hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/Pfam
Sequence file:            /cdna4/rodent/full/goal/mef/mef00119/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA0321  ( 2548 res)   mef00119

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
FYVE     FYVE zinc finger                               105.5    1.1e-27   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
FYVE       1/1    1816  1882 ..     1    77 []   105.5  1.1e-27

Alignments of top-scoring domains:
FYVE: domain 1 of 1, from 1816 to 1882: score 105.5, E = 1.1e-27
                   *->phWvpDeevsnCmrCgkpFtkltkRrHHCRaCGrifCgsCssktvll
                      ++WvpDe++s Cm+C+++++++++RrHHCR CGr++CgsCs k++ +
   mKIAA0321  1816    DQWVPDETESVCMVCCREHFTMFNRRHHCRRCGRLVCGSCSTKKMVV 1862 

                   pylgiaallkndviekpvRVCdsCydrlnk<-*
                   + ++          e+p RVCd+Cy+++nk   
   mKIAA0321  1863 EGFR----------ENPTRVCDQCYSYYNK    1882 

//