hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-18382055/chunk_1/iprscan-20080502-18382055.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1994 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01166.9.fs TSC-22/dip/bun family 150.9 8.5e-47 1 PF01166.9.ls TSC-22/dip/bun family 152.9 7.9e-43 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01166.9.fs 1/1 1032 1091 .. 1 60 [] 150.9 8.5e-47 PF01166.9.ls 1/1 1032 1091 .. 1 60 [] 152.9 7.9e-43 Alignments of top-scoring domains: PF01166.9.fs: domain 1 of 1, from 1032 to 1091: score 150.9, E = 8.5e-47 *->MDLVKsHLmyAVREEVEvLkeqIkeLveklnqLeeENtLLktnvSpE MDLVKsHLmyAVREEVEvLkeqIkeL+ek++qLe+EN LLkt++SpE KIAA1994 1032 MDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPE 1078 qLaqlqaqlqlae<-* qLaq+qaqlq+++ KIAA1994 1079 QLAQFQAQLQTGS 1091 PF01166.9.ls: domain 1 of 1, from 1032 to 1091: score 152.9, E = 7.9e-43 *->MDLVKsHLmyAVREEVEvLkeqIkeLveklnqLeeENtLLktnvSpE MDLVKsHLmyAVREEVEvLkeqIkeL+ek++qLe+EN LLkt++SpE KIAA1994 1032 MDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPE 1078 qLaqlqaqlqlae<-* qLaq+qaqlq+++ KIAA1994 1079 QLAQFQAQLQTGS 1091 //