hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mtk/mtk00386/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0053 ( 549 res) mtk00386 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RhoGAP RhoGAP domain 205.9 6.2e-58 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RhoGAP 1/1 79 232 .. 1 155 [] 205.9 6.2e-58 Alignments of top-scoring domains: RhoGAP: domain 1 of 1, from 79 to 232: score 205.9, E = 6.2e-58 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdln P++vekC ef+ ++G +EGI+R++G +k+Lr+afd ge++ mKIAA0053 79 PILVEKCAEFILEHGVSEEGIFRLPGQDNLVKQLRDAFDAGERPS-- 123 dleeedvhvvAslLKlFLReLPePLltfelyeefiea.aaksedeeerle ++++ dvh+vAslLKl+LR+LPeP+++ ++ye f++++ + + de + mKIAA0053 124 FDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCgQLMNADEAKAQQ 173 alrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLl +l + l++LP+ N+++L y++++L++++ n++vNkM++ NLA+v+g +L+ mKIAA0053 174 ELVKQLSTLPRDNYNLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLI 223 rppdgdsad<-* r++++d+a mKIAA0053 224 RSKVEDPAV 232 //