hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg13653/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0455 ( 795 res) mbg13653 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PAP2 PAP2 superfamily 127.1 3.2e-34 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PAP2 1/1 208 361 .. 1 176 [] 127.1 3.2e-34 Alignments of top-scoring domains: PAP2: domain 1 of 1, from 208 to 361: score 127.1, E = 3.2e-34 *->aalallfalvasallnglaylKllfgrpRAPhflavcqpdwgdstcs ++++++f+l+++al++++ ++l++g++ P mKIAA0455 208 FVGVHVFGLCSTALITDI--IQLSTGYQA-P---------------- 235 dlwyeelygl.e.fycmagspg.ldrid.lfgsvlltsafalvseggpSF y+l++ ++++++ ++++++++ + +++ +s+ +++ g++SF mKIAA0455 236 -------YFLtVcKPNYTSLNVsCKENSyIVEDICSGSDLTVINSGRKSF 278 PSGHaafaaaaalflalylprrlstls.rllrlllgllllllallvglSR PS Ha++aa+aa++++ y+ + + t s++ll++ll++ ++++++ +gl+R mKIAA0455 279 PSQHATLAAFAAVYVSMYFNS-TLTDSsKLLKPLLVFTFIICGIICGLTR 327 vylgvHypsDVlaGallGaliallvllfvrrlld<-* + ++ +p+DV G+l+G +ial+ l+ +++ mKIAA0455 328 ITQYKNHPVDVYCGFLIGGGIALYLGLYAVGNFL 361 //