hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mbh/mbh04344/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1643  ( 950 res)   mbh04344

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
FYVE     Protein present in Fab1, YOTB, Vac1, and EEA    97.1    2.1e-24   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
FYVE       1/1     872   941 ..     1    81 []    97.1  2.1e-24

Alignments of top-scoring domains:
FYVE: domain 1 of 1, from 872 to 941: score 97.1, E = 2.1e-24
                   *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk
                      e  p+WvpDe    C + C+++Ft+ +rR+HHCR CG+ifCs+Css+
   mKIAA1643   872    EDPPEWVPDEACGFC-TSCKAPFTV-IRRKHHCRSCGKIFCSRCSSH 916  

                   kaplpklgkekkngknedftpvRVCdsCyerlsk<-*
                   +aplp  g+ k         pvRVC +Cy  + +   
   mKIAA1643   917 SAPLPRYGQVK---------PVRVCTHCYMFHVT    941  

//