hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg08215/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0305 ( 1536 res) mbg08215 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- FYVE FYVE zinc finger 125.3 1.1e-33 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- FYVE 1/1 738 802 .. 1 77 [] 125.3 1.1e-33 Alignments of top-scoring domains: FYVE: domain 1 of 1, from 738 to 802: score 125.3, E = 1.1e-33 *->phWvpDeevsnCmrCgkpFtkltkRrHHCRaCGrifCgsCssktvll p+WvpD+e+ nCm+C+++Ft +tkRrHHCRaCG++fCg C+++++ l mKIAA0305 738 PTWVPDSEAPNCMNCQVKFT-FTKRRHHCRACGKVFCGVCCNRKCKL 783 pylgiaallkndviekpvRVCdsCydrlnk<-* +yl ek++RVC Cy+ nk mKIAA0305 784 QYL-----------EKEARVCVICYETINK 802 //