60.5 bits (145), Expect = 9e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PP PP S PP PPPPPPP Sbjct: 339 PPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPP 378 Score = 60.5 bits (145), Expect = 9e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PP PP S PPPPP PPPP Sbjct: 375 PPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPP 414 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP +PPPP PPPPP Sbjct: 225 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 264 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP +PPPPPPP PP Sbjct: 230 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 269 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PPPP +PPPPP S PP PPPP PP Sbjct: 264 PPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPP 303 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PP PPP PP PP S PP PPPPPPP+ Sbjct: 279 PPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPR 319 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PP PPP PPPPP P PPPP PPP S Sbjct: 325 PPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPS 366 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PP PP S PP PPPP PP Sbjct: 334 PPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPP 373 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP PP PPPPPPP Sbjct: 235 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 274 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPPS PPPP PPPP Sbjct: 272 PPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP 305 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPP PP PPPP PP Sbjct: 292 PPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPP 331 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPP PP PPP P PPP PPPPPP S Sbjct: 338 PPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPS 379 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PP PP S PPPPP PPPP Sbjct: 287 PPPPSPPPPSPPPPSP---PPPSPPPPSPPPPPPPRPPPP 323 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPPPS PPP PPPP P Sbjct: 388 PPPPSPPPPSPPPPSP---PPPPPPSPPPPPPPRPPPPSP 424 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/48 (54%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP------PPPPPPKS 436 PP S PPP PPPP P PPPP +PPPP PPPPPP S Sbjct: 220 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 267 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPP P PPPP +PPPP PPPP Sbjct: 190 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 228 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPP P PPPP +PPPP PPPP Sbjct: 195 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 233 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPP P PPPP +PPPP PPPP Sbjct: 200 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 238 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPP P PPPP +PPPP PPPP Sbjct: 205 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 243 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPP P PPPP +PPPP PPPP Sbjct: 210 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 248 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPP P PPPP +PPPP PPPP Sbjct: 215 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 253 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PP PPP P PPP PPPPPP Sbjct: 278 PPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 317 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PP PPP P PPPPPP PPP Sbjct: 374 PPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPP 413 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PPPPS PPPP PPPP Sbjct: 271 PPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPP 310 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPP PPPP P PPPPPS P PPPPPPP Sbjct: 315 PPPPRPPPPSPPPPSP---PPPPPPSPPPPPSPPPPPPP 350 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPP PPP P PPP PPPP P Sbjct: 333 PPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSP 372 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PP PP S PPPPP PPPP Sbjct: 347 PPPPRPPPPSPPPPSP---PPPSPPPPSPPPPPPPSPPPP 383 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PP PP S PP PPPP PP Sbjct: 407 PPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPP 440 Score = 54.3 bits (129), Expect = 6e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPP PPP P PPP PPPP P Sbjct: 273 PPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 312 [103][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 68.2 bits (165), Expect = 4e-10 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP S PPPPPPPPPP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 64.7 bits (156), Expect = 5e-09 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPP PP PPPPP PPPPPPPPPP S Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPS 276 Score = 63.9 bits (154), Expect = 8e-09 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPS +PPPPPPPPPP Sbjct: 228 PPPPPSPPPSPPPPPP-----PPPPSPPPSPPPPPPPPPP 262 Score = 63.9 bits (154), Expect = 8e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 267 PPPPPPPPPSPPPPPP----PPPPPPPPPPPPPPPPPPPP 302 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PPPPP PPPPPPPPPP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPP PPPPPP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPP P PPPPPPPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PP PP PPPPPPPPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP P PPP PPPPPPPPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPP PPPPPPPPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPP PPPPP PPPPPPPPPP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PPPPP PPPPPPPPPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PP PPPPPP PPP P PPPPPPPPPP Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP P P PPPPPP PP PP PPPPPPPPPP Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PP PPPPPP P PPP PPPPPPPPPP Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P PPP PPPPPP PPPP PPPPPPPPPP Sbjct: 232 PSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 60.1 bits (144), Expect = 1e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S PPP PP PPP PPPPP S P PPPPPPPP Sbjct: 221 PLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPP 260 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PP PP PP PPPPPS +PPPPPPPPPP Sbjct: 213 PLPNAPPSPLPPSPP----PPPPPSPPPSPPPPPPPPPP 247 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP P P PPPPP PPPPP PPP PPPPP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPP 257 [104][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 68.2 bits (165), Expect = 4e-10 Identities = 30/58 (51%), Positives = 34/58 (58%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVE 388 PP PPP PPPPPP PPPPP PPPPPPPPPP S + K +P ++E Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPS----THKSMSIPTLIE 542 Score = 67.0 bits (162), Expect = 9e-10 Identities = 30/50 (60%), Positives = 31/50 (62%), Gaps = 5/50 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP-----KSLSI 427 PP PPP PPPPPP PPPPP PPPPPPPPPP KS+SI Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSI 537 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 S PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 487 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 [105][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 68.2 bits (165), Expect = 4e-10 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPP PPPPPPPPPPK+ Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKT 46 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/54 (51%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPP--PPKSLSIASAKVRR 406 PP PPP PPPPPP PPPPP PPPPPPPP P +++ A +RR Sbjct: 16 PPPPPPPPPPPPPPPP----PPPPP-----PPPPPPPPKTPRTTVAFPPAPLRR 60 [106][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 67.8 bits (164), Expect = 5e-10 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P++ IPPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 19 PERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 67.8 bits (164), Expect = 5e-10 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 62 PPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 67.4 bits (163), Expect = 7e-10 Identities = 26/41 (63%), Positives = 28/41 (68%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP+ PPP PPPPPP PPPPP PPPPPPPPPP+ Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP PPPPPPPPPP+ Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPP 77 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPP 79 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPP 88 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPP 87 Score = 64.7 bits (156), Expect = 5e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPP 78 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP + PPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPP 76 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPP PPPPP PPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPP 89 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PPPPP PPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPP PPPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPP 80 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP +P PPP PPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPP 85 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPP PPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPP 86 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PPPP PPPPP PPPPPPPPPP Sbjct: 56 PPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPP P PPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPP 81 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP P PPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPP 75 Score = 60.5 bits (145), Expect = 9e-08 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP---PPPPPP 442 PP PPP PPPPPP PPPPP PPPP PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPP 73 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP-----PPPPPPK 439 PP PPP PPPPPP PPPPP PPPP PPP PPK Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPK 121 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPP P Sbjct: 74 PPPPPPPPPPPPPPPP----PPPPP-----PPPPPPPPRP 104 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PP P PPPPP Sbjct: 75 PPPPPPPPPPPPPPPP----PPPPPPPPPPPPRPCPPPPP 110 [107][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP +PPP PPPPPP PPPPP S PPPPPPPPPP L Sbjct: 241 PPPPPMPPPPPPPPPP---PPPPPPPPSPPPPPPPPPPPPPPL 280 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = -2 Query: 561 PPQKSIPP----PHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PP P P PPPP + PPPPP PPPPPPPPPP S Sbjct: 225 PPSASSPPSSPSPSPRPPPPPMPPPPPPP-----PPPPPPPPPPPS 265 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PPP PPPPPP PPPPP P PPPPPPPP Sbjct: 237 PSPRPPPPPMPPPPPP---PPPPPPPPPPPPSPPPPPPPP 273 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP P P PPPPP PPPPP PPPP PPPPP Sbjct: 231 PPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPP 270 Score = 57.4 bits (137), Expect = 7e-07 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPP--PP 442 PP PPP PPPPPP PPPPP PPPPPPPP PP Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPP-----PPPPPPPPLLPP 283 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPP PP PS S PPPPP PPPP Sbjct: 217 PPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPP 250 [108][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 67.8 bits (164), Expect = 5e-10 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP +PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 28 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 29 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 65.1 bits (157), Expect = 4e-09 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PP PPP PPPPPP PPPPP PPPPPPPPPP ++ + Sbjct: 34 PPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPNNIVV 74 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 22 PPPPPPPPPLPPPPPP----PPPPPPPPPPPPPPPPPPPP 57 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPP PPPPP PPPPPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PPPPP PPPPPPPPPP Sbjct: 17 PPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 56 [109][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 67.8 bits (164), Expect = 5e-10 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPP PPPPPPPPPP+S Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQS 57 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 [110][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 67.8 bits (164), Expect = 5e-10 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIA 424 PP PPP PPPPPP PPPPP PPPPPPPPPP L+++ Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMS 46 [111][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/40 (70%), Positives = 28/40 (70%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPPS PPPPPPPPPP Sbjct: 255 PPSPSPPPPPPPPPPP---PPPPPPSPPPPPPPPPPPPPP 291 Score = 66.2 bits (160), Expect = 2e-09 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP S PPPPPPPPPP Sbjct: 254 PPPSPSPPPPPPPPPP----PPPPPPPSPPPPPPPPPPPP 289 Score = 63.9 bits (154), Expect = 8e-09 Identities = 28/44 (63%), Positives = 28/44 (63%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS 430 PP PPP PPPPPP PPPPP PPPPPPPPPP S S Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPP-----PPPPPPPPPPPSPS 298 Score = 58.5 bits (140), Expect = 3e-07 Identities = 28/52 (53%), Positives = 30/52 (57%), Gaps = 5/52 (9%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPS-----VSKAPPPPPPPPPPKSLSIAS 421 PP S PPP PPPPPP PPP PS S +PP PPPP PP L A+ Sbjct: 273 PPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPPSVLPAAT 324 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P P P PP PPP PPPPP PPPPPPPPPP S Sbjct: 241 PPSPPPSPRPPSPPPPSPSPPPPPP----PPPPPPPPPPPS 277 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S PP PPPP P PPPPP PPPP PPPPP Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPP 282 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S PPP P PPPP PPPPP PPP PPPPPP Sbjct: 248 PRPPSPPPPSPSPPPP----PPPPPPPPPPPPPSPPPPPP 283 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S PP PPP P PPP PS PPPPPPPPPP Sbjct: 235 PTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPP 273 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/54 (48%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAP------PPPPPPPPPKSLSIASA 418 PP PP PPPPPP PPPPP S +P P PP PPPP S+ A Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPPSVLPA 322 [112][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 67.4 bits (163), Expect = 7e-10 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 278 PPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPP 317 Score = 61.6 bits (148), Expect = 4e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPP PPP Sbjct: 258 PPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPP 297 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPP PPPPP PPPPP PPPPPPPPP Sbjct: 289 PPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPP 327 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQ--------PPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 267 PPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPP 314 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPP PPP Sbjct: 295 PPPPPPPPPCPPPPPP---PPPPPPPCPPPPPPPPPCPPP 331 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPP PPPPPP PP PP PPPPPPPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPP 303 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPP PPP PP PPPPP PPPPPPPPP Sbjct: 244 PPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPP 282 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PP PPPPP PPPPPPPPPP Sbjct: 248 PPPPPCPPPCPPPCPPPPPPPPPPP-----PPPPPPPPPP 282 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPP PPP PP Sbjct: 299 PPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPP 338 Score = 58.2 bits (139), Expect = 4e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP P PPP PPPPPPPP P Sbjct: 266 PPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCP 305 Score = 57.4 bits (137), Expect = 7e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PPPPP PPPPPPPP P Sbjct: 290 PPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCP 329 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PP PPP PPP Sbjct: 300 PPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPP 339 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSV-----SKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPP PPPPPP Sbjct: 302 PPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPP 346 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPP--PPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPP PP PPPPPP PPP Sbjct: 309 PPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCPPP 350 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P PPP PPPPPP PPP PPPPPPPPPP Sbjct: 237 PCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPP 276 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PP PPPP PPPP PPPPP Sbjct: 323 PPPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPPCPPPPP 362 [113][TOP] >UniRef100_Q212G2 Peptidase C14, caspase catalytic subunit p20 n=1 Tax=Rhodopseudomonas palustris BisB18 RepID=Q212G2_RHOPB Length = 1026 Score = 67.4 bits (163), Expect = 7e-10 Identities = 29/46 (63%), Positives = 33/46 (71%), Gaps = 6/46 (13%) Frame = -2 Query: 561 PPQKSIPPPHP-----PPPPPLLHQ-PPPPPSVSKAPPPPPPPPPP 442 P + PPP P PPPPP++HQ PPPPP V +APPPPPPPPPP Sbjct: 928 PVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPPPPPPPPPP 973 Score = 61.6 bits (148), Expect = 4e-08 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 11/51 (21%) Frame = -2 Query: 561 PPQKSIPPPHP-----PPPPPLLHQ------PPPPPSVSKAPPPPPPPPPP 442 P + PPP P PPPPP++ Q PPPPP V APPPPPPPPPP Sbjct: 938 PVVRQAPPPPPVVHQAPPPPPVVRQAPPPPPPPPPPVVRPAPPPPPPPPPP 988 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/43 (55%), Positives = 28/43 (65%), Gaps = 5/43 (11%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH-----QPPPPPSVSKAPPPPPPPP 448 P + PPP PPPPPP++ PPPPP V + PPPPPPPP Sbjct: 958 PVVRQAPPPPPPPPPPVVRPAPPPPPPPPPPVMRPPPPPPPPP 1000 Score = 57.8 bits (138), Expect = 6e-07 Identities = 28/51 (54%), Positives = 32/51 (62%), Gaps = 11/51 (21%) Frame = -2 Query: 561 PPQKSIPPPHP-----PPPPPLLHQ-PPPPPSVSKAPPPPP-----PPPPP 442 P + PPP P PPPPP++ Q PPPPP V +APPPPP PPPPP Sbjct: 908 PVVRPAPPPPPVVRQAPPPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPP 958 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 8/47 (17%) Frame = -2 Query: 558 PQKSIPP---PHPPPPPPLLHQPPPPPSVSKAPPPPP-----PPPPP 442 P + PP P PPPPP + PPPPP V +APPPPP PPPPP Sbjct: 902 PAPAAPPVVRPAPPPPPVVRQAPPPPPVVRQAPPPPPVVRQAPPPPP 948 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK 415 P + PPP PPPPPP++ PPPPP A P PPPP K ++ + + Sbjct: 973 PVVRPAPPPPPPPPPPVMRPPPPPPPPPAAARPAPPPPAAKPCTLPNGQ 1021 Score = 53.9 bits (128), Expect = 8e-06 Identities = 28/51 (54%), Positives = 32/51 (62%), Gaps = 11/51 (21%) Frame = -2 Query: 561 PPQKSIPPPHP-----PPPPPLLHQ-PPPPPSVSKAPPPPP-----PPPPP 442 P + PPP P PPPPP++ Q PPPPP V +APPPPP PPPPP Sbjct: 918 PVVRQAPPPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPPPPP 968 [114][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 67.4 bits (163), Expect = 7e-10 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PP