hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-11384086/chunk_1/iprscan-20080502-11384086.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1748 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01529.11.ls DHHC zinc finger domain 120.0 6.2e-33 1 PF01529.11.fs DHHC zinc finger domain 118.0 7.4e-33 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01529.11.fs 1/1 138 202 .. 1 66 [] 118.0 7.4e-33 PF01529.11.ls 1/1 138 202 .. 1 66 [] 120.0 6.2e-33 Alignments of top-scoring domains: PF01529.11.fs: domain 1 of 1, from 138 to 202: score 118.0, E = 7.4e-33 *->ldndkfikdnfCskCnsyKVPpRShHCsvCnkCVlrmDHHCpWinnC + +++ + ++C +C++y+ PpR++HCsvC++CV+ +DHHCpW+nnC KIAA1748 138 EIKGIQVRMKWCATCRFYR-PPRCSHCSVCDNCVEEFDHHCPWVNNC 183 VGlrNyryFllFlfylill<-* +G+rNyryF+lFl++l+ + KIAA1748 184 IGRRNYRYFFLFLLSLTAH 202 PF01529.11.ls: domain 1 of 1, from 138 to 202: score 120.0, E = 6.2e-33 *->ldndkfikdnfCskCnsyKVPpRShHCsvCnkCVlrmDHHCpWinnC + +++ + ++C +C++y+ PpR++HCsvC++CV+ +DHHCpW+nnC KIAA1748 138 EIKGIQVRMKWCATCRFYR-PPRCSHCSVCDNCVEEFDHHCPWVNNC 183 VGlrNyryFllFlfylill<-* +G+rNyryF+lFl++l+ + KIAA1748 184 IGRRNYRYFFLFLLSLTAH 202 //