hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mng/mng09179/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1501 ( 606 res) mng09179 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RhoGAP RhoGAP domain 244.6 1.4e-69 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RhoGAP 1/1 39 192 .. 1 155 [] 244.6 1.4e-69 Alignments of top-scoring domains: RhoGAP: domain 1 of 1, from 39 to 192: score 244.6, E = 1.4e-69 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdl. Pliv C++ +e+rGL++ GIyRv+G+ +++ L+e+++rg+ + mKIAA1501 39 PLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRGPSDINl 85 ndleeedvhvvAslLKlFLReLPePLltfelyeefieaaaksedeeerle +d++++d +v++slLK F+R+LPePL+t++ y++fie a ++ed +er++ mKIAA1501 86 QDERWQDLNVISSLLKAFFRKLPEPLFTDDKYNDFIE-ANRIEDSRERMK 134 alrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLl lr+l+r LP + ++tL++L++hL+ +a++se+NkM ++NLA+vFgPtL+ mKIAA1501 135 TLRKLIRDLPGHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLV 184 rppdgdsad<-* r++++ +++ mKIAA1501 185 RTSED-NMT 192 //