PPP PPPPPP PPPPP PPPPPPPPPP ++ + Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIVV 74 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [115][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 67.4 bits (163), Expect = 7e-10 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PP PPP PPPPPP PPPPP PPPPPPPPPP ++ + Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIVV 71 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [116][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 67.4 bits (163), Expect = 7e-10 Identities = 28/54 (51%), Positives = 32/54 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVP 400 PP PPP PPPPPP PPPPP PPPPPPPPPP L + +++ P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYMQKPP 63 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP PPPPPP PPPPP PPPPPPPPPP L Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 51 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [117][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 67.4 bits (163), Expect = 7e-10 Identities = 32/72 (44%), Positives = 38/72 (52%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PP PPP PPPPPP PPPPP PPPPPPPPPP + +V + Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVDCRQVWYLYIRTPRA 99 Query: 381 HSLMRRDSTNSR 346 H+ RDS+ +R Sbjct: 100 HNQYVRDSSRNR 111 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 [118][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 67.4 bits (163), Expect = 7e-10 Identities = 28/59 (47%), Positives = 31/59 (52%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEF 385 PP P P PPPPPP L PPPPP PPPPPPPPPP + +P +F Sbjct: 299 PPATPPPSPPPPPPPPPLPSPPPPPPTPPPPPPPPPPPPPPNPPFIPPAEPVIPSFADF 357 [119][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 67.4 bits (163), Expect = 7e-10 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = -2 Query: 561 PPQKSIPPPHP-PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS 430 PP S PPP P PPPPP L PPPPP + +PPPPPP PPP LS Sbjct: 83 PPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLS 127 Score = 67.4 bits (163), Expect = 7e-10 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPLL PPPPPS PPP PPPPPP Sbjct: 124 PPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPP 163 Score = 65.1 bits (157), Expect = 4e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP P PPPP L PPPPP PPPP PPPPP S Sbjct: 123 PPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPS 164 Score = 64.7 bits (156), Expect = 5e-09 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 4/46 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP----PPPPPKS 436 PP S PPP PP PPP L PPPPP + PPPPP PPPPP S Sbjct: 75 PPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPS 120 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP +PPP P PP PL PPPPP S PPPPP PPPP Sbjct: 170 PPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPP 209 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPP S PPPP PPPPP Sbjct: 3 PPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPP 36 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP QPPPPPS PPPPP PPPP Sbjct: 52 PPPSPPPPPP--SQPPPPPSSPPPPPPPPSPPPP 83 Score = 60.8 bits (146), Expect = 7e-08 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIPPPHPP--PPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PP PPPP PPPPP S PPPPP PPPP Sbjct: 50 PPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPP 91 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -2 Query: 561 PPQKSIPPPHPP--PPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PP PPPP PPPPPS PP PPPPPP S Sbjct: 12 PPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPS 55 Score = 60.1 bits (144), Expect = 1e-07 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP P PP PL PPPPP S PPPP PPPP S Sbjct: 28 PPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPS 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + PPP PPPPP PPPPP S PP P PPPPP Sbjct: 60 PPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPP 99 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP P PPS PPP PPPPPP Sbjct: 22 PPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPP 61 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP PPPPP PPPPP +PPPPPPP PP L Sbjct: 53 PPSPPPPPPSQPPPPPSSPPPPPPPP---SPPPPPPPSPPPPL 92 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 10/50 (20%) Frame = -2 Query: 561 PPQKSIPPP----HPPPPPPLLHQP------PPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPPL P PPPP +S PPPP PPPPP Sbjct: 90 PPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPP 139 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP +PPP PPPP P PPPPPS PPPP PPPPP S Sbjct: 219 PPSPPLPPPPPPPPSP---PPPPPPS----PPPPSPPPPPPS 253 Score = 58.5 bits (140), Expect = 3e-07 Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP S PPP P PPPPP PPPPPS PPPPPPP PP L Sbjct: 2 PPPPSPPPPPPPPSSPPPPPPPSPPPPPPS----PPPPPPPSPPSPL 44 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP--PPPPPKS 436 PP S PPP PP PP L PPPP PPPPP PPPPP S Sbjct: 27 PPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSS 70 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP---PPPPP 442 PP S PPP PPP PP P PPP + PPPPP PPPPP Sbjct: 66 PPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPP 108 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPP---PPPPKSL 433 PP S PPP PPPP P PP PP +PPPPPP PPPP L Sbjct: 65 PPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPL 110 Score = 57.4 bits (137), Expect = 7e-07 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 11/53 (20%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPL-----LHQPPP------PPSVSKAPPPPPPPPPPKS 436 PP S PPP P PPPPL L PPP PPS PPP PPPPPP S Sbjct: 153 PPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPS 205 Score = 57.4 bits (137), Expect = 7e-07 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S P P PPPPP PPPPP S PP PPPPPP Sbjct: 214 PPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPPPPP 252 Score = 57.0 bits (136), Expect = 1e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPL P P P PPPPPPPP P Sbjct: 195 PPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSP 234 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PP PS P PPPPPPPP Sbjct: 193 PPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPP 232 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQ----PPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PP PPP L PPPPPS PP PPPPPP S Sbjct: 152 PPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPS 197 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/44 (54%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAP----PPPPPPPPP 442 PP PPP P PPPP PPPPP +P PPPPPPP P Sbjct: 13 PPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSP 56 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPP-PSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PPPP P S PPPPP PP P Sbjct: 145 PPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHP 185 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP + PP PPP PP PPPPPS PP PPPP PP S Sbjct: 136 PPPPLLSPPPPPPSPP----PPPPPSPPPPPPSPPPPLPPPS 173 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP---PPPPP 442 PP S PPP P PPPP PPPPP P PPP PPPPP Sbjct: 138 PPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPP 180 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP P PPPP L PP P S PP PPPPPPP S Sbjct: 194 PPPSPPPPPPPSPPPPPLPSPPAPSPPS--PPLPPPPPPPPS 233 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PP PP PPL PPPPPS PPP PPPP P Sbjct: 208 PPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSP 247 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 540 PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PP PPP PPPPPS PPPP PPPPP S Sbjct: 1 PPPPPSPPP----PPPPPSSPPPPPPPSPPPPPPS 31 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S P P PP PPP PPPP S+ PPPP PPPP Sbjct: 35 PPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPP 74 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PPP PPPPPP PPPP PPP P PPPP S Sbjct: 146 PPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPS 181 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIP---PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S P PP PPPPPP PPPPPS PPPPP P PP Sbjct: 177 PPPPSPPHPLPPSPPPPPPPSPPPPPPPS----PPPPPLPSPP 215 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/40 (57%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -2 Query: 561 PPQKSIP-PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP +P PP P PP P L PPPPP PPPP PPPP Sbjct: 206 PPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPP 245 [120][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 67.0 bits (162), Expect = 9e-10 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 156 PPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 195 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PP PPPPP S PPPPPPPPPP Sbjct: 146 PPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPP 185 Score = 65.5 bits (158), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PPPP PPPPPS PPPPPPPPPP Sbjct: 148 PPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPP 187 Score = 65.1 bits (157), Expect = 4e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PPPPP PPPPPPPPPP Sbjct: 147 PPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPP 186 Score = 65.1 bits (157), Expect = 4e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPP PPPPP PPPPPPPPPP Sbjct: 155 PPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 65.1 bits (157), Expect = 4e-09 Identities = 28/70 (40%), Positives = 37/70 (52%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PP PPP PPP PP PPPPP PPPPPPPPPP +A+++ + + + Sbjct: 160 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNARLKIALKAIRIF 219 Query: 381 HSLMRRDSTN 352 + + D N Sbjct: 220 QAKITVDPFN 229 Score = 63.5 bits (153), Expect = 1e-08 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPP PP PPPPP S PPP PPPPPP S Sbjct: 132 PPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPS 173 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PP PPPPPP PPPPP PPPPPPPPPP Sbjct: 157 PPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPPS PPP PPPPPP Sbjct: 142 PPPSPPPPPSPPPPPP--PSPPPPPSPPPPPPPSPPPPPP 179 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -2 Query: 561 PPQKSIPPPHPP-PPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP+ PPP PP PPPP PPPPPS PPPPP PPPP S Sbjct: 125 PPEPECPPPPPPSPPPPPPPSPPPPPS--PPPPPPPSPPPPPS 165 Score = 57.0 bits (136), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PPP P PPP PPPPP S PPP PPPPPP S Sbjct: 124 PPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPS 159 [121][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 67.0 bits (162), Expect = 9e-10 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPQ + PP PPPPPP PPPPP PPPPPPPPPP Sbjct: 227 PPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 65.5 bits (158), Expect = 3e-09 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPP-PPPPKSLSI 427 PP PPP PPPPPP PPPPP + PPPPPP PPPP SL + Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPL 291 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPP PPPPPP PPPPP PPPPPPPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/43 (60%), Positives = 26/43 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP PPPPPP PPPPP PP PPPPPPP L Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPL 282 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPP P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPP PP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPP PPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPP PPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPP PPPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPP PPPPPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 57.8 bits (138), Expect = 6e-07 Identities = 28/50 (56%), Positives = 28/50 (56%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKV 412 PP PPP PPPPPP L PPPPP P PPPPP P L SA V Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPP----PPLPPPPPSLPLPLPTTSATV 300 Score = 57.0 bits (136), Expect = 1e-06 Identities = 35/110 (31%), Positives = 48/110 (43%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PP PPP PPPPPP PPPPP PPP PPPPP L + + P Sbjct: 254 PPPPPPPPPPPPPPPPPPLPPPPPP-----PPPLPPPPPSLPLPLPTTSATVAPPST--- 305 Query: 381 HSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIK 232 S + ST +T G A + ++ + + + +S LL ++ Sbjct: 306 -SQPTQLSTTPTSSTTSTGTTTTNASIMDNTQQ---AQTQTQSQELLEVR 351 [122][TOP] >UniRef100_UPI00016E5C42 UPI00016E5C42 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E5C42 Length = 859 Score = 67.0 bits (162), Expect = 9e-10 Identities = 30/55 (54%), Positives = 33/55 (60%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEV 394 P+ PP + PPPPP PPPPP APPPPPPPPPP S + K R PEV Sbjct: 370 PESHTPPLNSPPPPP----PPPPPPPGVAPPPPPPPPPPHSCAFTVEKPPRKPEV 420 [123][TOP] >UniRef100_UPI00016E5C2A UPI00016E5C2A related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E5C2A Length = 787 Score = 67.0 bits (162), Expect = 9e-10 Identities = 30/55 (54%), Positives = 33/55 (60%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEV 394 P+ PP + PPPPP PPPPP APPPPPPPPPP S + K R PEV Sbjct: 298 PESHTPPLNSPPPPP----PPPPPPPGVAPPPPPPPPPPHSCAFTVEKPPRKPEV 348 [124][TOP] >UniRef100_B9LBU3 Putative uncharacterized protein n=1 Tax=Chloroflexus sp. Y-400-fl RepID=B9LBU3_CHLSY Length = 340 Score = 67.0 bits (162), Expect = 9e-10 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPP+V+ PPPPPPPPPP Sbjct: 285 PPPPPPPPPPPTVAPPPPPTVAPPPPPPPPPPPP 318 Score = 63.5 bits (153), Expect = 1e-08 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PPP PPPPPP + PPPP PPPPPPPPPP Sbjct: 281 PTEPPPPPPPPPPPPTVAPPPPPTVAPPPPPPPPPPPPP 319 [125][TOP] >UniRef100_A9WHI6 Putative uncharacterized protein n=1 Tax=Chloroflexus aurantiacus J-10-fl RepID=A9WHI6_CHLAA Length = 344 Score = 67.0 bits (162), Expect = 9e-10 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPP+V+ PPPPPPPPPP Sbjct: 289 PPPPPPPPPPPTVAPPPPPTVAPPPPPPPPPPPP 322 Score = 63.5 bits (153), Expect = 1e-08 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PPP PPPPPP + PPPP PPPPPPPPPP Sbjct: 285 PTEPPPPPPPPPPPPTVAPPPPPTVAPPPPPPPPPPPPP 323 [126][TOP] >UniRef100_Q93ZL7 At1g48280/F11A17_25 n=1 Tax=Arabidopsis thaliana RepID=Q93ZL7_ARATH Length = 200 Score = 67.0 bits (162), Expect = 9e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 159 IEDVVPFVKWLDDELSYLVDERAVLKHFEWPEQKADALREAA 34 +EDV+ FV WLD EL+ L DERAVLKHF+WPE+KAD L+EAA Sbjct: 1 MEDVMKFVDWLDKELATLADERAVLKHFKWPEKKADTLQEAA 42 [127][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 67.0 bits (162), Expect = 9e-10 Identities = 30/54 (55%), Positives = 30/54 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVP 400 PP PPP PPPPPP PPPPP PPPPPPPPPP K RR P Sbjct: 78 PPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPTCPCCEKCRRGP 127 Score = 64.3 bits (155), Expect = 6e-09 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 IPPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 76 IPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPP PPPPPP PPPPP PPPPPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 [128][TOP] >UniRef100_B6AGG8 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6AGG8_9CRYT Length = 497 Score = 67.0 bits (162), Expect = 9e-10 Identities = 30/53 (56%), Positives = 33/53 (62%), Gaps = 6/53 (11%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPP------PPPKSLSIAS 421 PP SIPPP P PPPP + PPP PS+ K PPPPPP PPPK L + S Sbjct: 303 PPPPSIPPPPPIPPPPSIPPPPPKPSIQKIPPPPPPKPSIRKIPPPKPLLLKS 355 Score = 55.8 bits (133), Expect(2) = 1e-06 Identities = 27/46 (58%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = -2 Query: 561 PPQKSIPPPHP---PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP S+PP P PPPPP+ PPPPP PPPPP PPPP SL Sbjct: 378 PPPSSLPPSPPSSLPPPPPI---PPPPP----IPPPPPIPPPPSSL 416 Score = 20.4 bits (41), Expect(2) = 1e-06 Identities = 16/62 (25%), Positives = 23/62 (37%) Frame = -3 Query: 359 PQTREEIPPAVETPPRKQYLLTPTPET*SEKSKTDRFISSR*KPT*KRKEIS*GS*SKKS 180 P +P + PP L +P P + S SS KP+ + S S S S Sbjct: 410 PPPPSSLPSPLPIPPPPSSLPSPLPIPPPKSSLLRSLFSSPPKPSLPKSLFSSSSSSSSS 469 Query: 179 ET 174 + Sbjct: 470 SS 471 Score = 55.5 bits (132), Expect = 3e-06 Identities = 29/61 (47%), Positives = 33/61 (54%), Gaps = 8/61 (13%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPP-PPSVSKAPPPP-------PPPPPPKSLSIASAKVRRV 403 P SIPPP PPPP + PPP PP S PPPP PPPPPPK +R++ Sbjct: 292 PPPSIPPPPSIPPPPSIPPPPPIPPPPSIPPPPPKPSIQKIPPPPPPK------PSIRKI 345 Query: 402 P 400 P Sbjct: 346 P 346 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/43 (58%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -2 Query: 558 PQKSIPPPHP-PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 P S+PPP P PPPPP+ PP PP S P P P PPPP SL Sbjct: 387 PPSSLPPPPPIPPPPPIPPPPPIPPPPSSLPSPLPIPPPPSSL 429 [129][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 67.0 bits (162), Expect = 9e-10 Identities = 27/45 (60%), Positives = 28/45 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PP PPP PPPPPP PPPPP PPPPPPPPPP+ I Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARI 63 Score = 66.6 bits (161), Expect = 1e-09 Identities = 29/61 (47%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKV-RRVPEVVEF 385 PP PPP PPPPPP PPPPP PPPPPPPPPP A++ +P + F Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNIPLFLRF 73 Query: 384 Y 382 + Sbjct: 74 F 74 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.0 bits (149), Expect = 3e-08 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 S+ PP PPPPPP PPPPP PPPPPPPPPP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 [130][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 66.2 bits (160), Expect(2) = 1e-09 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP PPPPPPPPPP+ Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 107 Score = 20.8 bits (42), Expect(2) = 1e-09 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 338 PPAVETPPRKQYLLTPTPET 279 PP PP++++L P+ T Sbjct: 99 PPPPPPPPQREHLPVPSSAT 118 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP PPPPPPPPP + Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQR 108 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/48 (52%), Positives = 28/48 (58%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA 418 PP PPP PPPPPP PPPP PPPPPPPP + L + S+ Sbjct: 79 PPPPPPPPPPPPPPPP----PPPP------PPPPPPPPQREHLPVPSS 116 [131][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 65.5 bits (158), Expect(2) = 1e-09 Identities = 29/53 (54%), Positives = 31/53 (58%), Gaps = 11/53 (20%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP-----------PPPPPPKS 436 PP S PPP PPPPPP ++ PPPPP S PPPP PPPPPP S Sbjct: 492 PPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHS 544 Score = 21.2 bits (43), Expect(2) = 1e-09 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = -3 Query: 362 TPQTREEIPPAVETPPRKQYLLTPTPET 279 +P PP PP YL P P T Sbjct: 569 SPPPHSPPPPHSPPPPIYPYLSPPPPPT 596 Score = 64.3 bits (155), Expect = 6e-09 Identities = 27/45 (60%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH-----QPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP+ PPPPP V PPPPPPPPPP Sbjct: 432 PPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPP--------PPPPPPP 442 PP S PPP PPPPPP ++ PPPPP