hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg00079/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0993 ( 646 res) mbg00079 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- FYVE Protein present in Fab1, YOTB, Vac1, and EEA 105.2 7.5e-27 1 WD40 WD40 repeats 73.8 2.2e-17 5 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- WD40 1/5 192 226 .. 1 46 [] 8.5 22 WD40 2/5 236 275 .. 1 46 [] 34.6 1.3e-05 WD40 3/5 278 316 .. 1 46 [] 16.0 1.4 WD40 4/5 321 365 .. 1 46 [] 18.7 0.54 WD40 5/5 519 558 .. 1 46 [] 8.4 23 FYVE 1/1 566 635 .. 1 81 [] 105.2 7.5e-27 Alignments of top-scoring domains: WD40: domain 1 of 5, from 192 to 226: score 8.5, E = 22 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW ++l+++ +++ ++p+ +l+++g++ +++W mKIAA0993 192 VyECLSEWG------QILCA-VCPNP------KLVITGGtSTVVCVW 225 d<-* + mKIAA0993 226 E 226 WD40: domain 2 of 5, from 236 to 275: score 34.6, E = 1.3e-05 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + +l + l gHt+ Vt+ + s ++++sgs+D+t+ +W mKIAA0993 236 PlTLKQALLGHTD--TVTCATASLAY------HIIVSGSrDRTCIIW 274 d<-* d mKIAA0993 275 D 275 WD40: domain 3 of 5, from 278 to 316: score 16.0, E = 1.4 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + + l l+gH++ pV++++++ ++s+ + i++W mKIAA0993 278 KlSFLTQLRGHRA--PVSALCINELT------GDIVSCAgTY-IHVW 315 d<-* + mKIAA0993 316 S 316 WD40: domain 4 of 5, from 321 to 365: score 18.7, E = 0.54 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + + t++g ++ + +++ s + d n++++g +Dg +r+W mKIAA0993 321 PiVSVNTFTGRSQ--QIVCCCMSEMNEW-DTQNVIVTGHsDGVVRFW 364 d<-* mKIAA0993 365 R 365 WD40: domain 5 of 5, from 519 to 558: score 8.4, E = 23 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + r+ + H + +Vt++ +s d+ +++++g++ g + W mKIAA0993 519 HtAFDRKDNTHPA--EVTALGVSKDH------SRILVGDsRGRVFSW 557 d<-* + mKIAA0993 558 S 558 FYVE: domain 1 of 1, from 566 to 635: score 105.2, E = 7.5e-27 *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk a+hWv+De ++C ++C++ F+l t+RrHHCRnCG++fC+kCs++ mKIAA0993 566 SAADHWVKDEGGDSC-SGCSVRFSL-TERRHHCRNCGQLFCQKCSRF 610 kaplpklgkekkngknedftpvRVCdsCyerlsk<-* ++ + l+++ pvRVC Cy +l++ mKIAA0993 611 QSEIKRLKISS---------PVRVCQNCYYSLQH 635 //