hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg01323/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0546 ( 1638 res) mbg01323 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HAT HAT (Half-A-TPR) repeats 54.5 1.4e-11 5 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HAT 1/5 1030 1062 .. 1 34 [] 17.4 2 HAT 2/5 1064 1095 .. 1 34 [] 1.6 7.6e+02 HAT 3/5 1299 1331 .. 1 34 [] 9.8 58 HAT 4/5 1408 1443 .. 1 34 [] 7.5 1.2e+02 HAT 5/5 1568 1600 .. 1 34 [] 20.5 0.23 Alignments of top-scoring domains: HAT: domain 1 of 5, from 1030 to 1062: score 17.4, E = 2 *->gdieraRkiyeralekfpdksvdlWlkYaefEer<-* + + a +++ rale++ ++++W Y+++ ++ mKIAA0546 1030 ESLDSALNVLARALENNK-DNPEIWCHYLRLFSK 1062 HAT: domain 2 of 5, from 1064 to 1095: score 1.6, E = 7.6e+02 *->gdieraRkiyeralekfpdksvdlWlkYaefEer<-* g e++ + e a+e p + ++W+ ++ +E+ mKIAA0546 1064 GTKEEVQEMCETAVEYAP-DYQSFWT-FLHLEST 1095 HAT: domain 3 of 5, from 1299 to 1331: score 9.8, E = 58 *->gdieraRkiyeralekfpdksvdlWlkYaefEer<-* +++aR+++ a e++p ++ ++++ ++f + mKIAA0546 1299 DRYDKARRVWLTAFENNP-QNAEIFYHLCKFFIL 1331 HAT: domain 4 of 5, from 1408 to 1443: score 7.5, E = 1.2e+02 *->gdieraRkiyeralekfp..dksvdlWlkYaefEer<-* i + + ye al + ++d + ++W++Y+ f + mKIAA0546 1408 SSIKETVEAYEAALGVAMrsDIVQKIWMDYLVFANN 1443 HAT: domain 5 of 5, from 1568 to 1600: score 20.5, E = 0.23 *->gdieraRkiyeralekfpdksvdlWlkYaefEer<-* + +++ ++y+ral k p ++ +lW++ + fE + mKIAA0546 1568 KGQREVHRLYQRALQKLP-LCASLWKDQLLFEAS 1600 //