PPP PPPPPPP Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 7/47 (14%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLL-------HQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPP V PPPPPPPPPP Sbjct: 461 PPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPP---PPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PPP PPPPP S PPPPPPPPPP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 61.6 bits (148), Expect = 4e-08 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPP---PPP 442 PP S PPP PPPPPP ++ PPPPP PPPPPPP PPP Sbjct: 477 PPVYSPPPPSPPPPPPPVYSPPPPP-----PPPPPPPVYSPPP 514 Score = 61.2 bits (147), Expect = 5e-08 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = -2 Query: 561 PPQKSIPPP-HPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP + PPPPP PPPPP S PPPPPPPPPP Sbjct: 426 PPPPSPPPPVYSPPPPP----PPPPPVYSPPPPPPPPPPPP 462 Score = 60.5 bits (145), Expect = 9e-08 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Frame = -2 Query: 561 PPQKSIPPPHPPPPP--PLLHQPPPPPSVSKAPPPP---PPPPPP 442 PP S PPPH PPPP P L PPPP VS PP P PPPPPP Sbjct: 570 PPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 10/50 (20%) Frame = -2 Query: 561 PPQKSIPPP----HPPPPPPLLHQPPPPPSVSKAPPPPPP------PPPP 442 P S PPP PPPPPP + PPPPP + +PPPPPP PPPP Sbjct: 595 PTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPP 644 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/42 (59%), Positives = 28/42 (66%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSK--APPPPPPPPPP 442 PP + PPP P PPPP+ PPPPP +PPPPPPPPPP Sbjct: 420 PPTLTSPPP-PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPP 460 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + P PPPPP PPPPP S PPPPPPPPPP Sbjct: 443 PPPPPVYSPPPPPPP-----PPPPPVYSPPPPPPPPPPPP 477 Score = 57.4 bits (137), Expect = 7e-07 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKSIPPPHPPP--------PPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PPP PPPPP V PPP PPPPPP Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/51 (50%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAP-----PPPPPP--PPPKSLS 430 PP PP + PPPPP+ PPPPPS + P PPPPPP PPP S Sbjct: 501 PPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFS 551 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/55 (49%), Positives = 30/55 (54%), Gaps = 15/55 (27%) Frame = -2 Query: 561 PPQKSIPPP--------HPPPPPPLLH--QPPPPPSVSKAPPPPP-----PPPPP 442 PP I PP PPPPPP++H PPPPP +PPPPP PPPPP Sbjct: 611 PPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPP 665 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/46 (50%), Positives = 27/46 (58%), Gaps = 5/46 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP-----PPPPPPK 439 PP S P PPP P++H PPPP V +PPPP PPPP P+ Sbjct: 693 PPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPE 738 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = -2 Query: 558 PQKSIPPPHPPPP----PPLLHQPPPP--PSVSKAPPPPPPPPPP 442 P S+P P PP P PP L PPPP P +PPPPPPPPPP Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPP 447 [132][TOP] >UniRef100_UPI0001795F40 PREDICTED: leiomodin 2 (cardiac) n=1 Tax=Equus caballus RepID=UPI0001795F40 Length = 549 Score = 66.6 bits (161), Expect = 1e-09 Identities = 34/86 (39%), Positives = 41/86 (47%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYH 379 PQ + PP PPPPPP PPPPP + PPPPPPPPPP L R + EV++ Sbjct: 416 PQSPVVPPAPPPPPP----PPPPPPPQRLPPPPPPPPPP--LPEKKLITRNIAEVIKQQE 469 Query: 378 SLMRRDSTNSRRDSTGGGNAAAEAIL 301 S R ++ G IL Sbjct: 470 SAQRALQNGQKKKKGKKGKKQPNNIL 495 [133][TOP] >UniRef100_UPI0000F2E472 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2E472 Length = 551 Score = 66.6 bits (161), Expect = 1e-09 Identities = 31/65 (47%), Positives = 37/65 (56%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PP + P P PPPPPP PPPPP +S PPPPPPPPPP L R + EV++ Sbjct: 417 PPSPAAPSPPPPPPPP----PPPPPHMSPLPPPPPPPPPP--LPEKKLITRNIAEVIKQQ 470 Query: 381 HSLMR 367 + R Sbjct: 471 ENAQR 475 [134][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP PPPPPPPPPP+ Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 65.1 bits (157), Expect = 4e-09 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 S+PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [135][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 66.6 bits (161), Expect = 1e-09 Identities = 29/43 (67%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPP-PPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PPP PPP PPPPP S PPPPPPPPPP S Sbjct: 82 PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPS 124 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP S PPPPPPPPPP Sbjct: 101 PPPPPPPPPSPPPPPP----PPPPPPPSPPPPPPPPPPPP 136 Score = 64.7 bits (156), Expect = 5e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPP PP PPPPPPP Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS 430 PP PPP PPPPPP PPPPP PPPPPPPPP S S Sbjct: 108 PPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPS 151 Score = 63.9 bits (154), Expect = 8e-09 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPP S +PPP PPP PP S Sbjct: 122 PPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPS 163 Score = 63.5 bits (153), Expect = 1e-08 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PP PP PPPPP V PPPPPPPPPP S Sbjct: 69 PPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPS 110 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPP---PHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPQ +PP P PPPPPP+ PPPPP P PPPPPPPP Sbjct: 76 PPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPP 118 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PPPPP PPPPPPPPPP Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPP 135 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPP PPPPPP Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPP 144 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPP PPPPPP Sbjct: 91 PPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPP 130 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PP PPPPPPP Sbjct: 92 PPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPP 131 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP P PPPPPPPP Sbjct: 93 PPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPP 132 Score = 61.2 bits (147), Expect = 5e-08 Identities = 28/42 (66%), Positives = 28/42 (66%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIP--PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S P PP PPPPPP QPP PPS S PPPPPP PPP Sbjct: 57 PPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPP 98 Score = 59.7 bits (143), Expect(2) = 6e-08 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPP-PPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PP PPPS +PPP PPP PP S Sbjct: 133 PPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPS 175 Score = 21.2 bits (43), Expect(2) = 6e-08 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -3 Query: 362 TPQTREEIPPAVETPPRKQYLLTPTP 285 +P+ PP+ PPR+ P+P Sbjct: 216 SPRPPSPSPPSPRPPPRRPPFPPPSP 241 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PP P PPPPP PPPPPPPPPP Sbjct: 67 PPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPP 106 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PP PP PPPPP PPPPPPPPPP Sbjct: 68 PPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPP 107 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP+PPPPPP PPP PS +PPP PPP PP S Sbjct: 129 PPPPPPPPPNPPPPPP---PPPPSPSPPPSPPPSPPPSPPPS 167 Score = 59.3 bits (142), Expect = 2e-07 Identities = 34/78 (43%), Positives = 38/78 (48%), Gaps = 5/78 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPP--PPKSLSIASAKVRRVPEVVE 388 PP S PPP PPPP P +PPPP PPPPP PP PP+ + P VV Sbjct: 331 PPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPPRRPPRPPRRPPTAPGVVG 390 Query: 387 F---YHSLMRRDSTNSRR 343 F Y D+T SRR Sbjct: 391 FFPDYEWDYVDDTTGSRR 408 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQP-PPPPSVSKAPPPPPPPPPP 442 P PPP PPP PPL P PPPP PPPPPPPPPP Sbjct: 66 PPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPP 105 Score = 57.8 bits (138), Expect = 6e-07 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PP P PPPS +PPP PPP PP Sbjct: 146 PPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 185 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPP---PPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP + PPP PPPP PPL P PPP + P PPPP PPP S Sbjct: 246 PPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPS 290 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P PPP PPP PP P PPPS +PPP PPP PP S Sbjct: 150 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPS 191 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P PPP PPP PP P PPPS +PPP PPP PP S Sbjct: 154 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPS 195 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P PPP PPP PP P PPPS +PPP PPP PP S Sbjct: 170 PSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPS 211 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/42 (54%), Positives = 23/42 (54%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P PPP PPP PP P PPPS PPP PPP PP S Sbjct: 158 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPS 199 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/38 (57%), Positives = 23/38 (60%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 P S PPP PPPP P +PPPP PPPP PPPP Sbjct: 237 PPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPP 274 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP---PPPPPPKSLS 430 PP + PPP PPPP P +PPPP PPPP PP PPP S S Sbjct: 311 PPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPS 357 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQP-PPPPSVSKAP---PPPPPPPPPK 439 PP S PPP PPPP PL P PP PS P PPPP PPPP+ Sbjct: 276 PPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPR 320 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/40 (55%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P PPP PPP PP P PPPS +PPP PPP PP Sbjct: 166 PSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPP 205 [136][TOP] >UniRef100_A7PXC6 Chromosome chr12 scaffold_36, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PXC6_VITVI Length = 312 Score = 66.6 bits (161), Expect = 1e-09 Identities = 46/158 (29%), Positives = 77/158 (48%), Gaps = 5/158 (3%) Frame = -2 Query: 492 PPSVSKAPPPPPPPPPPKSL--SIASAKVRRVPEVVEFYHSLMRR--DSTNSRRDSTGGG 325 P + APPPPPP K+L A+ K++R + Y +L + S+ ++S G Sbjct: 2 PMTKGAAPPPPPPLAVAKALRPRKANNKLKRSTHMGNLYRTLKGKVEGSSLQGKNSQGRT 61 Query: 324 NAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVV 145 +A ++ D + E+ RS Y I+ DV+ G I + + + D+++++ Sbjct: 62 SAIGDSAGGKQGMADALAEMTKRSAYFQQIEEDVQKHGKVIMEIKVAISSFQTKDMDELL 121 Query: 144 PFVKWLDDELSYLVDERAVLKHFE-WPEQKADALREAA 34 F K ++ L L DE VL FE +P +K + LR AA Sbjct: 122 KFQKHVEQHLEELTDETQVLARFEDFPMKKLETLRMAA 159 [137][TOP] >UniRef100_A7Z068 LMOD2 protein n=1 Tax=Bos taurus RepID=A7Z068_BOVIN Length = 553 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/65 (46%), Positives = 36/65 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PP + PPP PPPPPP PPPPP + PPPPPPPPP + R + EV++ Sbjct: 414 PPSPAAPPPPPPPPPPPPPPPPPPPLAPQRLPPPPPPPPPPAPE-KKLITRNIAEVIKQQ 472 Query: 381 HSLMR 367 S R Sbjct: 473 ESAQR 477 [138][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP PPPPPP PPPPP PPPPPPPPPP L Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRL 100 Score = 66.2 bits (160), Expect = 2e-09 Identities = 27/47 (57%), Positives = 28/47 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIAS 421 PP PPP PPPPPP PPPPP PPPPPPPPPP + S Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTS 103 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 64.7 bits (156), Expect = 5e-09 Identities = 30/57 (52%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK---SLSIASAKVRRVP 400 PP PPP PPPPPP PPPPP PPPPPPPPPP+ S +++ R VP Sbjct: 62 PPPPPPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPRLVTSRPLSALFARPVP 115 [139][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP PPPPPPPPPP+ Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 48 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 63.9 bits (154), Expect = 8e-09 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 +PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 2 VPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 [140][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP PPPPPP PPPPP PPPPPPPPPP L Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 48 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/59 (49%), Positives = 32/59 (54%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEF 385 PP PPP PPPPPP PPPPP PPPPPPPPP +L A + V E+ Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCNLWDVGANTKHSHNVAEY 67 [141][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 66.6 bits (161), Expect = 1e-09 Identities = 28/57 (49%), Positives = 32/57 (56%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVV 391 PP PPP PPPPPP PPPPP PPPPPPPPPP I+ + E++ Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHITKISLPFFNALIEII 74 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS 430 PP PPP PPPPPP PPPPP PPPPPPPPPP ++ Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHIT 60 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [142][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP+ PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP PPPPPP PPPPP PPPPPPPPPP L Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 98 Score = 66.2 bits (160), Expect = 2e-09 Identities = 28/60 (46%), Positives = 32/60 (53%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PP PPP PPPPPP PPPPP PPPPPPPPPP + +P +F+ Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIPLRTQFF 113 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 [143][TOP] >UniRef100_A1DL75 Actin associated protein Wsp1, putative n=1 Tax=Neosartorya fischeri NRRL 181 RepID=A1DL75_NEOFI Length = 638 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 4/44 (9%) Frame = -2 Query: 561 PPQKSIPPPHPPPPP----PLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S+PPP PPPPP P PPPPPS++ PPPPPPPP P Sbjct: 477 PPSASVPPPPPPPPPASAGPPAPPPPPPPSIAGPPPPPPPPPAP 520 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/44 (54%), Positives = 28/44 (63%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS 430 PP S PP PPPP + PPPPP + A PP PPPPPP S++ Sbjct: 465 PPATSAVPPPPPPPSASVPPPPPPPPPASAGPPAPPPPPPPSIA 508 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAP----PPPPPPPPPKS 436 PP + PP PPPPPP + PPPPP AP PPPPPPPP S Sbjct: 490 PPASAGPPAPPPPPPPSIAGPPPPPPPPPAPGGSAPPPPPPPPGAS 535 Score = 57.4 bits (137), Expect = 7e-07 Identities = 26/53 (49%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPP-----PPPPKSLSIASA 418 P + +PPP PPP P PPPP+ S PPPPPP PPPP ASA Sbjct: 442 PARNPVPPPAPPPVPAASRPTPPPPATSAVPPPPPPPSASVPPPPPPPPPASA 494 [144][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 400 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 362 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 401 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 363 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PPP PPPPPP PPPPP S PPPPPPPPPP Sbjct: 353 PCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 391 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P Q PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 353 PCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 64.3 bits (155), Expect = 6e-09 Identities = 29/47 (61%), Positives = 29/47 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIAS 421 PP S PPP PPPPPP PPPPP PPPPPPPP P S S S Sbjct: 375 PPPPSPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPCPASCSPTS 418 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP P PPP PPPPPPPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 397 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPP PPPPPPPPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 398 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPP PPPPP PPPPPPPPPP Sbjct: 364 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PPPPP PPPPPPPPPP Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 [145][TOP] >UniRef100_Q7T318 Wiskott-Aldrich syndrome (Eczema-thrombocytopenia) n=1 Tax=Danio rerio RepID=Q7T318_DANRE Length = 479 Score = 66.2 bits (160), Expect = 2e-09 Identities = 32/65 (49%), Positives = 37/65 (56%), Gaps = 11/65 (16%) Frame = -2 Query: 561 PPQKSIPPPHP---------PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS--IASAK 415 PP + PPP P PPPP H+PPPPP + APPPPPPPPPP S S +S+ Sbjct: 330 PPHRGPPPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPPPPPPPSSSGNFSSSP 389 Query: 414 VRRVP 400 V P Sbjct: 390 VSSAP 394 [146][TOP] >UniRef100_B0S5G8 Wiskott-Aldrich syndrome (Eczema-thrombocytopenia) n=1 Tax=Danio rerio RepID=B0S5G8_DANRE Length = 479 Score = 66.2 bits (160), Expect = 2e-09 Identities = 32/65 (49%), Positives = 37/65 (56%), Gaps = 11/65 (16%) Frame = -2 Query: 561 PPQKSIPPPHP---------PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS--IASAK 415 PP + PPP P PPPP H+PPPPP + APPPPPPPPPP S S +S+ Sbjct: 330 PPHRGPPPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPPPPPPPSSSGNFSSSP 389 Query: 414 VRRVP 400 V P Sbjct: 390 VSSAP 394 [147][TOP] >UniRef100_B0S5G7 Wiskott-Aldrich syndrome (Eczema-thrombocytopenia) (Fragment) n=1 Tax=Danio rerio RepID=B0S5G7_DANRE Length = 271 Score = 66.2 bits (160), Expect = 2e-09 Identities = 32/65 (49%), Positives = 37/65 (56%), Gaps = 11/65 (16%) Frame = -2 Query: 561 PPQKSIPPPHP---------PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS--IASAK 415 PP + PPP P PPPP H+PPPPP + APPPPPPPPPP S S +S+ Sbjct: 192 PPHRGPPPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPPPPPPPSSSGNFSSSP 251 Query: 414 VRRVP 400 V P Sbjct: 252 VSSAP 256 [148][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP PPPPPPPPPP+ Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPE 364 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP PPPPPP PPP+ Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQ 368 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPP PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 57.4 bits (137), Expect = 7e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPP PPP P Sbjct: 334 PPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPEPPPQP 369 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA 418 PP PPP PPPPPP PPPPP PPPPP PPP + +A Sbjct: 338 PPPPPPPPPPPPPPPP----PPPPP-----PPPPPEPPPQPDPPVTTA 376 [149][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 64.3 bits (155), Expect = 6e-09 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP PPPPPP PPPPP PPPPPPPPPP L Sbjct: 64 PPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPL 102 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPP PPPP PPPPP S Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPS 109 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPP PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 +PPP PP PPP PPPPP PPPPPPPPPP Sbjct: 54 LPPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 [150][TOP] >UniRef100_C4LZJ6 Putative uncharacterized protein n=1 Tax=Entamoeba histolytica HM-1:IMSS RepID=C4LZJ6_ENTHI Length = 1575 Score = 66.2 bits (160), Expect = 2e-09 Identities = 30/59 (50%), Positives = 35/59 (59%), Gaps = 11/59 (18%) Frame = -2 Query: 561 