hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/Pfam
Sequence file:            /cdna4/rodent/full/goal/mbh/mbh04344/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1643  ( 950 res)   mbh04344

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
FYVE     FYVE zinc finger                                97.1    3.6e-25   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
FYVE       1/1     875   941 ..     1    77 []    97.1  3.6e-25

Alignments of top-scoring domains:
FYVE: domain 1 of 1, from 875 to 941: score 97.1, E = 3.6e-25
                   *->phWvpDeevsnCmrCgkpFtkltkRrHHCRaCGrifCgsCssktvll
                      p WvpDe+  +C++C+ pFt +++R+HHCR+CG+ifC+ Css++++l
   mKIAA1643   875    PEWVPDEACGFCTSCKAPFT-VIRRKHHCRSCGKIFCSRCSSHSAPL 920  

                   pylgiaallkndviekpvRVCdsCydrlnk<-*
                   p  g           kpvRVC +Cy  ++    
   mKIAA1643   921 PRYGQ---------VKPVRVCTHCYMFHVT    941  

//