hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-17275951/chunk_1/iprscan-20080502-17275951.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1952 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF05699.5.ls hAT family dimerisation domain 18.4 0.00035 1 PF05699.5.fs hAT family dimerisation domain 16.6 0.00036 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00096.16.ls 1/1 173 195 .. 1 24 [] 18.8 0.018 PF05699.5.fs 1/1 654 734 .. 1 94 [] 16.6 0.00036 PF05699.5.ls 1/1 654 734 .. 1 94 [] 18.4 0.00035 Alignments of top-scoring domains: PF00096.16.ls: domain 1 of 1, from 173 to 195: score 18.8, E = 0.018 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C Cg F nL H+++H KIAA1952 173 YTCG-ACGIQFQFYNNLLEHMQSH 195 PF05699.5.fs: domain 1 of 1, from 654 to 734: score 16.6, E = 0.00036 *->ELdkYlselpvlprnteprgledfdvLeWWkeaqnssryPiLsklAr E+ +Yl+e p+++ + d+ ++W+ + ++ L klA+ KIAA1952 654 EVYDYLQE-PLFQATP--------DLFQYWS--CVTQKHTKLAKLAF 689 diLsiPvssaasErsFStgklgrvldesrnrlepenveaLlcledwl<-* +L++P+ a s + +l ++r+ l pe ++L++l++++ KIAA1952 690 WLLAVPAVGARSGCVNMCE--QALLIKRRRLLSPEDMNKLMFLKSNM 734 PF05699.5.ls: domain 1 of 1, from 654 to 734: score 18.4, E = 0.00035 *->ELdkYlselpvlprnteprgledfdvLeWWkeaqnssryPiLsklAr E+ +Yl+e p+++ + d+ ++W+ + ++ L klA+ KIAA1952 654 EVYDYLQE-PLFQATP--------DLFQYWS--CVTQKHTKLAKLAF 689 diLsiPvssaasErsFStgklgrvldesrnrlepenveaLlcledwl<-* +L++P+ a s + +l ++r+ l pe ++L++l++++ KIAA1952 690 WLLAVPAVGARSGCVNMCE--QALLIKRRRLLSPEDMNKLMFLKSNM 734 //