PPQKSIPPPHPP------PPPPLLHQPPPPPSVSKAPPPPP-----PPPPPKSLSIASA 418 PP S+PPP PP PPPP L PPPPP PPPPP PPPPP +L++ S+ Sbjct: 1445 PPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLNVTSS 1503 Score = 64.7 bits (156), Expect = 5e-09 Identities = 30/56 (53%), Positives = 33/56 (58%), Gaps = 11/56 (19%) Frame = -2 Query: 561 PPQKSIPPPHPP------PPPPLLHQPPPPPSVSKAPPPPP-----PPPPPKSLSI 427 PP S+PPP PP PPPP L PPPPP PPPPP PPPPP +LS+ Sbjct: 1425 PPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSM 1480 Score = 60.5 bits (145), Expect = 9e-08 Identities = 30/56 (53%), Positives = 33/56 (58%), Gaps = 11/56 (19%) Frame = -2 Query: 561 PPQKSIPPPHPP------PPPPLLHQPPPPPSVSKAPPPPP-----PPPPPKSLSI 427 PP S+PPP PP PPPP L PPPPP PPPPP PPPPP +LS+ Sbjct: 1435 PPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSM 1490 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 8/47 (17%) Frame = -2 Query: 543 PPPH---PPPPPPLLHQPPPPPSVSKAPPPPP-----PPPPPKSLSI 427 PPP PPPPPP L PPPPP PPPPP PPPPP +LS+ Sbjct: 1424 PPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSM 1470 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 5/40 (12%) Frame = -2 Query: 531 PPPPPPLLHQPPPPPSVSKAPPPPP-----PPPPPKSLSI 427 PPPPPP L PPPPP PPPPP PPPPP +LS+ Sbjct: 1421 PPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSM 1460 [151][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP PPPPPPPPPP+ Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 S PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 44 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [152][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVV 391 P + PPP PPPPPP PPPPP PPPPPPPPPP S++++S K+ + E++ Sbjct: 494 PSSTPPPPPPPPPPP----PPPPP-----PPPPPPPPPPPSVTLSSQKMAGLRELL 540 [153][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP +PPPPPPPPPP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP PPPPPPPPPP+ Sbjct: 65 PPPPPPPPPPPPPPPP----PPPPPPPPSPPPPPPPPPPPQ 101 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP S PPPPPPPPP + Sbjct: 66 PPPPPPPPPPPPPPPP----PPPPPPPSPPPPPPPPPPPQR 102 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 61.2 bits (147), Expect = 5e-08 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 +PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 58 VPPPLPPPPPP----PPPPPPPPPPPPPPPPPPPP 88 [154][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 66.2 bits (160), Expect = 2e-09 Identities = 39/87 (44%), Positives = 46/87 (52%), Gaps = 2/87 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK--VRRVPEVVE 388 PP PPP PPPPPP PPPPP PPPPPPPPPP S A +R+ ++VE Sbjct: 346 PPAAQAPPPPPPPPPP----PPPPPP---PPPPPPPPPPPASTKPPQALSFAKRLQQLVE 398 Query: 387 FYHSLMRRDSTNSRRDSTGGGNAAAEA 307 +++ ST S AAAEA Sbjct: 399 ----VLKGGSTFSGAKRVDTAAAAAEA 421 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/39 (58%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -2 Query: 555 QKSIPPPHPPPPP-PLLHQPPPPPSVSKAPPPPPPPPPP 442 Q + PPHP P P P H PP P ++APPPPPPPPPP Sbjct: 323 QHASGPPHPHPHPHPHPHPRPPQPPAAQAPPPPPPPPPP 361 [155][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 65.1 bits (157), Expect(2) = 2e-09 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP V +PPPPPP PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 20.8 bits (42), Expect(2) = 2e-09 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 Query: 338 PPAVETPPRKQYLLTPTP 285 PP V PP Y+ P P Sbjct: 421 PPYVYPPPPPPYVYPPPP 438 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 376 PPSPPPPPPPPPPPPP----PPPPP-----PPPPPPPPPP 406 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPP-----PPPPPPPPPP 407 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 6/48 (12%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAP---PPPPPP---PPPKS 436 PP PPP PPPPPP ++ PPPP S P PPPPPP PPP S Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPS 439 Score = 57.8 bits (138), Expect = 6e-07 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 540 PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPPPPP PPPPP PPPPPPPPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPP---PPPPP 442 PPP PP PPP ++ PPPPP V PP PP PPPPP Sbjct: 413 PPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 [156][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 63.2 bits (152), Expect = 1e-08 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -2 Query: 555 QKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 + + PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 850 EPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/45 (60%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP--PPPPPKSL 433 PP PPP PPPPPP PPPPP PPPPP PPPPP +L Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPAL 972 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/49 (57%), Positives = 29/49 (59%), Gaps = 6/49 (12%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPP------PPPPKSL 433 PP PPP PPPPPP PPPPP APPPPPP PPPP +L Sbjct: 935 PPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPPAL 983 Score = 55.1 bits (131), Expect = 4e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPP PPPPPP PPPPP++ PPPPP P Sbjct: 946 PPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPPALP 984 [157][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIPPP--HPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP ++ PPPPP V PPPPP PPPP Sbjct: 269 PPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPP 310 Score = 64.7 bits (156), Expect = 5e-09 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP---PPPPPKS 436 PP S PPP P PPPP+ PPPPP V PPPPP PPPPP S Sbjct: 262 PPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPS 306 Score = 61.2 bits (147), Expect(2) = 1e-08 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPP---PPPPPKS 436 PPP PPPPPP ++ PPPPPS PPPP PPPPP S Sbjct: 303 PPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPS 341 Score = 21.9 bits (45), Expect(2) = 1e-08 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -3 Query: 359 PQTREEIPPAVETPPRKQYLLTPTPET 279 P R PP +PP L +P P T Sbjct: 355 PCVRPPPPPPPNSPPPPPPLFSPPPPT 381 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/60 (41%), Positives = 29/60 (48%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PP PP PP PPP + PPPPP +PPPP P PPP + P V +Y Sbjct: 441 PPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYY 500 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 6/46 (13%) Frame = -2 Query: 561 PPQKSIPPPHPPPP---PPLLHQPPPPPSVSKAPPPP---PPPPPP 442 PP S PPP PPPP PP + PPPPP S PPPP PPPP P Sbjct: 337 PPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTP 382 Score = 57.0 bits (136), Expect(2) = 3e-07 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = -2 Query: 561 PPQKSIPPPHPPPPP--PLLHQPPPPPSVSKAPPPP---PPPPP 445 PP PPPH PPPP P L PPPP V PPPP PPPPP Sbjct: 409 PPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPP 452 Score = 21.6 bits (44), Expect(2) = 3e-07 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 338 PPAVETPPRKQYLLTPTP 285 PP+ PP QY P+P Sbjct: 473 PPSPSPPPPTQYKPPPSP 490 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP P PPPPP P PPP V PPPPP PPPP Sbjct: 302 PPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPP 345 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/43 (58%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPP---PPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S P P P PP PP ++ PPPPP V PPPPP PPPP Sbjct: 235 PPPPSPPMPVPSPPVYLPPPVYSPPPPPPVYSPPPPPPSPPPP 277 Score = 57.8 bits (138), Expect = 6e-07 Identities = 29/50 (58%), Positives = 30/50 (60%), Gaps = 8/50 (16%) Frame = -2 Query: 561 PPQKSIPPP-----HPPPPPPLLHQPPPPPSVSKAPPPPPP---PPPPKS 436 PP S PPP PPPPPP+ PPPPPS PPPPPP PPPP S Sbjct: 276 PPVYSPPPPPPPVYSPPPPPPVYSPPPPPPS---PPPPPPPVYSPPPPPS 322 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHP---PPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP P PPPPP PPPPP S PPP PPPP P Sbjct: 286 PPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSP 328 Score = 57.4 bits (137), Expect = 7e-07 Identities = 25/46 (54%), Positives = 27/46 (58%), Gaps = 4/46 (8%) Frame = -2 Query: 561 PPQKSIPPP----HPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PPPP P + PPPPS +PPPPP PPP S Sbjct: 363 PPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPS 408 Score = 55.5 bits (132), Expect(2) = 1e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKSIPPP-----HPPPPPPLLHQPPPPPSVSKAPPPPPPP---PPP 442 PP S PPP PPPPP ++ PPPPP S PPP PPP PPP Sbjct: 415 PPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPP 462 Score = 21.2 bits (43), Expect(2) = 1e-06 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 359 PQTREEIPPAVETPPRKQYLLTPTP 285 P T+ + PP+ PP + +P P Sbjct: 480 PPTQYKPPPSPSPPPPPVHYYSPPP 504 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/45 (55%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP------PPPPP 445 PP PPPH PPPP H PPPPP +PPPP PPPPP Sbjct: 393 PPHSPPPPPHSPPPPSPPHSPPPPP---HSPPPPIYPYLSPPPPP 434 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 9/48 (18%) Frame = -2 Query: 558 PQKSIPPP--HPPPPPPLLHQPPPPPS----VSKAPPPPPP---PPPP 442 P +PPP PPPPPP+ PPPPPS V PPPPPP PPPP Sbjct: 247 PPVYLPPPVYSPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPPP 294 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP P PPPP+ PPPPPS PPPP PPPP L Sbjct: 317 PPPPPSPPP-PSPPPPVYSPPPPPPS-----PPPPSPPPPSPL 353 Score = 54.7 bits (130), Expect = 5e-06 Identities = 24/43 (55%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP---PPPPPP 442 PP PP + PPPPP ++ PPPPP +PPPP PPPPPP Sbjct: 247 PPVYLPPPVYSPPPPPPVYSPPPPP---PSPPPPVYSPPPPPP 286 Score = 54.3 bits (129), Expect = 6e-06 Identities = 25/45 (55%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPP--PPPPKSL 433 PP S PPP P PPPP P P P + PPPPPP PPPP L Sbjct: 330 PPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPL 374 Score = 54.3 bits (129), Expect = 6e-06 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP----PPPPPPKS 436 P PP PPPPPPL PPP P +PPPP PPPPP S Sbjct: 359 PPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHS 403 Score = 54.3 bits (129), Expect = 6e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPH PPPPP H PPPP PPPP PPPP Sbjct: 388 PPPPS--PPHSPPPPP--HSPPPPSPPHSPPPPPHSPPPP 423 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 6/46 (13%) Frame = -2 Query: 561 PPQKSIPPPHPP-PPPPLLHQPPPPPSVSKAPPPPP-----PPPPP 442 PP S PPP PP PPP H PPPP +PPPPP PPPPP Sbjct: 399 PPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPP 444 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = -2 Query: 561 PPQKSIPPP-HPPPPPPLLHQPPPPPSVSKAPP--PPPPPPPPKS 436 PP S PPP + PPPPP PP PP S PP PPPPPPP S Sbjct: 323 PPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNS 367 [158][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVP 117 [159][TOP] >UniRef100_Q4WCV2 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus fumigatus RepID=Q4WCV2_ASPFU Length = 643 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PP ++ PP PPPP P +P PPP V+ A PPPPPPPPP S S+ Sbjct: 441 PPARNPVPPPPPPPVPAASRPTPPPPVTSAVPPPPPPPPPPSTSV 485 Score = 64.7 bits (156), Expect = 5e-09 Identities = 28/47 (59%), Positives = 31/47 (65%), Gaps = 4/47 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH---QPPPPPSVSKAPP-PPPPPPPPKSL 433 P ++PPP PPPPPP PPPPP VS PP PPPPPPPP S+ Sbjct: 466 PVTSAVPPPPPPPPPPSTSVPPSPPPPPPVSSGPPAPPPPPPPPPSI 512 Score = 60.5 bits (145), Expect = 9e-08 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 7/47 (14%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH-------QPPPPPSVSKAPPPPPPPPPP 442 PP + PP PPPPPP+ PPPPPS+ PPPPPPPP P Sbjct: 479 PPPSTSVPPSPPPPPPVSSGPPAPPPPPPPPPSIGGPPPPPPPPPAP 525 Score = 57.8 bits (138), Expect = 6e-07 Identities = 27/45 (60%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = -2 Query: 561 PPQKSIPP--PHPPPPPPLLHQPPPPPSVSKAP----PPPPPPPP 445 PP S PP P PPPPPP + PPPPP AP PPPPPPPP Sbjct: 493 PPVSSGPPAPPPPPPPPPSIGGPPPPPPPPPAPGGSAPPPPPPPP 537 [160][TOP] >UniRef100_Q2U6Q3 Actin regulatory protein n=1 Tax=Aspergillus oryzae RepID=Q2U6Q3_ASPOR Length = 665 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/47 (57%), Positives = 30/47 (63%), Gaps = 4/47 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPP----SVSKAPPPPPPPPPPKSL 433 PP S+PPP PPPPPP PPPPP S+ PP PPPPPP S+ Sbjct: 477 PPSSSVPPPPPPPPPPTSSVPPPPPPPPLPSSRGPPAPPPPPPSSSI 523 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = -2 Query: 561 PPQKSIPPPHPP----PPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P ++PPP PP PPPP PPPPP S PPPPPPPP P S Sbjct: 467 PASSAVPPPPPPSSSVPPPP----PPPPPPTSSVPPPPPPPPLPSS 508 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 10/50 (20%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH----QPPPPPSVSKAPPPPPP------PPPP 442 PP S+PPP PPPP P PPPPPS S PPPPPP PPPP Sbjct: 491 PPTSSVPPPPPPPPLPSSRGPPAPPPPPPSSSIPPPPPPPGRGPSAPPPP 540 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/48 (54%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Frame = -2 Query: 561 PPQKSIPPPHP------PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P + PPP P PPPP PPPPP S PPPPPPPPPP S Sbjct: 447 PASQPPPPPVPAASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTS 494 Score = 58.2 bits (139), Expect = 4e-07 Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = -2 Query: 561 PPQKSIP----PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP +P PP PPPPPP PPPPP + P PPPPPPP Sbjct: 500 PPPPPLPSSRGPPAPPPPPPSSSIPPPPPPPGRGPSAPPPPPPP 543 Score = 57.4 bits (137), Expect = 7e-07 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP + P PPPP PPPPPS S PPPPPPPPP S+ Sbjct: 454 PPVPAASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTSSV 496 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPP---PLLHQPPPPPSVSKAPPPPPPPPP 445 PP SIPP PPPPP P PPPPP+ + PPPPPPPP Sbjct: 518 PPSSSIPP--PPPPPGRGPSAPPPPPPPAPAGGAPPPPPPPP 557 [161][TOP] >UniRef100_B8NKG8 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus flavus NRRL3357 RepID=B8NKG8_ASPFN Length = 692 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/47 (57%), Positives = 30/47 (63%), Gaps = 4/47 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPP----SVSKAPPPPPPPPPPKSL 433 PP S+PPP PPPPPP PPPPP S+ PP PPPPPP S+ Sbjct: 504 PPSSSVPPPPPPPPPPTSSVPPPPPPPPLPSSRGPPAPPPPPPSSSI 550 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = -2 Query: 561 PPQKSIPPPHPP----PPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P ++PPP PP PPPP PPPPP S PPPPPPPP P S Sbjct: 494 PASSAVPPPPPPSSSVPPPP----PPPPPPTSSVPPPPPPPPLPSS 535 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/49 (53%), Positives = 26/49 (53%), Gaps = 8/49 (16%) Frame = -2 Query: 558 PQKSIPPPHP--------PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P PPP P PPPP PPPPP S PPPPPPPPPP S Sbjct: 473 PASQPPPPPPVPAASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTS 521 Score = 57.4 bits (137), Expect = 7e-07 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP + P PPPP PPPPPS S PPPPPPPPP S+ Sbjct: 481 PPVPAASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTSSV 523 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/52 (50%), Positives = 29/52 (55%), Gaps = 12/52 (23%) Frame = -2 Query: 561 PPQKSIPPPHPPPP------PPLLHQPPPPPSVSKAPPPP------PPPPPP 442 PP S+PPP PPPP PP PPP S+ + PPPP PPPPPP Sbjct: 518 PPTSSVPPPPPPPPLPSSRGPPAPPPPPPSSSIPRPPPPPGRGPSAPPPPPP 569 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 10/55 (18%) Frame = -2 Query: 561 PPQK--SIPPPHPP--------PPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PP+ S PPP PP PPPP PPPP S + PPPPPPPPP + S+ Sbjct: 469 PPRSPASQPPPPPPVPAASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTSSV 523 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/46 (52%), Positives = 28/46 (60%), Gaps = 6/46 (13%) Frame = -2 Query: 561 PPQKSIP----PPHPPPPPPL--LHQPPPPPSVSKAPPPPPPPPPP 442 PP +P PP PPPPPP + +PPPPP + PPPPPPP P Sbjct: 527 PPPPPLPSSRGPPAPPPPPPSSSIPRPPPPPGRGPSAPPPPPPPAP 572 [162][TOP] >UniRef100_UPI0001A7B1A6 unknown protein n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B1A6 Length = 712 Score = 65.5 bits (158), Expect = 3e-09 Identities = 56/204 (27%), Positives = 80/204 (39%), Gaps = 28/204 (13%) Frame = -2 Query: 561 PPQKSIPPPHPP--------------PPPPLLHQPPPPP---SVSKAPPPPPPPPPPKSL 433 PP ++ PP PP PPP PPPPP + K PPPPPP Sbjct: 384 PPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARG 443 Query: 432 SIASAKV-------RRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNAR--- 283 + + KV + + F + + R GGG+ A S + Sbjct: 444 GLGAKKVTSKLKRSTHLGALFRFLKGKLEGKNPEVRSRGAGGGSKGATGSAPASGKQGMA 503 Query: 282 DMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLV 103 D + EI +S Y I+ DV I L ++ DI ++ F ++ L L Sbjct: 504 DALAEITKKSPYFQKIEEDVRMYMTSINELKTDITKFKNKDITELQKFHHRIESVLEKLE 563 Query: 102 DERAVLKHFE-WPEQKADALREAA 34 DE VL E +P +K +A+R AA Sbjct: 564 DETQVLARCEGFPHKKLEAIRMAA 587 [163][TOP] >UniRef100_O23691 Putative uncharacterized protein T19D16.24 n=1 Tax=Arabidopsis thaliana RepID=O23691_ARATH Length = 554 Score = 65.5 bits (158), Expect = 3e-09 Identities = 56/204 (27%), Positives = 80/204 (39%), Gaps = 28/204 (13%) Frame = -2 Query: 561 PPQKSIPPPHPP--------------PPPPLLHQPPPPP---SVSKAPPPPPPPPPPKSL 433 PP ++ PP PP PPP PPPPP + K PPPPPP Sbjct: 226 PPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARG 285 Query: 432 SIASAKV-------RRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAAAEAILANSNAR--- 283 + + KV + + F + + R GGG+ A S + Sbjct: 286 GLGAKKVTSKLKRSTHLGALFRFLKGKLEGKNPEVRSRGAGGGSKGATGSAPASGKQGMA 345 Query: 282 DMIGEIENRSVYLLAIKTDVETQGDFIRFLIKEVGNAAFSDIEDVVPFVKWLDDELSYLV 103 D + EI +S Y I+ DV I L ++ DI ++ F ++ L L Sbjct: 346 DALAEITKKSPYFQKIEEDVRMYMTSINELKTDITKFKNKDITELQKFHHRIESVLEKLE 405 Query: 102 DERAVLKHFE-WPEQKADALREAA 34 DE VL E +P +K +A+R AA Sbjct: 406 DETQVLARCEGFPHKKLEAIRMAA 429 [164][TOP] >UniRef100_A9TWA3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWA3_PHYPA Length = 2209 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/42 (71%), Positives = 30/42 (71%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 P KS PPP PPPPPP PPPPP S APPPPPPPPPP L Sbjct: 1576 PGKSAPPPPPPPPPP----PPPPPGRS-APPPPPPPPPPLPL 1612 Score = 62.8 bits (151), Expect = 2e-08 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 10/53 (18%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPL----LHQPPPPPSVSKAPPPPP------PPPPPKSL 433 PP +S PPP PPPPPPL PPPPP APPPPP PPPPP L Sbjct: 1594 PPGRSAPPPPPPPPPPLPLGGRAAPPPPPGGRAAPPPPPGGRAAPPPPPPPPL 1646 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 4/46 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPP-PPLL---HQPPPPPSVSKAPPPPPPPPPPKS 436 PP KS PP PPPP PP L PPPPP PPPPPPPPP +S Sbjct: 1557 PPGKSAPPRRPPPPLPPSLPGKSAPPPPPP----PPPPPPPPPGRS 1598 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/39 (53%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 P ++ PPP PPPP PPPPP + PPPPPPPP Sbjct: 1664 PGGRAAPPPPPPPPGGRAAPPPPPPPGGRGAPPPPPPPP 1702 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/46 (50%), Positives = 24/46 (52%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIA 424 PP PP PPPPP PPPPP PPPPPPPP +A Sbjct: 1663 PPGGRAAPPPPPPPPGGRAAPPPPPPPGGRGAPPPPPPPPGGRGVA 1708 [165][TOP] >UniRef100_A0D1C0 Chromosome undetermined scaffold_34, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D1C0_PARTE Length = 1131 Score = 65.5 bits (158), Expect = 3e-09 Identities = 31/53 (58%), Positives = 33/53 (62%), Gaps = 14/53 (26%) Frame = -2 Query: 558 PQKSIPPPHPPPPPP---------LLHQPPPPPSVSK-----APPPPPPPPPP 442 PQK+ PPP PPPPPP + PPPPPSV K APPPPPPPPPP Sbjct: 589 PQKAAPPPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPP 641 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 5/41 (12%) Frame = -2 Query: 549 SIPPPHPPPPPPL-----LHQPPPPPSVSKAPPPPPPPPPP 442 S PPP PPPPPP PPPPP +KA PPPPPPPP Sbjct: 630 SAPPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPP 670 [166][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 65.5 bits (158), Expect = 3e-09 Identities = 29/68 (42%), Positives = 41/68 (60%), Gaps = 5/68 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSV-----SKAPPPPPPPPPPKSLSIASAKVRRVPE 397 PP +PPP PPPPPP PPPPP++ S PPPP PPPP S + + + + + Sbjct: 472 PPPPPLPPPPPPPPPPPPPPPPPPPALDVGETSSLQPPPPLPPPPYSCDPSGSDLPQDTK 531 Query: 396 VVEFYHSL 373 V+++Y +L Sbjct: 532 VLQYYFNL 539 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -2 Query: 531 PPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVP 400 PPPPPP L PPPPP PPPPPPPPPP +L + + P Sbjct: 470 PPPPPPPLPPPPPPP----PPPPPPPPPPPPALDVGETSSLQPP 509 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 S+PPP PPP PP PPPPP PPPPPPPPPP Sbjct: 468 SLPPPPPPPLPP----PPPPP-----PPPPPPPPPP 494 [167][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 65.5 bits (158), Expect = 3e-09 Identities = 28/47 (59%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKA---PPPPPPPPPPKSLS 430 PP PPP PPPPPP PPPPP +S PPPPPPPPPP +S Sbjct: 1034 PPPPPPPPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPPMS 1080 Score = 60.5 bits (145), Expect = 9e-08 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P ++PPP PPPPPP PPPPP PPPPPPPPPP S Sbjct: 1027 PAVTAVPPPPPPPPPP----PPPPPP---PPPPPPPPPPPMS 1061 Score = 57.8 bits (138), Expect = 6e-07 Identities = 27/56 (48%), Positives = 29/56 (51%), Gaps = 8/56 (14%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQ---PPPPPSVSKAPPP-----PPPPPPPKSLSIASA 418 PP PPP PPPPPP + PPPPP PPP PPPPPPP + A Sbjct: 1043 PPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPPMSPGMPPPPPPPPGAPVPGA 1098 [168][TOP] >UniRef100_B2AKS1 Translation initiation factor IF-2 n=1 Tax=Podospora anserina RepID=B2AKS1_PODAN Length = 1038 Score = 65.5 bits (158), Expect = 3e-09 Identities = 27/48 (56%), Positives = 31/48 (64%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK 415 P+ PPP PPPPPP PPPPP S PPPPPPPPPP+ + A+ Sbjct: 116 PRAPKPPPPPPPPPP--PPPPPPPKASTPPPPPPPPPPPRQWQPSPAR 161 Score = 57.8 bits (138), Expect = 6e-07 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = -2 Query: 561 PPQKSIP----PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP K P PP PPPPPP PPPPP KA PPPPPPPP Sbjct: 110 PPPKLEPRAPKPPPPPPPPP----PPPPPPPPKASTPPPPPPPP 149 [169][TOP] >UniRef100_B1WBQ8 Glyceraldehyde 3-phosphate dehydrogenase n=1 Tax=Rattus norvegicus RepID=B1WBQ8_RAT Length = 432 Score = 65.1 bits (157), Expect = 4e-09 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 6/47 (12%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQP------PPPPSVSKAPPPPPPPPPPK 439 PP K PPP PPPPPP +P PPPP PPPPPPPPPPK Sbjct: 49 PPPKEEPPPPPPPPPPPQIEPEEPKEAPPPPPPPPPPPPPPPPPPPK 95 Score = 62.0 bits (149), Expect = 3e-08 Identities = 29/65 (44%), Positives = 36/65 (55%), Gaps = 8/65 (12%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPPPPPPPP-PPKSLSIASAKVRR 406 PP++ PPP PPPPPP + PPPPP PPPPPPPP P K L++ R Sbjct: 50 PPKEEPPPPPPPPPPPQIEPEEPKEAPPPPPPPPPPPPPPPPPPPKPAKELTVGINGFGR 109 Query: 405 VPEVV 391 + +V Sbjct: 110 IGRLV 114 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/48 (56%), Positives = 30/48 (62%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKSIPPP---HPPPPPPLLHQPPPPPSV-----SKAPPPPPPPPPP 442 PP+ PPP PPPPPP PPPPP + +APPPPPPPPPP Sbjct: 42 PPKVEEPPPPKEEPPPPPP----PPPPPQIEPEEPKEAPPPPPPPPPP 85 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 P PPPPPP + +PPPP + PPPPPPPPPP+ Sbjct: 34 PVIRPPPPPPKVEEPPPPKE--EPPPPPPPPPPPQ 66 [170][TOP] >UniRef100_A2XDP2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XDP2_ORYSI Length = 820 Score = 65.1 bits (157), Expect = 4e-09 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 P + PPP PPPPPP PPPPP ++ AP PPPPPPPP S+ Sbjct: 345 PSNAPPPPPPPPPPP---PPPPPPKLNTAPKPPPPPPPPPSV 383 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP L+ P PP PPPPPPP P + Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPP-----PPPPPPPSVPSN 386 [171][TOP] >UniRef100_B6AF23 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6AF23_9CRYT Length = 876 Score = 65.1 bits (157), Expect = 4e-09 Identities = 27/41 (65%), Positives = 28/41 (68%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIAS 421 PPP PP PP LH PPPPP PPPPPPPPPP S S +S Sbjct: 178 PPPSPPLYPPPLHPPPPPPPPPPPPPPPPPPPPPSSHSSSS 218 [172][TOP] >UniRef100_B6Q311 Actin associated protein Wsp1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q311_PENMQ Length = 627 Score = 65.1 bits (157), Expect = 4e-09 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 7/46 (15%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH-------QPPPPPSVSKAPPPPPPPPP 445 PP IPPP PPPPPP PPPPP+ S APPPPPPPPP Sbjct: 483 PPSSGIPPPPPPPPPPPSSGAPPPPPPPPPPPASSGAPPPPPPPPP 528 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 7/50 (14%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPPPPPPPPPPKSLS 430 P PPP PPPPPP PPPPP S APPPPPPPPPP + S Sbjct: 468 PSSGAPPPPPPPPPPPPSSGIPPPPPPPPPPPSSGAPPPPPPPPPPPASS 517 Score = 62.0 bits (149), Expect = 3e-08 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Frame = -2 Query: 561 PPQKSIPPPH---PPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPPS PPPPPPPPPP S Sbjct: 476 PPPPPPPPPSSGIPPPPPP----PPPPPSSGAPPPPPPPPPPPAS 516 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S P PPPPPP PPPPS PPPPPPPPPP S Sbjct: 465 PPAPSSGAPPPPPPPP-----PPPPSSGIPPPPPPPPPPPSS 501 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKS--IPPPHP------PPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + +PPP P PPPPP PPPPP S PPPPPPPPP Sbjct: 454 PPSNTRLVPPPPPAPSSGAPPPPP----PPPPPPPSSGIPPPPPPPPP 497 [173][TOP] >UniRef100_Q9ESV6 Glyceraldehyde-3-phosphate dehydrogenase, testis-specific n=1 Tax=Rattus norvegicus RepID=G3PT_RAT Length = 432 Score = 65.1 bits (157), Expect = 4e-09 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 6/47 (12%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQP------PPPPSVSKAPPPPPPPPPPK 439 PP K PPP PPPPPP +P PPPP PPPPPPPPPPK Sbjct: 49 PPPKEEPPPPPPPPPPPQIEPEEPKEAPPPPPPPPPPPPPPPPPPPK 95 Score = 62.0 bits (149), Expect = 3e-08 Identities = 29/65 (44%), Positives = 36/65 (55%), Gaps = 8/65 (12%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPPPPPPPP-PPKSLSIASAKVRR 406 PP++ PPP PPPPPP + PPPPP PPPPPPPP P K L++ R Sbjct: 50 PPKEEPPPPPPPPPPPQIEPEEPKEAPPPPPPPPPPPPPPPPPPPKPAKELTVGINGFGR 109 Query: 405 VPEVV 391 + +V Sbjct: 110 IGRLV 114 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/48 (56%), Positives = 30/48 (62%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKSIPPP---HPPPPPPLLHQPPPPPSV-----SKAPPPPPPPPPP 442 PP+ PPP PPPPPP PPPPP + +APPPPPPPPPP Sbjct: 42 PPKVEEPPPPKEEPPPPPP----PPPPPQIEPEEPKEAPPPPPPPPPP 85 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 P PPPPPP + +PPPP + PPPPPPPPPP+ Sbjct: 34 PVIRPPPPPPKVEEPPPPKE--EPPPPPPPPPPPQ 66 [174][TOP] >UniRef100_Q10Q99 Formin-like protein 8 n=1 Tax=Oryza sativa Japonica Group RepID=FH8_ORYSJ Length = 892 Score = 65.1 bits (157), Expect = 4e-09 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 P + PPP PPPPPP PPPPP ++ AP PPPPPPPP S+ Sbjct: 345 PSNAPPPPPPPPPPP---PPPPPPKLNTAPKPPPPPPPPPSV 383 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP L+ P PP PPPPPPP P + Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPP-----PPPPPPPSVPSN 386 [175][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 64.7 bits (156), Expect = 5e-09 Identities = 30/75 (40%), Positives = 38/75 (50%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMR 367 +PPP PPPPPP PPPPP PPPPPPPPPP + K + + + L R Sbjct: 1474 LPPPPPPPPPPPPPPPPPPP-----PPPPPPPPPPLPRTPRGGKRKHKQQQQQQQPQLQR 1528 Query: 366 RDSTNSRRDSTGGGN 322 + ++R GN Sbjct: 1529 EEEVKAKRHRKSRGN 1543 [176][TOP] >UniRef100_UPI00016E7DED UPI00016E7DED related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7DED Length = 658 Score = 64.7 bits (156), Expect = 5e-09 Identities = 28/47 (59%), Positives = 31/47 (65%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA 418 PQ S PPP PPPPPP PPPP + + PPPPPPPPPP + SA Sbjct: 467 PQTSPPPPPPPPPPP---PPPPPAARTNVPPPPPPPPPPSMPTPGSA 510 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 10/50 (20%) Frame = -2 Query: 561 PP--QKSIPPPHPPPPPPLLHQP--------PPPPSVSKAPPPPPPPPPP 442 PP + ++PPP PPPPPP + P PPP+ + PPPPPPPPPP Sbjct: 485 PPAARTNVPPPPPPPPPPSMPTPGSAMGFEESPPPAPTPTPPPPPPPPPP 534 [177][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 64.7 bits (156), Expect = 5e-09 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PP PP PPPPPPPPPP S Sbjct: 1933 PPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPPS 1974 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPP P PPPPPPPPPP Sbjct: 1932 PPPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPP 1971 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P PPP PPPPPP PPP P+ PPPPPPPPPP Sbjct: 1926 PSSPETPPPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPP 1965 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/44 (54%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPP---PPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPP PP PPPPP PPPPPP PP+ Sbjct: 1935 PPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPPSAPPQ 1978 Score = 54.3 bits (129), Expect = 6e-06 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS 430 P + + P PPPPPP PPPPP PPPPPPPPP SLS Sbjct: 3058 PSKPLLQTPPPPPPPP----PPPPP-----PPPPPPPPPSSSLS 3092 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/49 (48%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPP---PPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIA 424 PP PPP PPP PPP PPPPP PPPPP PP L ++ Sbjct: 1936 PPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPPSAPPQVQLPVS 1984 [178][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 64.7 bits (156), Expect = 5e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1205 PPLTPPPPPLPPPPPPPPPLPPPPPPPPPLPPPPPPPPPP 1244 Score = 63.5 bits (153), Expect = 1e-08 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP +PPP PPPPP L PPPPP PPPPPPPPPP Sbjct: 1209 PPPPPLPPPPPPPPP--LPPPPPPPPPLPPPPPPPPPPPP 1246 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPL PPPPP + PPPPPP PPP Sbjct: 1204 PPPLTPPPPPLPPPPPPPPPLPPPPPPPPPLPPP 1237 [179][TOP] >UniRef100_Q17G68 Formin 1,2/cappuccino n=1 Tax=Aedes aegypti RepID=Q17G68_AEDAE Length = 891 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/48 (56%), Positives = 31/48 (64%), Gaps = 3/48 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH---QPPPPPSVSKAPPPPPPPPPPKSLSI 427 P +PPPHPPPPPP+ PP PP + PPPPPPPPP S+SI Sbjct: 301 PLPPPLPPPHPPPPPPMFKTAVAPPGPPPLPPPPPPPPPPPPISSVSI 348 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/56 (48%), Positives = 29/56 (51%), Gaps = 9/56 (16%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKA---------PPPPPPPPPPKSLSIAS 421 PP +PPP PPP H PPPPP A PPPPPPPPPP +S S Sbjct: 297 PPPPPLPPPLPPP-----HPPPPPPMFKTAVAPPGPPPLPPPPPPPPPPPPISSVS 347 Score = 54.7 bits (130), Expect = 5e-06 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPP----PPPPPPPPKSLSIAS 421 PPP PPPPPP + PPS S PP PPPPPPP L++ S Sbjct: 332 PPPPPPPPPPPISSVSIPPSTSGGPPAPPLPPPPPPPTAPLAVGS 376 [180][TOP] >UniRef100_B7QDE3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QDE3_IXOSC Length = 908 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPP PSV PPPPPPPPPP Sbjct: 737 PPPPPPPPPPPPPPPP----PPPCPSVGSIPPPPPPPPPP 772 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/50 (54%), Positives = 29/50 (58%), Gaps = 12/50 (24%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQP------PPPPSVS------KAPPPPPPPP 448 P SIPPP PPPPPP P PPPP V+ +APPPPPPPP Sbjct: 757 PSVGSIPPPPPPPPPPPTGVPCVAPPAPPPPPVAPPTGALQAPPPPPPPP 806 [181][TOP] >UniRef100_A9V3V4 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V3V4_MONBE Length = 2296 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 4/44 (9%) Frame = -2 Query: 561 PPQKSIPPPHPPPPP----PLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + PPP PPPPP P PPPPP V+ +PPPPPPPPPP Sbjct: 2122 PPAAASPPPPPPPPPAAASPPPPPPPPPPLVAASPPPPPPPPPP 2165 Score = 62.8 bits (151), Expect = 2e-08 Identities = 30/55 (54%), Positives = 33/55 (60%), Gaps = 7/55 (12%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPP-------PPKSLSIASA 418 PP + PPP PPPPPPL+ PPPP PPPPPPPP PP S +ASA Sbjct: 2135 PPAAASPPPPPPPPPPLVAASPPPP----PPPPPPPPPVAAPAPSPPPSPPVASA 2185 Score = 62.0 bits (149), Expect = 3e-08 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPP---LLHQPPPPPSVSKAPPPPPPPPPPKSLSIAS 421 PP + PPP PPPPPP PPPPP A PPPPPPPP L AS Sbjct: 2106 PPAATSPPPPPPPPPPPPAAASPPPPPPPPPAAASPPPPPPPPPPLVAAS 2155 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = -2 Query: 549 SIPPP---HPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 S PPP PPPPPP PPPPP + +PPPPPPPPP Sbjct: 2103 SPPPPAATSPPPPPP----PPPPPPAAASPPPPPPPPP 2136 [182][TOP] >UniRef100_C5P6Q6 WH1 domain containing protein n=1 Tax=Coccidioides posadasii C735 delta SOWgp RepID=C5P6Q6_COCP7 Length = 604 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/43 (67%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = -2 Query: 561 PPQKSIPP-PHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PP P PPPPPP PPPPPS + APPPPPPPP P S Sbjct: 450 PPSSSGPPAPGPPPPPP----PPPPPSAAPAPPPPPPPPMPSS 488 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PP P PPPP PPPPP S AP PPPPPPPP Sbjct: 449 PPPSSSGPPAPGPPPP----PPPPPPPSAAPAPPPPPPPP 484 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPL---LHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPP + + PPPPPP P S Sbjct: 456 PPAPGPPPPPPPPPPPSAAPAPPPPPPPPMPSSSGPPPPPPLPSS 500 [183][TOP] >UniRef100_UPI00015DEC3D chromodomain helicase DNA binding protein 3 n=1 Tax=Mus musculus RepID=UPI00015DEC3D Length = 78 Score = 64.3 bits (155), Expect = 6e-09 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP +PPP PP PPPL + PPPP + + PPPPPPPPPP+ Sbjct: 38 PPPPPLPPPPPPGPPPLPRRTPPPP-LPRPPPPPPPPPPPR 77 [184][TOP] >UniRef100_Q2NNS2 1629capsid n=1 Tax=Hyphantria cunea nucleopolyhedrovirus RepID=Q2NNS2_NPVHC Length = 539 Score = 64.3 bits (155), Expect = 6e-09 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 ++PPP PPPPP PPPPP + PPPPPPPPPP SL Sbjct: 238 NVPPPPTPPPPPPNMPPPPPPPPNMPPPPPPPPPPPLSL 276 Score = 60.1 bits (144), Expect = 1e-07 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PPP PPPPPP + PPPPP PPPPPPPPP LS+ Sbjct: 241 PPPTPPPPPPNMPPPPPPPPNM---PPPPPPPPPPPLSL 276 [185][TOP] >UniRef100_Q2L049 Filamentous hemagglutinin/adhesin n=1 Tax=Bordetella avium 197N RepID=Q2L049_BORA1 Length = 2621 Score = 64.3 bits (155), Expect = 6e-09 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 9/50 (18%) Frame = -2 Query: 561 PPQ--KSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPPPPPPPPPPK 439 PP+ K PPP PPPPPP + + PPPPP V K PPPPPPPPPK Sbjct: 2446 PPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPK 2495 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 5/46 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH----QPPPPPSVSKA-PPPPPPPPPPK 439 PP PPP PPPPP + PPPPP V K PPPPPPPPPPK Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPK 2366 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/49 (57%), Positives = 31/49 (63%), Gaps = 9/49 (18%) Frame = -2 Query: 561 PPQ--KSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPPPPPPPPPP 442 PP+ K PPP PPPPPP + + PPPPP V K PPPPPPPPP Sbjct: 2348 PPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2396 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/52 (57%), Positives = 33/52 (63%), Gaps = 11/52 (21%) Frame = -2 Query: 561 PPQ--KSIPPPHPPPPPPLLHQ--------PPPPPSVSKA-PPPPPPPPPPK 439 PP+ K PPP PPPPPP + + PPPPP V K PPPPPPPPPPK Sbjct: 2364 PPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPK 2415 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/49 (57%), Positives = 31/49 (63%), Gaps = 9/49 (18%) Frame = -2 Query: 561 PPQ--KSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPPPPPPPPPP 442 PP+ K PPP PPPPPP + + PPPPP V K PPPPPPPPP Sbjct: 2397 PPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2445 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/52 (57%), Positives = 33/52 (63%), Gaps = 11/52 (21%) Frame = -2 Query: 561 PPQ--KSIPPPHPPPPPPLLHQ--------PPPPPSVSKA-PPPPPPPPPPK 439 PP+ K PPP PPPPPP + + PPPPP V K PPPPPPPPPPK Sbjct: 2413 PPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPK 2464 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 8/43 (18%) Frame = -2 Query: 543 PPPHPPPPPPLLHQ-------PPPPPSVSKA-PPPPPPPPPPK 439 PPP PPPPPP + + PPPPP V K PPPPPPPPPPK Sbjct: 2389 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPK 2431 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 8/43 (18%) Frame = -2 Query: 543 PPPHPPPPPPLLHQ-------PPPPPSVSKA-PPPPPPPPPPK 439 PPP PPPPPP + + PPPPP V K PPPPPPPPPPK Sbjct: 2438 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPK 2480 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/48 (58%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Frame = -2 Query: 561 PPQKSIPPPHPPPPP------PLLHQPPPPPSVSKA-PPPPPPPPPPK 439 P K + PP PPPPP P PPPPP V K PPPPPPPPPPK Sbjct: 2335 PKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPK 2382 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 8/50 (16%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQ-----PPPPPSVSKA---PPPPPPPPPPKSL 433 P PPP PPPPPP + + PPPPP V K PPPPPPPP K + Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKV 2370 [186][TOP] >UniRef100_Q8GD27 Adhesin FhaB n=1 Tax=Bordetella avium RepID=Q8GD27_BORAV Length = 2621 Score = 64.3 bits (155), Expect = 6e-09 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 9/50 (18%) Frame = -2 Query: 561 PPQ--KSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPPPPPPPPPPK 439 PP+ K PPP PPPPPP + + PPPPP V K PPPPPPPPPK Sbjct: 2446 PPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPK 2495 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 5/46 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH----QPPPPPSVSKA-PPPPPPPPPPK 439 PP PPP PPPPP + PPPPP V K PPPPPPPPPPK Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPK 2366 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/49 (57%), Positives = 31/49 (63%), Gaps = 9/49 (18%) Frame = -2 Query: 561 PPQ--KSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPPPPPPPPPP 442 PP+ K PPP PPPPPP + + PPPPP V K PPPPPPPPP Sbjct: 2348 PPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2396 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/52 (57%), Positives = 33/52 (63%), Gaps = 11/52 (21%) Frame = -2 Query: 561 PPQ--KSIPPPHPPPPPPLLHQ--------PPPPPSVSKA-PPPPPPPPPPK 439 PP+ K PPP PPPPPP + + PPPPP V K PPPPPPPPPPK Sbjct: 2364 PPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPK 2415 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/49 (57%), Positives = 31/49 (63%), Gaps = 9/49 (18%) Frame = -2 Query: 561 PPQ--KSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPPPPPPPPPP 