hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mbg/mbg18407/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1537  ( 628 res)   mbg18407

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
FYVE     Protein present in Fab1, YOTB, Vac1, and EEA    94.1    1.6e-23   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
FYVE       1/1     554   621 ..     1    81 []    94.1  1.6e-23

Alignments of top-scoring domains:
FYVE: domain 1 of 1, from 554 to 621: score 94.1, E = 1.6e-23
                   *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk
                          +W +D+ a +C   C+keF+l  +R+HHCRnCG ifC+ Cs++
   mKIAA1537   554    LQGLVWLKDKDATHC-KLCEKEFSL-SKRKHHCRNCGEIFCNACSDN 598  

                   kaplpklgkekkngknedftpvRVCdsCyerlsk<-*
                   ++plp+  k           pvRVCdsC+++l     
   mKIAA1537   599 ELPLPSSPK-----------PVRVCDSCHAMLIQ    621  

//