hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mbg/mbg08215/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA0305  ( 1536 res)   mbg08215

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
FYVE     Protein present in Fab1, YOTB, Vac1, and EEA   117.3    1.7e-30   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
FYVE       1/1     735   802 ..     1    81 []   117.3  1.7e-30

Alignments of top-scoring domains:
FYVE: domain 1 of 1, from 735 to 802: score 117.3, E = 1.7e-30
                   *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk
                      ++ p+WvpD+ea nC mnC+++Ft+ t+RrHHCR+CG++fC+ C+++
   mKIAA0305   735    QKQPTWVPDSEAPNC-MNCQVKFTF-TKRRHHCRACGKVFCGVCCNR 779  

                   kaplpklgkekkngknedftpvRVCdsCyerlsk<-*
                   k++l++l+k            +RVC  Cye+++k   
   mKIAA0305   780 KCKLQYLEK-----------EARVCVICYETINK    802  

//