442 PP+ K PPP PPPPPP + + PPPPP V K PPPPPPPPP Sbjct: 2397 PPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2445 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/52 (57%), Positives = 33/52 (63%), Gaps = 11/52 (21%) Frame = -2 Query: 561 PPQ--KSIPPPHPPPPPPLLHQ--------PPPPPSVSKA-PPPPPPPPPPK 439 PP+ K PPP PPPPPP + + PPPPP V K PPPPPPPPPPK Sbjct: 2413 PPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPK 2464 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 8/43 (18%) Frame = -2 Query: 543 PPPHPPPPPPLLHQ-------PPPPPSVSKA-PPPPPPPPPPK 439 PPP PPPPPP + + PPPPP V K PPPPPPPPPPK Sbjct: 2389 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPK 2431 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 8/43 (18%) Frame = -2 Query: 543 PPPHPPPPPPLLHQ-------PPPPPSVSKA-PPPPPPPPPPK 439 PPP PPPPPP + + PPPPP V K PPPPPPPPPPK Sbjct: 2438 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPK 2480 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/48 (58%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Frame = -2 Query: 561 PPQKSIPPPHPPPPP------PLLHQPPPPPSVSKA-PPPPPPPPPPK 439 P K + PP PPPPP P PPPPP V K PPPPPPPPPPK Sbjct: 2335 PKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPK 2382 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 8/50 (16%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQ-----PPPPPSVSKA---PPPPPPPPPPKSL 433 P PPP PPPPPP + + PPPPP V K PPPPPPPP K + Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKV 2370 [187][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 64.3 bits (155), Expect = 6e-09 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP +PPPPP PPPP Sbjct: 221 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPPS PPPPPPPPPP S Sbjct: 217 PPPSPPPPPSPPPPPP----PPPPPS----PPPPPPPPPPPS 250 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPP PPPPP PPPPP S PPPPPPPPP Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 249 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/43 (60%), Positives = 26/43 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP S PPP PPPPPP PPPPP PPPP PPPP L Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPL 264 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/43 (62%), Positives = 28/43 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP S PPP PPPPPP PPPPPS PPPP PP PP S+ Sbjct: 234 PPPPSPPPPPPPPPPP---SPPPPPS----PPPPSPPLPPPSI 269 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P ++ P PPPPPP PPP P +PPPPPPPPPP S Sbjct: 197 PTSRASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPS 238 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PPP PPPPPS PPPPPPP PP Sbjct: 205 PPPPPPPPPSPSPPP----SPPPPPSPPPPPPPPPPPSPP 240 [188][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPPPP PPPPP PPPPPP PPP S Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPS 266 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P PPP PPPPPP PPPPP S PPPPPPPPPP Sbjct: 219 PVASPSPPPPPPPPPP----PPPPPPPSPPPPPPPPPPPP 254 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 S PPP PPPPPP PPPPPS PPPPPPPPPP Sbjct: 224 SPPPPPPPPPPP---PPPPPPSPPPPPPPPPPPPPP 256 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLS 430 PP PPP PPPPPP PPPPP PPP P PPPPK S Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPS 276 [189][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPPS PPPP PPPP Sbjct: 191 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 230 Score = 61.6 bits (148), Expect = 4e-08 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIAS 421 PP S PPP PPPP P PPPPP S PP PPPP PP + + Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPCKVCA 263 Score = 60.8 bits (146), Expect = 7e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PP PP S PP PPPPPPP Sbjct: 204 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PP PPP PPPPS PPP PPPPPP S Sbjct: 178 PPPPSPPPPPPPSPPP---PSPPPPSPPPPPPPSPPPPPPPS 216 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPP P PPPPP S PPPPP PPPP Sbjct: 187 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 220 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PPPP P PPPPPS PPPPPP PPP S Sbjct: 186 PPPPSPPPPSPPPPSP---PPPPPPS---PPPPPPPSPPPPS 221 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PP PP S PPPPP PPPP Sbjct: 212 PPPPSPPPPSPPPPSP---PPPSPPPPSPPPPPPPSPPPP 248 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PPPP P PPP +PPPPPPP PP Sbjct: 179 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 218 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP PPP PPP PP PPP P P PPPPPPP Sbjct: 177 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 215 Score = 54.3 bits (129), Expect = 6e-06 Identities = 22/40 (55%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PP PPPP P PP PP S PP PPPPPPP Sbjct: 168 PVTRGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 207 [190][TOP] >UniRef100_C1E983 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E983_9CHLO Length = 1724 Score = 64.3 bits (155), Expect = 6e-09 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPP+ + PPPPPP PPP Sbjct: 1142 PPPPSPPPPSPPPPPPPPPPAPPPPNANPLPPPPPPSPPP 1181 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PPP PPPPP H PPPPPS PPPPPP P P Sbjct: 82 PSPVASPPPDAPPPPPSPHPPPPPPS----PPPPPPTPTP 117 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKSIPPPHPPPPP--------PLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPP PL PPPPPS +PPPPPP PP Sbjct: 1147 PPPPSPPPPPPPPPPAPPPPNANPL--PPPPPPSPPPSPPPPPPDAPP 1192 [191][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 64.3 bits (155), Expect = 6e-09 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP PPPPPP PPPPP PPPPPPPPPP L Sbjct: 1 PPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPL 39 Score = 63.5 bits (153), Expect = 1e-08 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVR 409 PPP PPPPPP PPPPP PPPPPPPPPP + + K R Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGR 45 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/55 (52%), Positives = 33/55 (60%), Gaps = 3/55 (5%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP---PKSLSIASAKVRR 406 PP PPP PPPPPP PPPPP PPPPPPPPP PK + ++ + RR Sbjct: 4 PPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPLRAPKGRAPSAVRPRR 54 Score = 62.0 bits (149), Expect = 3e-08 Identities = 28/51 (54%), Positives = 28/51 (54%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVV 391 PPP PPPPPP PPPPP PPPPPPPPPP A R P V Sbjct: 4 PPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPSAV 50 [192][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 PP PPP PPPPPP PPPPP PPPPPPPPPP+ Sbjct: 78 PPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPR 114 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 60.8 bits (146), Expect = 7e-08 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P PP PPPPPP PPPPP PPPPPPPPPP Sbjct: 69 PAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPP--PPPKSL 433 PP + PPP PPPPPP P PPP+ APPP PP PPP L Sbjct: 150 PPAAAPPPPPPPPPPPSPPSPQPPPAPPAAPPPAAPPARPPPHPL 194 [193][TOP] >UniRef100_A0CZ14 Chromosome undetermined scaffold_31, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CZ14_PARTE Length = 417 Score = 64.3 bits (155), Expect = 6e-09 Identities = 30/53 (56%), Positives = 34/53 (64%), Gaps = 13/53 (24%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQ-----------PPPPPSV--SKAPPPPPPPPPP 442 P Q+S PPP PPPPPPL + PPPPP + S+APPPPPPPPPP Sbjct: 283 PQQQSPPPPPPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPP 335 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 8/42 (19%) Frame = -2 Query: 543 PPPHPPPPPPLLHQ--PPPPPSVSKAPP------PPPPPPPP 442 PPP PPPPPPL + PPPPP PP PPPPPPPP Sbjct: 310 PPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPP 351 Score = 55.5 bits (132), Expect = 3e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PPP PPPP P PPPPP + PPPPPPPP Sbjct: 339 PGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPP 377 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 P Q++ PPP PPP P PPPPP A PPPPPPPP Sbjct: 339 PGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPP 377 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/46 (56%), Positives = 29/46 (63%), Gaps = 12/46 (26%) Frame = -2 Query: 543 PPPHPPPPPPLLHQ----PPPPPSV--SKAPPPPPP------PPPP 442 PPP PPPPPP+ Q PPPPP + +APPPPPP PPPP Sbjct: 328 PPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPP 373 [194][TOP] >UniRef100_A0BFK7 Chromosome undetermined scaffold_104, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BFK7_PARTE Length = 1152 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP KS P P PPPPP + PPPPP KA PPPPPPPP Sbjct: 611 PPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPP 649 Score = 60.8 bits (146), Expect = 7e-08 Identities = 27/51 (52%), Positives = 31/51 (60%), Gaps = 11/51 (21%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPL----LHQPPPPPSVSKAPPPPP-------PPPPP 442 P S+PPP PPPPPP+ L PPPPP ++ PPPPP PPPPP Sbjct: 597 PNAPSLPPPPPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPPP 647 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = -2 Query: 561 PPQKSIPPPHPPPP----PPLLHQPPPPPSVSKAPPPPPPPPP 445 PP K+ PPP PPPP PP PPPPP SKA PPPPPPP Sbjct: 636 PPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPP 678 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQ---PPPPPSVSKAPPPPPPPPPPKS 436 PP PP PPPPPP + PPPPP A PPPPPPPP K+ Sbjct: 596 PPNAPSLPPPPPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKA 640 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/43 (55%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLL---HQPPPPPSVSKAPPPPPPPPPP 442 PP I P PPPPPP+ PPPPP V + P PPPPPPP Sbjct: 622 PPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPP 664 [195][TOP] >UniRef100_C5JWB6 Putative uncharacterized protein n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JWB6_AJEDS Length = 673 Score = 64.3 bits (155), Expect = 6e-09 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 P ++ PP PPPPP + +PPPPPSV PPPPPPPPP Sbjct: 525 PAPSTVAPPPPPPPPAGVARPPPPPSVGSPPPPPPPPPP 563 Score = 56.2 bits (134), Expect = 2e-06 Identities = 30/64 (46%), Positives = 32/64 (50%), Gaps = 7/64 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPP-------PPPKSLSIASAKVRRV 403 PP S P P PPPPP P P PS S APPPPPPP PPP + S+ R Sbjct: 471 PPPISAPAPPTPPPPP----PAPAPSSSPAPPPPPPPVSTGPPPPPPSTGSLPRPPPRPA 526 Query: 402 PEVV 391 P V Sbjct: 527 PSTV 530 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/55 (45%), Positives = 26/55 (47%), Gaps = 9/55 (16%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP---------PPPPPPKSLSIA 424 P S P P PPPPP PPPPPS P PP PPPPPP +A Sbjct: 489 PAPSSSPAPPPPPPPVSTGPPPPPPSTGSLPRPPPRPAPSTVAPPPPPPPPAGVA 543 [196][TOP] >UniRef100_C5GB40 Actin associated protein Wsp1 n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GB40_AJEDR Length = 673 Score = 64.3 bits (155), Expect = 6e-09 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 P ++ PP PPPPP + +PPPPPSV PPPPPPPPP Sbjct: 525 PAPSTVAPPPPPPPPAGVARPPPPPSVGSPPPPPPPPPP 563 Score = 54.7 bits (130), Expect = 5e-06 Identities = 29/64 (45%), Positives = 31/64 (48%), Gaps = 7/64 (10%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP-------PPPPPPKSLSIASAKVRRV 403 PP S P P PPPPP P P PS S APPPP PPPPPP + + R Sbjct: 471 PPPISAPAPPTPPPPP----PAPAPSSSPAPPPPPPPVNTGPPPPPPSTGGLPRPPPRPA 526 Query: 402 PEVV 391 P V Sbjct: 527 PSTV 530 [197][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 64.3 bits (155), Expect = 6e-09 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 1016 PVSAPAPPPPPPPPPPPPPPPPPPPGAIGVPPPPPPPPPP 1055 Score = 62.0 bits (149), Expect = 3e-08 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPP ++ PPPPPPPPPP Sbjct: 1023 PPPPPPPPPPPPPPPPPPGAIGVPPPPPPPPPPP 1056 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/51 (49%), Positives = 27/51 (52%), Gaps = 11/51 (21%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPP-----------SVSKAPPPPPPPPPP 442 PP PPP PPPPP + PPPPP + PPPPPPPPPP Sbjct: 1026 PPPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPPPPPPP 1076 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/48 (54%), Positives = 27/48 (56%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPP-LLHQPPPPPSVSKAPPP-------PPPPPPP 442 PP PPP PPPPPP + PPPPP PPP PPPPPPP Sbjct: 1025 PPPPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPPP 1072 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 7/47 (14%) Frame = -2 Query: 561 PPQKSIPPPHPPP-------PPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PPP PPPP PPPPPPPPPP Sbjct: 1046 PPPPPPPPPPPPPGGKGMGVPPPPPPPPPPPGFGGGMPPPPPPPPPP 1092 [198][TOP] >UniRef100_UPI0001552F36 PREDICTED: similar to SH3 domain binding protein n=1 Tax=Mus musculus RepID=UPI0001552F36 Length = 455 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK 415 PP PPP PPPPPP L PPPPP APPPPPPP PP S S + Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPP--LGAPPPPPPPGPPVSTDTPSLR 50 [199][TOP] >UniRef100_UPI0001552DAA PREDICTED: similar to CR16 n=1 Tax=Mus musculus RepID=UPI0001552DAA Length = 483 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK 415 PP PPP PPPPPP L PPPPP APPPPPPP PP S S + Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPP--LGAPPPPPPPGPPVSTDTPSLR 50 [200][TOP] >UniRef100_UPI00016E9BFD UPI00016E9BFD related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E9BFD Length = 941 Score = 63.9 bits (154), Expect = 8e-09 Identities = 31/72 (43%), Positives = 37/72 (51%), Gaps = 7/72 (9%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPP-------PPPPKSLSIASAKVRRVP 400 P S PPP PPPPPP PPPPP PPPPPP PPPP SL + P Sbjct: 413 PDLSXPPPPPPPPPPGGGPPPPPPPPGCGPPPPPPFFGGPGGPPPPPSLPVVKLPYGLQP 472 Query: 399 EVVEFYHSLMRR 364 + + ++M+R Sbjct: 473 KKIYKPETVMKR 484 [201][TOP] >UniRef100_UPI00016E9BE4 UPI00016E9BE4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E9BE4 Length = 944 Score = 63.9 bits (154), Expect = 8e-09 Identities = 31/72 (43%), Positives = 37/72 (51%), Gaps = 7/72 (9%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPP-------PPPPKSLSIASAKVRRVP 400 P S PPP PPPPPP PPPPP PPPPPP PPPP SL + P Sbjct: 413 PDLSXPPPPPPPPPPGGGPPPPPPPPGCGPPPPPPFFGGPGGPPPPPSLPVVKLPYGLQP 472 Query: 399 EVVEFYHSLMRR 364 + + ++M+R Sbjct: 473 KKIYKPETVMKR 484 [202][TOP] >UniRef100_B9H7Q5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H7Q5_POPTR Length = 173 Score = 63.9 bits (154), Expect = 8e-09 Identities = 31/53 (58%), Positives = 34/53 (64%), Gaps = 12/53 (22%) Frame = -2 Query: 561 PPQKSIPPPHPP------PPPPLLHQPPPPPS--VSKAPPPPPP----PPPPK 439 PP+KS PPP PP PPPP +H PPPPP K+PPPPPP PPPPK Sbjct: 36 PPKKSPPPPPPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPPPVHKSPPPPK 88 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/53 (52%), Positives = 30/53 (56%), Gaps = 13/53 (24%) Frame = -2 Query: 561 PPQKSIPPPHPP-----PPPPLLHQPPPP--PSVSKAPPPPPP------PPPP 442 P KS PPP P PPPP +H PPPP P K+PPPPPP PPPP Sbjct: 79 PVHKSPPPPKKPYKYKSPPPPPVHSPPPPSHPYKYKSPPPPPPVYKYKSPPPP 131 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 11/50 (22%) Frame = -2 Query: 561 PPQKSIPPPHP-----PPPPPLLHQPPPPPSVS---KAPPPPP---PPPP 445 P PPPHP PPPPP +H+ PPPP K+PPPPP PPPP Sbjct: 58 PVHSPPPPPHPYKYKSPPPPPPVHKSPPPPKKPYKYKSPPPPPVHSPPPP 107 [203][TOP] >UniRef100_A4HZX9 Putative uncharacterized protein n=1 Tax=Leishmania infantum RepID=A4HZX9_LEIIN Length = 790 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 6/60 (10%) Frame = -2 Query: 561 PPQKSIPPPHPP---PPPPLLHQPPPPPSVSKAPPPPPP---PPPPKSLSIASAKVRRVP 400 PP S+PPP P PPPP + PPPPPS + PPPPP PPPP ++S+ VP Sbjct: 369 PPAASVPPPPPAVSVPPPPAVSVPPPPPSAASVPPPPPAASVPPPPPAVSVPPPPAVSVP 428 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 6/50 (12%) Frame = -2 Query: 561 PPQKSIPPPHPP---PPPPLLHQPPPPPSVSKAPPPPPP---PPPPKSLS 430 PP S+PPP P PPPP + PPPPPS + PPPPP PPPP+S S Sbjct: 405 PPAASVPPPPPAVSVPPPPAVSVPPPPPSAASVPPPPPAASVPPPPRSAS 454 Score = 61.2 bits (147), Expect(2) = 3e-08 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 7/52 (13%) Frame = -2 Query: 561 PPQKSIPPPHP-----PPPPPLLHQPPPPPSVSKAPPP--PPPPPPPKSLSI 427 PP S+PPP P PPPPP PPPPP+VS PPP PPPPP + S+ Sbjct: 350 PPAASVPPPPPAVSVPPPPPPAASVPPPPPAVSVPPPPAVSVPPPPPSAASV 401 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 Query: 338 PPAVETPPRKQYLLTPTP 285 PPAV PP + P P Sbjct: 414 PPAVSVPPPPAVSVPPPP 431 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 7/52 (13%) Frame = -2 Query: 561 PPQKSIPPPHP-----PPPPPLLHQPPPPPSVSKAPPP--PPPPPPPKSLSI 427 PP S+PPP P PPPPP PPPPP+VS PPP PPPPP + S+ Sbjct: 386 PPAVSVPPPPPSAASVPPPPPAASVPPPPPAVSVPPPPAVSVPPPPPSAASV 437 Score = 57.4 bits (137), Expect = 7e-07 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 6/51 (11%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAPPPPP--PPPPPKSLSI 427 P S+PPP P PPPPP + PPPPP + PPPPP PPP ++S+ Sbjct: 341 PSAASVPPPPPAASVPPPPPAVSVPPPPPPAASVPPPPPAVSVPPPPAVSV 391 Score = 55.5 bits (132), Expect = 3e-06 Identities = 28/61 (45%), Positives = 31/61 (50%), Gaps = 7/61 (11%) Frame = -2 Query: 561 PPQKSIPPPH----PPPPPPLLHQPPPPPSVSKAPPPP---PPPPPPKSLSIASAKVRRV 403 PP S+PPP PPPPP PPPPP+ S PPPP PPPP S+ V Sbjct: 378 PPAVSVPPPPAVSVPPPPPSAASVPPPPPAASVPPPPPAVSVPPPPAVSVPPPPPSAASV 437 Query: 402 P 400 P Sbjct: 438 P 438 Score = 54.7 bits (130), Expect = 5e-06 Identities = 24/46 (52%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = -2 Query: 528 PPPPPLLHQPPPPPSVSKAPPPPPP---PPPPKSLSIASAKVRRVP 400 PPPPP PPPPP+VS PPPPP PPPP ++S+ VP Sbjct: 347 PPPPPAASVPPPPPAVSVPPPPPPAASVPPPPPAVSVPPPPAVSVP 392 [204][TOP] >UniRef100_Q5KG31 Putative uncharacterized protein n=1 Tax=Filobasidiella neoformans RepID=Q5KG31_CRYNE Length = 464 Score = 63.9 bits (154), Expect = 8e-09 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPP--PPSVSKAPPPPPPPPPP 442 P S+PPP PPPPPP PP PPS APPPPPPPPPP Sbjct: 272 PSAPSVPPPPPPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPP 313 Score = 57.4 bits (137), Expect = 7e-07 Identities = 37/107 (34%), Positives = 46/107 (42%), Gaps = 25/107 (23%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPP---PPPPPPPP---------- 442 PP PP PPPPPP + PPPPP PP PPPPPPPP Sbjct: 297 PPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPPPPPTSAPSAPPLP 356 Query: 441 -----KSLSIASAKVRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAA 316 +S +AS + R V HSL + D + + + GG+ A Sbjct: 357 TASGGRSALLASIQGRGV-------HSLKKVDPSEQKVSALAGGDTA 396 [205][TOP] >UniRef100_Q55RM6 Putative uncharacterized protein n=1 Tax=Filobasidiella neoformans RepID=Q55RM6_CRYNE Length = 458 Score = 63.9 bits (154), Expect = 8e-09 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S+PPP PPPPPP +P PPS APPPPPPPPPP Sbjct: 272 PSAPSVPPPPPPPPPP--GRPAAPPSAPSAPPPPPPPPPP 309 Score = 57.4 bits (137), Expect = 7e-07 Identities = 37/107 (34%), Positives = 46/107 (42%), Gaps = 25/107 (23%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQ-------PPPPPSVSKAPP---PPPPPPPP---------- 442 PP PP PPPPPP + PPPPP PP PPPPPPPP Sbjct: 293 PPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPPPPPTSAPSAPPLP 352 Query: 441 -----KSLSIASAKVRRVPEVVEFYHSLMRRDSTNSRRDSTGGGNAA 316 +S +AS + R V HSL + D + + + GG+ A Sbjct: 353 TASGGRSALLASIQGRGV-------HSLKKVDPSEQKVSALAGGDTA 392 [206][TOP] >UniRef100_P0C7L0-2 Isoform 2 of WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=P0C7L0-2 Length = 451 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK 415 PP PPP PPPPPP L PPPPP APPPPPPP PP S S + Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPP--LGAPPPPPPPGPPVSTDTPSLR 50 [207][TOP] >UniRef100_P0C7L0 WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=WIPF3_MOUSE Length = 485 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK 415 PP PPP PPPPPP L PPPPP APPPPPPP PP S S + Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPP--LGAPPPPPPPGPPVSTDTPSLR 50 [208][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 63.5 bits (153), Expect = 1e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP V PPPPP PPPP Sbjct: 140 PPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPP 179 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 5/45 (11%) Frame = -2 Query: 561 PPQKSIPPPHPPPP-----PPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP PP+ PPPPP PPPPPPPPPP Sbjct: 114 PPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPP 158 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/44 (61%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPP-SVSKAPPPPPPPPPPKSL 433 PP PPP PPPPPP++ PPPPP AP PPPPPPPP L Sbjct: 150 PPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCL 193 Score = 61.6 bits (148), Expect = 4e-08 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP P P PPPPPP PPPPP + PPPPPPPPPP Sbjct: 110 PPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPP 149 Score = 61.2 bits (147), Expect = 5e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PPPP PPPPP PPPPPPPPPP Sbjct: 164 PPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPPP 203 Score = 60.5 bits (145), Expect = 9e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 132 PPPMCAPPPPPPPPPP----PPPPP-----PPPPPPPPPP 162 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PP PPPPP PPPPP PPPPPPPPPP Sbjct: 120 PPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPP 159 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 133 PPMCAPPPPPPPPPPP----PPPPP-----PPPPPPPPPP 163 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPP P PPPPP PPPPPPPPPP Sbjct: 172 PPPCPPPPAPCPPPPPPPPMCLPPPPPPPPPPPP 205 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PP PPPPPP PPPPP PPPPPPPPPP Sbjct: 131 PPPPMCAPPPPPPPPPPPPPPPPPP-----PPPPPPPPPP 165 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PPPPP P P PPPPPP Sbjct: 189 PPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAPCPPPPPP 228 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSK-----APPPPPPPPPP 442 PP PPP PPPP P PPPPP APPPPPPPPPP Sbjct: 103 PPGCGPPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPP 147 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 561 PPQKSIPPPHP-PPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PPPPP PPPP + PPPPPPPPPP Sbjct: 108 PPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPP 148 Score = 57.4 bits (137), Expect = 7e-07 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPP---PPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP PP PPPPP PPPPP PPPP Sbjct: 177 PPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPPCPPPP 219 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PPP PPPPPP PPPPP P PPPPPPP Sbjct: 196 PPPPPPPPPPCPLPPPPPPCPPPPAPCPPPPPPP 229 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Frame = -2 Query: 561 PPQKSIPPPH-----PPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP+ PPPPP P P PPPPPP Sbjct: 170 PPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPP 214 [209][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 63.5 bits (153), Expect = 1e-08 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 +PPP PPPPPP PPPPP PPPPPPPPPP Sbjct: 14 LPPPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPPP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPPPPP PPPPP PPPPPPPPPP L Sbjct: 16 PPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPPPPLPL 52 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/45 (57%), Positives = 27/45 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PP PPP PPPPP PPPPP PPPPPPPPPP L + Sbjct: 16 PPLPPPPPPPRPPPPP----PPPPP----PPPPPPPPPPPPPLPL 52 [210][TOP] >UniRef100_UPI0000D9A916 PREDICTED: similar to leiomodin 2 (cardiac) isoform 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9A916 Length = 552 Score = 63.5 bits (153), Expect = 1e-08 Identities = 30/58 (51%), Positives = 34/58 (58%) Frame = -2 Query: 540 PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMR 367 PP PPPPPP PPPPPS + PPPPPPPPPP L R + EV++ S R Sbjct: 420 PPPPPPPPP----PPPPPSSQRLPPPPPPPPPP--LPEKKLITRNIAEVIKQQESAQR 471 [211][TOP] >UniRef100_UPI0000D9A914 PREDICTED: similar to leiomodin 2 (cardiac) isoform 3 n=1 Tax=Macaca mulatta RepID=UPI0000D9A914 Length = 547 Score = 63.5 bits (153), Expect = 1e-08 Identities = 30/58 (51%), Positives = 34/58 (58%) Frame = -2 Query: 540 PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYHSLMR 367 PP PPPPPP PPPPPS + PPPPPPPPPP L R + EV++ S R Sbjct: 420 PPPPPPPPP----PPPPPSSQRLPPPPPPPPPP--LPEKKLITRNIAEVIKQQESAQR 471 [212][TOP] >UniRef100_A5VB72 Filamentous haemagglutinin family outer membrane protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5VB72_SPHWW Length = 1531 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + PP PPPPPP+ PPPPP +PPPPPPPPPP Sbjct: 1280 PPPPPVSPPPPPPPPPVSPPPPPPPV---SPPPPPPPPPP 1316 Score = 62.0 bits (149), Expect = 3e-08 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPP--PPPP 442 PP + PP PPPPPP+ PPPPP PPPPPP PPPP Sbjct: 1269 PPPPPVSPPPPPPPPPVSPPPPPPPPPVSPPPPPPPVSPPPP 1310 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPP--PPPPP 442 PP PPP PPPPP PPPPP VS PPPPP PPPPP Sbjct: 1270 PPPPVSPPPPPPPPPVSPPPPPPPPPVSPPPPPPPVSPPPPP 1311 Score = 61.6 bits (148), Expect = 4e-08 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = -2 Query: 552 KSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 +++ PP PPPPPP + PPPPP +PPPPPPPPP Sbjct: 1260 RAVSPPPPPPPPPPVSPPPPPPPPPVSPPPPPPPPP 1295 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/43 (58%), Positives = 27/43 (62%), Gaps = 5/43 (11%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPP-----PPPPPKSLS 430 PPP PPPPPP+ PPPPP PPPPP PPPPP +S Sbjct: 1264 PPPPPPPPPPVSPPPPPPPPPVSPPPPPPPPPVSPPPPPPPVS 1306 [213][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP L PP PP +PPPP PPPPP Sbjct: 1209 PPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPPPPSPPPPP 1248 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPPL P PPP PPP PPPPPP Sbjct: 1210 PPSPPPPPPPPPPPPPLPPPPSPPPPPPSPPPPSPPPPPP 1249 Score = 61.2 bits (147), Expect = 5e-08 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP+ + PPP PPPPPP PPP P PPPPP PPPP Sbjct: 1203 PPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPPPP 1242 [214][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 63.5 bits (153), Expect = 1e-08 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 14/66 (21%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLL--------HQPPPPPSVSKAPPPP------PPPPPPKSLSIA 424 PP PPP PPPPPP L PPPPP SK+PPPP PPPPPP+ S Sbjct: 42 PPPPFPPPPSPPPPPPPLPPPPSPPPPPPPPPPPPSKSPPPPPRKKLQPPPPPPRDRSTG 101 Query: 423 SAKVRR 406 + RR Sbjct: 102 NVMRRR 107 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/54 (50%), Positives = 27/54 (50%), Gaps = 14/54 (25%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPP--------------PPPP 442 PP S PPP PPPPPP PPPPP PPPPPP PPPP Sbjct: 60 PPPPSPPPPPPPPPPPPSKSPPPPPRKKLQPPPPPPRDRSTGNVMRRRSHPPPP 113 Score = 58.2 bits (139), Expect = 4e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S PPP PPPP P PPPPP + P PPPPPPPP Sbjct: 38 PPPSPPPPFPPPPSP----PPPPPPLPPPPSPPPPPPPP 72 Score = 57.0 bits (136), Expect = 1e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P PPP PPPP P PPPPP PP PPPPPPP Sbjct: 33 PSPPSPPPSPPPPFPPPPSPPPPPPPLPPPPSPPPPPPP 71 [215][TOP] >UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA Length = 688 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + PP PPPP P PPPPP K PPPPPPPPPP Sbjct: 207 PPAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPP 246 Score = 62.0 bits (149), Expect = 3e-08 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP P P PPPPP +PPPPP PPPPPPPPPP Sbjct: 206 PPPAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPP 245 Score = 62.0 bits (149), Expect = 3e-08 Identities = 26/49 (53%), Positives = 29/49 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK 415 PP K PPP PPPPPP +P PP PPPP PPPP S+ I S + Sbjct: 230 PPPKPKPPPPPPPPPPPAPKPSPPTPPPTTPPPPTAPPPPPSVPIPSGQ 278 Score = 60.5 bits (145), Expect = 9e-08 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPK 439 +PPP PPPP P PPPPP K PPPPPPP PK Sbjct: 200 VPPPPPPPPAPAPTPPPPPPPAPKPKPPPPPPPKPK 235 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQP-PPPPSVSKAPPPPPPPPPP 442 PP P P PPPPPP +P PPPP K PPPPPPPPP Sbjct: 204 PPPPPAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPP 244 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP P P PPPPPP +PPPPP PPPPPP P P Sbjct: 216 PPPPPAPKPKPPPPPPPKPKPPPPP-----PPPPPPAPKP 250 [216][TOP] >UniRef100_A0DA74 Chromosome undetermined scaffold_43, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0DA74_PARTE Length = 1401 Score = 63.5 bits (153), Expect = 1e-08 Identities = 30/53 (56%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPP-----LLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA 418 P KS PPP PPPPPP PPPPP SK PPPPPPPPP SA Sbjct: 834 PGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSA 886 Score = 61.2 bits (147), Expect = 5e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S P PPPPPP PPPPP APPPPPPPPPP Sbjct: 814 PPGGSKTLPRPPPPPP----PPPPPGGKSAPPPPPPPPPP 849 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = -2 Query: 561 PPQKSIPPPHP-----PPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP P PPPPP PPPPP APPPPPPPPPP S Sbjct: 824 PPPPPPPPPPPGGKSAPPPPP----PPPPPGGKGAPPPPPPPPPPGS 866 [217][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 5/68 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSV-----SKAPPPPPPPPPPKSLSIASAKVRRVPE 397 PP PPP PPPPPP PPPPP++ S PPPP PPPP S + + + + + Sbjct: 843 PPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDPSGSDLPQDTK 902 Query: 396 VVEFYHSL 373 V+++Y +L Sbjct: 903 VLQYYFNL 910 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVP 400 S+PPP PPPPPP PPPPP PPPPPPPPPP +L + + P Sbjct: 839 SLPPPPPPPPPP----PPPPPP----PPPPPPPPPPPALDVGETSNLQPP 880 [218][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 5/68 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSV-----SKAPPPPPPPPPPKSLSIASAKVRRVPE 397 PP PPP PPPPPP PPPPP++ S PPPP PPPP S + + + + + Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDPSGSDLPQDTK 980 Query: 396 VVEFYHSL 373 V+++Y +L Sbjct: 981 VLQYYFNL 988 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVP 400 S+PPP PPPPPP PPPPP PPPPPPPPPP +L + + P Sbjct: 917 SLPPPPPPPPPP----PPPPPP----PPPPPPPPPPPALDVGETSNLQPP 958 [219][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 5/68 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSV-----SKAPPPPPPPPPPKSLSIASAKVRRVPE 397 PP PPP PPPPPP PPPPP++ S PPPP PPPP S + + + + + Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDPSGSDLPQDTK 980 Query: 396 VVEFYHSL 373 V+++Y +L Sbjct: 981 VLQYYFNL 988 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVP 400 S+PPP PPPPPP PPPPP PPPPPPPPPP +L + + P Sbjct: 917 SLPPPPPPPPPP----PPPPPP----PPPPPPPPPPPALDVGETSNLQPP 958 [220][TOP] >UniRef100_C6HGV1 Cytokinesis protein SepA/Bni1 n=1 Tax=Ajellomyces capsulatus H143 RepID=C6HGV1_AJECH Length = 1711 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + P PPPPPP PPPPP +S PPPPPPPPPP Sbjct: 967 PPPPGVGAPPPPPPPP----PPPPPGISGPPPPPPPPPPP 1002 Score = 61.6 bits (148), Expect = 4e-08 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PP PPPPPP PPPPP V PPPPPPPPPP Sbjct: 950 PKVEDAVPPGPPPPPP----PPPPPGVGAPPPPPPPPPPP 985 Score = 57.8 bits (138), Expect = 6e-07 Identities = 30/66 (45%), Positives = 33/66 (50%), Gaps = 12/66 (18%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPL----LHQPPPPPSVSKAPPPPPPP--------PPPKSLSIASA 418 PP S PPP PPPPPP PPPPP + PPPPPPP PPP S+ Sbjct: 986 PPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPPGASMGGW 1045 Query: 417 KVRRVP 400 K +P Sbjct: 1046 KKTYLP 1051 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSI---PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP I PPP PPPPPP + PPPPP PPPPPPPP Sbjct: 984 PPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPP 1026 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 4/37 (10%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAP----PPPPPPPP 445 PPP PPPPPP + PPPPP P PPPPPPPP Sbjct: 978 PPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPP 1014 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 13/53 (24%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH---------QPPPPPSVSKAPPPPPPP----PPP 442 PP PPP PPPPPP PPPPP V PPPPPPP PPP Sbjct: 969 PPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPP 1021 [221][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 63.5 bits (153), Expect = 1e-08 Identities = 27/45 (60%), Positives = 30/45 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSI 427 PP S P P PPPPPP PPPP+ + PPPPPPPPPP S S+ Sbjct: 144 PPPSSAPLPQPPPPPP-----PPPPASAPPPPPPPPPPPPISPSL 183 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S PPP PP PL PPPPP A PPPPPPPP Sbjct: 135 PHTPSSPPPPPPSSAPLPQPPPPPPPPPPASAPPPPPPPP 174 [222][TOP] >UniRef100_C0NZQ8 Cytokinesis protein SepA/Bni1 n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NZQ8_AJECG Length = 1741 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP + P PPPPPP PPPPP +S PPPPPPPPPP Sbjct: 997 PPPPGVGAPPPPPPPP----PPPPPGISGPPPPPPPPPPP 1032 Score = 61.6 bits (148), Expect = 4e-08 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P + PP PPPPPP PPPPP V PPPPPPPPPP Sbjct: 980 PKVEDAVPPGPPPPPP----PPPPPGVGAPPPPPPPPPPP 1015 Score = 57.8 bits (138), Expect = 6e-07 Identities = 30/66 (45%), Positives = 33/66 (50%), Gaps = 12/66 (18%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPL----LHQPPPPPSVSKAPPPPPPP--------PPPKSLSIASA 418 PP S PPP PPPPPP PPPPP + PPPPPPP PPP S+ Sbjct: 1016 PPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPPGASMGGW 1075 Query: 417 KVRRVP 400 K +P Sbjct: 1076 KKTYLP 1081 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSI---PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP I PPP PPPPPP + PPPPP PPPPPPPP Sbjct: 1014 PPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPP 1056 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 4/37 (10%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAP----PPPPPPPP 445 PPP PPPPPP + PPPPP P PPPPPPPP Sbjct: 1008 PPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPP 1044 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 13/53 (24%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLH---------QPPPPPSVSKAPPPPPPP----PPP 442 PP PPP PPPPPP PPPPP V PPPPPPP PPP Sbjct: 999 PPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPP 1051 [223][TOP] >UniRef100_B8PC49 Predicted protein n=1 Tax=Postia placenta Mad-698-R RepID=B8PC49_POSPM Length = 642 Score = 63.5 bits (153), Expect = 1e-08 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S PPP PPPPPPL +P P P +A PPPPPPPPP Sbjct: 394 PSAPSPPPPPPPPPPPLAAEPEPEPEPEEAAPPPPPPPPP 433 [224][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 61.2 bits (147), Expect(2) = 1e-08 Identities = 29/54 (53%), Positives = 31/54 (57%), Gaps = 7/54 (12%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPP----PP---SVSKAPPPPPPPPPPKSLSIAS 421 PP PPP PPPPPP QPPP PP S PPPPPPPPPP + + S Sbjct: 489 PPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPS 542 Score = 21.9 bits (45), Expect(2) = 1e-08 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 362 TPQTREEIPPAVETPPRKQYLLTPTP 285 +P R PP P R + ++TP P Sbjct: 578 SPSPRPPPPPPRPRPSRPRPIITPKP 603 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/38 (60%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = -2 Query: 543 PPPHPPPPPPLLHQ---PPPPPSVSKAPPPPPPPPPPK 439 PP PPPPPP+ + PPPPP PPPPPPPPPP+ Sbjct: 61 PPSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPR 98 Score = 56.6 bits (135), Expect(2) = 2e-07 Identities = 25/42 (59%), Positives = 28/42 (66%), Gaps = 6/42 (14%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQ---PPPPPSVSKA---PPPPPPPPPP 442 S PPP PPPPPP+ + PPPPPS+ P PPPPPPPP Sbjct: 524 SPPPPPPPPPPPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPP 565 Score = 22.3 bits (46), Expect(2) = 2e-07 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 359 PQTREEIPPAVETPPRKQYLLTPTP 285 P +PP TP + YL PTP Sbjct: 605 PPRATYLPPPRLTPQPRTYLPPPTP 629 Score = 57.4 bits (137), Expect = 7e-07 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 13/53 (24%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPP-------------PPPPPPPP 442 PP PPP PPPPPP PPPPP S+ PP PPPPPPPP Sbjct: 481 PPSSPSPPP-PPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPP 532 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P P P PPPPP + P PPP PPPPPPPPPP Sbjct: 57 PSHQPPSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPP 95 Score = 48.1 bits (113), Expect(2) = 4e-06 Identities = 22/43 (51%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPP---PSVSKAPPPPPPPPPP 442 P + P P PPPPPP + P P PS S PPPPPP P P Sbjct: 550 PVTYNYPSPPPPPPPPSYNYPAPTYYYPSPSPRPPPPPPRPRP 592 Score = 26.6 bits (57), Expect(2) = 4e-06 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 362 TPQTREEIPPAVETPPRKQYLLTPTPET 279 TPQ R +PP TP Y P P++ Sbjct: 617 TPQPRTYLPPPTPTPQTFTYSQPPAPQS 644 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/46 (56%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPP--PPPKSLS 430 PP + P PPPPPP PPPPP + PPPPPPP PPP SL+ Sbjct: 477 PPSRPPSSPSPPPPPP----PPPPP---RPPPPPPPPSQPPPTSLT 515 [225][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/43 (60%), Positives = 27/43 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP +PPP P PPPP L PPPPP PPP PPPPPP L Sbjct: 77 PPPPPLPPPPPLPPPPPLPPPPPPPPPLPPPPPLPPPPPPPPL 119 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/43 (58%), Positives = 27/43 (62%), Gaps = 7/43 (16%) Frame = -2 Query: 549 SIPPPHP-------PPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 S+PPP P PPPPPL PPPPP + PP PPPPPPP Sbjct: 75 SVPPPPPLPPPPPLPPPPPLPPPPPPPPPLPPPPPLPPPPPPP 117 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/43 (60%), Positives = 26/43 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP PPPPPP PPPPP PPPPPPPP P L Sbjct: 85 PPPLPPPPPLPPPPPPPPPLPPPPP----LPPPPPPPPLPPPL 123 [226][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/47 (59%), Positives = 29/47 (61%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRV 403 PPP PPPPPP PPPPP PPPPPPPPPP + A A R V Sbjct: 654 PPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPDVLAADAFDRTV 696 Score = 61.2 bits (147), Expect = 5e-08 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASA 418 PPP PPPPPP PPPPP PPPPPPPPPP + +A Sbjct: 652 PPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPPDVLAA 689 Score = 54.3 bits (129), Expect = 6e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPP 448 PP PPP PPPPPP PPPPP PPPPPPPP Sbjct: 656 PPPPPPPPPPPPPPPP----PPPPP-----PPPPPPPP 684 [227][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P K PPP PPPPPP PPP P PPPPPPPPPP Sbjct: 86 PNKVPPPPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPP 124 Score = 63.2 bits (152), Expect = 1e-08 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -2 Query: 546 IPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 +PPP PPPPPP PPPP +PPPPPPPPPP S Sbjct: 89 VPPPPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPS 125 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPPPP PPPPPS PPPP PPPP Sbjct: 104 PPPPSPPPPSPPPPPP----PPPPPS----PPPPSPPPP 134 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP PPP PPPP P PPPPP PPPPPP PPP S Sbjct: 94 PPPPPPPPPSPPPPSPPPPSPPPPP-----PPPPPPSPPPPS 130 Score = 57.0 bits (136), Expect = 1e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPP PP PPP P PPPPP PPPP Sbjct: 90 PPPPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPP 129 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP P PPPP P PPP PPP PPPP P Sbjct: 92 PPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPPSP 131 [228][TOP] >UniRef100_Q5VR02 Hydroxyproline-rich glycoprotein-like n=1 Tax=Oryza sativa Japonica Group RepID=Q5VR02_ORYSJ Length = 1026 Score = 63.2 bits (152), Expect = 1e-08 Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 5/100 (5%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQP---PPPPSVSK-APPPPPPPPPPKSLSIASAKVRRVPEV 394 PP ++ PP PPPPPP P PPPP+ S APPPPPPPPPP + + R+ P Sbjct: 536 PPPPALSPPAPPPPPPAPSPPAPLPPPPAPSPPAPPPPPPPPPPCPPAPPKTRSRQAPPP 595 Query: 393 VEFYHSLMRR-DSTNSRRDSTGGGNAAAEAILANSNARDM 277 + + D+T ++ G +A +A R + Sbjct: 596 ASTRATKKAKVDTTKNKEPPYGCSQEELDAYVAGEVKRQL 635 [229][TOP] >UniRef100_Q0JA38 Os04g0617200 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=Q0JA38_ORYSJ Length = 149 Score = 63.2 bits (152), Expect = 1e-08 Identities = 31/56 (55%), Positives = 34/56 (60%), Gaps = 4/56 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS----LSIASAKVRR 406 PP PPPHP PP PL PPPPPS PPPPPPP PP S L + S ++RR Sbjct: 18 PPPPLPPPPHPSPPLPLPTPPPPPPS----PPPPPPPAPPPSLVALLLLLSGRLRR 69 [230][TOP] >UniRef100_C1MSQ5 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MSQ5_9CHLO Length = 1516 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 S PPP PPPPPP PPPP+ S PPPPPPPPPP Sbjct: 1045 SSPPPPPPPPPPPSPPSPPPPNGSPQPPPPPPPPPP 1080 Score = 57.8 bits (138), Expect = 6e-07 Identities = 28/51 (54%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQP---PPPPSVSKAPPPPPPPPPPKSLSIASA 418 PP S PP PPPPPP L P PPPPS S +PPPPPP P S + +S+ Sbjct: 1064 PPNGSPQPPPPPPPPPPLPSPPPSPPPPSPSPSPPPPPPYALPTSPADSSS 1114 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 S PPP PPPPPP PP PP + +P PPPPPPPP L Sbjct: 1046 SPPPPPPPPPPP---SPPSPPPPNGSPQPPPPPPPPPPL 1081 [231][TOP] >UniRef100_A9TWI4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWI4_PHYPA Length = 818 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP+ ++PPP P PPPP PP PP S PPPP PPPPP S Sbjct: 474 PPECTLPPPPPSPPPPSPPPPPSPPPPSPPPPPPSPPPPPPS 515 Score = 60.8 bits (146), Expect = 7e-08 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPPS PPPP PPPPP Sbjct: 492 PPPPSPPPPSPPPPPP--SPPPPPPS----PPPPSPPPPP 525 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPP--PPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PPP PPPP PP PPPPPS PPPPPP PPP S Sbjct: 481 PPPPSPPPPSPPPPPSPPPPSPPPPPPS----PPPPPPSPPPPS 520 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/61 (45%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPP-------PPPPKSLSIASAKVRRV 403 PP PPP PPPPPP P PPP S +PPPP P PPPP +S ++ K Sbjct: 499 PPSPPPPPPSPPPPPPSPPPPSPPPPPSPSPPPPAPRPVKIFRPPPPDFISNSAPKAPPP 558 Query: 402 P 400 P Sbjct: 559 P 559 [232][TOP] >UniRef100_A4RWC6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RWC6_OSTLU Length = 4003 Score = 63.2 bits (152), Expect = 1e-08 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP PPP P PPPP PPPPPS +PP PPPPPP K++ Sbjct: 1561 PPSPPPPPPPPSPPPPPPSPPPPPPSPPPSPPSPPPPPPAKAI 1603 Score = 60.8 bits (146), Expect = 7e-08 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P PPP PPPP P PPPPP S PPPP PPPPP S Sbjct: 1545 PSPPPSPPPSPPPPSPPPSPPPPPPPPSPPPPPPSPPPPPPS 1586 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPPP PPPPPS PPPPPP PPP Sbjct: 1555 PPPPS-PPPSPPPPPPPPSPPPPPPS----PPPPPPSPPP 1589 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PP PPP PPPPP PP PPPPPP Sbjct: 1560 PPPSPPPPPPPPSPPPPPPSPPPPPPSPPPSPPSPPPPPP 1599 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKV 412 PPP PPPPP PPPPPS PPPPPPP PP SA V Sbjct: 1774 PPPSPPPPP----SPPPPPS----PPPPPPPSPPPLHQFTSADV 1809 [233][TOP] >UniRef100_Q38EF1 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei RepID=Q38EF1_9TRYP Length = 576 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPP--PPPSVSKAPPPPPPPPP 445 PPQK PP PPPPPP PP PPP V+ PPPPPPPPP Sbjct: 519 PPQKGGVPPPPPPPPPPKAPPPKGPPPKVAPPPPPPPPPPP 559 Score = 55.1 bits (131), Expect = 4e-06 Identities = 31/72 (43%), Positives = 35/72 (48%), Gaps = 23/72 (31%) Frame = -2 Query: 561 PPQKSIPPPHPP----------PPPPLLHQPPPPPS-----------VSKAP--PPPPPP 451 PP K+ PPP PP PPPP + PPP PS + AP PPPPPP Sbjct: 379 PPGKAPPPPPPPPPMFAGKMKAPPPPPIKAPPPMPSLPGAAATKGLPIGNAPPAPPPPPP 438 Query: 450 PPPKSLSIASAK 415 PPP + A AK Sbjct: 439 PPPPGQAKAPAK 450 [234][TOP] >UniRef100_C9ZY65 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei gambiense DAL972 RepID=C9ZY65_TRYBG Length = 576 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPP--PPPSVSKAPPPPPPPPP 445 PPQK PP PPPPPP PP PPP V+ PPPPPPPPP Sbjct: 519 PPQKGGVPPPPPPPPPPKAPPPKGPPPKVAPPPPPPPPPPP 559 Score = 55.1 bits (131), Expect = 4e-06 Identities = 31/72 (43%), Positives = 35/72 (48%), Gaps = 23/72 (31%) Frame = -2 Query: 561 PPQKSIPPPHPP----------PPPPLLHQPPPPPS-----------VSKAP--PPPPPP 451 PP K+ PPP PP PPPP + PPP PS + AP PPPPPP Sbjct: 379 PPGKAPPPPPPPPPMFAGKMKAPPPPPIKAPPPMPSLPGAAATKGLPIGNAPPAPPPPPP 438 Query: 450 PPPKSLSIASAK 415 PPP + A AK Sbjct: 439 PPPPGKAKAPAK 450 [235][TOP] >UniRef100_C4Q878 Formin-like n=1 Tax=Schistosoma mansoni RepID=C4Q878_SCHMA Length = 1039 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK 415 PPP PPPPPPL PPPPPS PPPPPPPPP + A+ Sbjct: 507 PPPPPPPPPPL---PPPPPSAGGIPPPPPPPPPGMGAMVPGAE 546 [236][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/48 (58%), Positives = 30/48 (62%) Frame = -2 Query: 555 QKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKV 412 Q+ PPP PPPPPP PPPPP PPPPPPPPPPK S K+ Sbjct: 38 QEQAPPPPPPPPPP----PPPPP-----PPPPPPPPPPKKTSDTKKKI 76 [237][TOP] >UniRef100_C5MAF0 Pre-mRNA splicing factor PRP8 n=1 Tax=Candida tropicalis MYA-3404 RepID=C5MAF0_CANTT Length = 2393 Score = 63.2 bits (152), Expect = 1e-08 Identities = 33/70 (47%), Positives = 36/70 (51%), Gaps = 10/70 (14%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPP----------PPPPPPPKSLSIASAKVR 409 PQK PPP PPPPPP PPP P APPP PPPPPPP S S S K R Sbjct: 26 PQKRQPPPPPPPPPPRSRNPPPAPP---APPPSGSQSDKSNRPPPPPPPPSASNDSTKKR 82 Query: 408 RVPEVVEFYH 379 + + + H Sbjct: 83 KWSNMAQNRH 92 [238][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/68 (42%), Positives = 38/68 (55%), Gaps = 5/68 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPP-----SVSKAPPPPPPPPPPKSLSIASAKVRRVPE 397 PP PPP PPPPPP PPPPP S PPPP PPPP S + + + + + Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPLDVGEASNLQPPPPLPPPPYSCDPSGSDLPQDTK 519 Query: 396 VVEFYHSL 373 V+++Y +L Sbjct: 520 VLQYYFNL 527 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -2 Query: 549 SIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIAS 421 S+PPP PPPPPP PPPPP PPPPPPPPPP + AS Sbjct: 458 SLPPPPPPPPPP----PPPPP----PPPPPPPPPPPLDVGEAS 492 [239][TOP] >UniRef100_UPI00005A3748 PREDICTED: similar to Splicing factor 1 (Zinc finger protein 162) (Transcription factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point binding protein mBBP) (BBP) isoform 8 n=1 Tax=Canis lupus familiaris RepID=UPI00005A3748 Length = 758 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P ++PPP PPPPPP PPPPPS + PPP PPPPP Sbjct: 64 PFAALPPPPPPPPPPPQQPPPPPPSPGSSYPPPQPPPPP 102 [240][TOP] >UniRef100_UPI000054797E Hypothetical protein. n=1 Tax=Danio rerio RepID=UPI000054797E Length = 481 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PPP PPPPP H P PPP S APPPPPPPPP Sbjct: 308 PPPPPPPPPEPTHVPVPPPGTSAAPPPPPPPPP 340 [241][TOP] >UniRef100_UPI0001AE70C7 UPI0001AE70C7 related cluster n=1 Tax=Homo sapiens RepID=UPI0001AE70C7 Length = 507 Score = 62.8 bits (151), Expect = 2e-08 Identities = 30/64 (46%), Positives = 35/64 (54%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYH 379 P + P PPPPPP PPPPPS + PPPPPPPPPP L R + EV++ Sbjct: 374 PLSPVATPPPPPPPP----PPPPPSSQRLPPPPPPPPPP--LPEKKLITRNIAEVIKQQE 427 Query: 378 SLMR 367 S R Sbjct: 428 SAQR 431 [242][TOP] >UniRef100_UPI000013D567 Huntingtin (Huntington disease protein) (HD protein). n=1 Tax=Homo sapiens RepID=UPI000013D567 Length = 3142 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/52 (51%), Positives = 33/52 (63%), Gaps = 2/52 (3%) Frame = -2 Query: 555 QKSIPPPHPPPPPPLLHQPPP--PPSVSKAPPPPPPPPPPKSLSIASAKVRR 406 Q+ PPP PPPPPP L QPPP P + + PPPPPPPPP ++A + R Sbjct: 36 QQQPPPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHR 87 [243][TOP] >UniRef100_A8DZA2 Novel protein n=1 Tax=Danio rerio RepID=A8DZA2_DANRE Length = 448 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PPP PPPPP H P PPP S APPPPPPPPP Sbjct: 275 PPPPPPPPPEPTHVPVPPPGTSAAPPPPPPPPP 307 [244][TOP] >UniRef100_A4IG59 Wash protein n=1 Tax=Danio rerio RepID=A4IG59_DANRE Length = 481 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PPP PPPPP H P PPP S APPPPPPPPP Sbjct: 308 PPPPPPPPPEPTHVPVPPPGTSAAPPPPPPPPP 340 [245][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP +PPP PPPPPP P PPP +PPPP PPPPP Sbjct: 209 PPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPP 248 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSL 433 PP S PPP PPPPPP PPPPS PPP PPPPPP L Sbjct: 221 PPPPSPPPPSPPPPPP---PSPPPPSPPPPPPPSPPPPPPPPL 260 Score = 61.6 bits (148), Expect = 4e-08 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -2 Query: 540 PPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPPPPPL PPPPP S PP PPPPPPP Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPP 237 Score = 61.2 bits (147), Expect = 5e-08 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPP P PPPPP+ +PPPP PPPP Sbjct: 2267 PPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPP 2305 Score = 60.8 bits (146), Expect = 7e-08 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 543 PPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P P PPPPPP L PPPPP PPP PPPPPP S Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPS 238 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPP PPPPPS PPPPPPPP P Sbjct: 226 PPPPSPPPPPPPSPPPPSPPPPPPPS----PPPPPPPPLP 261 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PP PP S PPPPP PPPP Sbjct: 216 PPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPP 255 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/49 (51%), Positives = 26/49 (53%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAK 415 PP S PPP PPPP P PPP P PP PPPP PP S + K Sbjct: 2747 PPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPPDRTSTSGTK 2795 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPPPP PP PP S PPPPP PPPP Sbjct: 205 PPPPPPPPPLPPPPPP--PPPPSPPPPSPPPPPPPSPPPP 242 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PP PP PPP L PP PP S PP PPP PPP S Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPS 2573 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/42 (57%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPP--PPPSVSKAPPPPPPPPPP 442 PP P PHPP PPP PP PPP+ +PPPPPP PPP Sbjct: 2254 PPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPP 2295 Score = 57.8 bits (138), Expect = 6e-07 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P PPP PPPPPP PPPPS PPPP PPPP Sbjct: 2277 PPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPP 2315 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPP P PPPP +PPPP PPPP Sbjct: 2717 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2755 Score = 57.4 bits (137), Expect = 7e-07 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 PP S PPP PPPP P PPPP +PPPP PPPP Sbjct: 2722 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2760 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIAS 421 PP PPP P PPPP PPPPP S PPPPPP P P S S Sbjct: 227 PPPSPPPPPPPSPPPP---SPPPPPPPSPPPPPPPPLPTPTGRSCFS 270 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPPP PPPP PPPP PPPPP Sbjct: 1176 PPPPSPPPPSPPPPP----SPPPPSPPPPLPPPPSPPPPP 1211 Score = 57.0 bits (136), Expect = 1e-06 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPPP + +PPP PPPP P Sbjct: 2737 PPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSP 2776 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP PPP PPPP P PP PP S PP PPPP PP Sbjct: 2670 PPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPP 2709 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P S PPP PPP PP PP PP S PP PPPP PP S Sbjct: 2676 PPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPS 2716 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPP P PPP PPPP P Sbjct: 2693 PPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSP 2732 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP P PPP P PPP PPPP P Sbjct: 2698 PPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSP 2737 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPP PP PPP P PPP PPPP P Sbjct: 2703 PPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2742 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP S PP PP PPP PP PP S PP PPP PPP S Sbjct: 2680 PPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPS 2721 Score = 55.5 bits (132), Expect = 3e-06 Identities = 40/118 (33%), Positives = 47/118 (39%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFY 382 PP S PPP PPP PP PP PP S PP PPPP PP S S P Y Sbjct: 2529 PP--SPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPY 2586 Query: 381 HSLMRRDSTNSRRDSTGGGNAAAEAILANSNARDMIGEIENRSVYLLAIKTDVETQGD 208 D G + +I+ S+A D + EN + T +T GD Sbjct: 2587 PPCHEFDDDT----RIVGYDVPGSSIIVASSASDCSIQCENEHRSVAGYFTHHKTDGD 2640 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 8/48 (16%) Frame = -2 Query: 561 PPQKSIPPPHPP--------PPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PP PPPP P PPP + AP PPP PPPP Sbjct: 2727 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPP 2774 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/38 (57%), Positives = 23/38 (60%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPP 445 P S PPP PPPP P PPPP +PPPP PPPP Sbjct: 2713 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2750 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/42 (54%), Positives = 23/42 (54%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 PP P P PP PPP PP PP S P PPPP PPP S Sbjct: 2685 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPS 2726 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = -2 Query: 561 PPQKSIPPPHPPPP---PPLLHQPPPPPSVSKAPPPPPPPPPP 442 PP S PPP PPPP PPL P PPPS P PPP PPPP Sbjct: 2742 PPPPSPPPPSPPPPSPPPPLPPAPSPPPS-PPPPSPPPSPPPP 2783 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P S PPP PPPP P PPPP PPP PPPP P Sbjct: 2689 PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSP 2727 [246][TOP] >UniRef100_Q6IMV8 Transposase n=1 Tax=Oryza sativa Indica Group RepID=Q6IMV8_ORYSI Length = 361 Score = 62.8 bits (151), Expect = 2e-08 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPP 442 P +PPP PP P P QPPPP APPPPPPPPPP Sbjct: 86 PSPPVPPPRPPAPSPPASQPPPPAPSPPAPPPPPPPPPP 124 [247][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 62.8 bits (151), Expect = 2e-08 Identities = 30/52 (57%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPP----PPKSLSIASA 418 PP PP PPPPPP L PPPPP + PPPPPPPP KSLS SA Sbjct: 265 PPSLPPQPPPPPPPPPPLPPPPPPPPLPPQPPPPPPPPLQPQQHKSLSKVSA 316 [248][TOP] >UniRef100_A4HCC8 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis RepID=A4HCC8_LEIBR Length = 814 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 8/51 (15%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAPPPP----PPPPPPKSL 433 PP S+PPP P PPPPP PPPPP+ S PPPP PPPPP SL Sbjct: 338 PPAASVPPPPPAASLPPPPPAASVPPPPPAASLPPPPPAASVPPPPPAASL 388 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 8/51 (15%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAPPPP----PPPPPPKSL 433 PP S+PPP P PPPPP PPPPP+ S PPPP PPPPP SL Sbjct: 383 PPAASLPPPPPAASVPPPPPAASVPPPPPAASVPPPPPAASVPPPPPAASL 433 Score = 61.2 bits (147), Expect = 5e-08 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 8/51 (15%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAPPPP----PPPPPPKSL 433 PP S+PPP P PPPPP PPPPP+ S PPPP PPPPP S+ Sbjct: 347 PPAASLPPPPPAASVPPPPPAASLPPPPPAASVPPPPPAASLPPPPPAASV 397 Score = 61.2 bits (147), Expect = 5e-08 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 8/51 (15%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAPPPP----PPPPPPKSL 433 PP S+PPP P PPPPP PPPPP+ S PPPP PPPPP S+ Sbjct: 365 PPAASLPPPPPAASVPPPPPAASLPPPPPAASVPPPPPAASVPPPPPAASV 415 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 8/47 (17%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAPPPP----PPPPP 445 PP S+PPP P PPPPP PPPPP+ S PPPP PPPPP Sbjct: 392 PPAASVPPPPPAASVPPPPPAASVPPPPPAASVPPPPPAASLPPPPP 438 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/51 (52%), Positives = 31/51 (60%), Gaps = 6/51 (11%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAPPPPP--PPPPPKSLSI 427 PP S+PPP P PPPPP PPPPP+ S PPPP PPPP + S+ Sbjct: 356 PPAASVPPPPPAASLPPPPPAASVPPPPPAASLPPPPPAASVPPPPPAASV 406 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/51 (52%), Positives = 31/51 (60%), Gaps = 6/51 (11%) Frame = -2 Query: 561 PPQKSIPPPHP----PPPPPLLHQPPPPPSVSKAPPPPP--PPPPPKSLSI 427 PP S+PPP P PPPPP PPPPP+ S PPPP PPPP + S+ Sbjct: 374 PPAASVPPPPPAASLPPPPPAASVPPPPPAASVPPPPPAASVPPPPPAASV 424 Score = 54.3 bits (129), Expect = 6e-06 Identities = 24/47 (51%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPP----PPPPPPKSL 433 PP P PPPPP PPPPP+ S PPPP PPPPP S+ Sbjct: 333 PPSTPPPAASVPPPPPAASLPPPPPAASVPPPPPAASLPPPPPAASV 379 [249][TOP] >UniRef100_B4DRV0 cDNA FLJ58570, highly similar to Mus musculus leiomodin 2 (cardiac) (Lmod2), mRNA n=1 Tax=Homo sapiens RepID=B4DRV0_HUMAN Length = 507 Score = 62.8 bits (151), Expect = 2e-08 Identities = 30/64 (46%), Positives = 35/64 (54%) Frame = -2 Query: 558 PQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVPEVVEFYH 379 P + P PPPPPP PPPPPS + PPPPPPPPPP L R + EV++ Sbjct: 374 PLSPVATPPPPPPPP----PPPPPSSQRLPPPPPPPPPP--LPEKKLITRNIAEVIKQQE 427 Query: 378 SLMR 367 S R Sbjct: 428 SAQR 431 [250][TOP] >UniRef100_C7YGW0 Putative uncharacterized protein n=1 Tax=Nectria haematococca mpVI 77-13-4 RepID=C7YGW0_NECH7 Length = 427 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/51 (60%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = -2 Query: 561 PPQKSIP-PPHPPPPPPLLHQPPPPPSVSKAP---PPPPPPPPPKSLSIAS 421 PP S P PP PPPPPP PPP PSVS P PPPPPPPP S S S Sbjct: 248 PPMSSAPAPPAPPPPPPSAAPPPPRPSVSPTPRTQPPPPPPPPAASHSTPS 298 Score = 52.4 bits (124), Expect(2) = 8e-06 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = -2 Query: 561 PPQKSIPPPHPPPPPPLLHQPPPPPSVSKAPPPPPPPPPPKS 436 P S+PP P P P PPPPP +S AP PP PPPPP S Sbjct: 228 PSSMSLPPSVPSAPAP----PPPPPPMSSAPAPPAPPPPPPS 265 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 338 PPAVETPPRKQYLLTPTPET 279 PP PP + ++PTP T Sbjct: 262 PPPSAAPPPPRPSVSPTPRT 281