hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-10131898/chunk_1/iprscan-20080502-10131898.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1699 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF04048.5.fs Sec8 exocyst complex component specific 239.4 7.1e-69 1 PF04048.5.ls Sec8 exocyst complex component specific 235.4 1.1e-67 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF04048.5.fs 1/1 1 136 [. 9 170 .] 239.4 7.1e-69 PF04048.5.ls 1/1 1 136 [. 1 170 [] 235.4 1.1e-67 Alignments of top-scoring domains: PF04048.5.fs: domain 1 of 1, from 1 to 136: score 239.4, E = 7.1e-69 *->asRgrkigkdenlsnnaErieGllinvIrrdyqamVEtDCiPleLsL ++R++++++++++ Glli+vIr +L KIAA1699 1 KYRSTVSKSKDPS--------GLLISVIR----------------TL 23 alsddtdvGrehEykrfeqlykridasLqelVheHkqdfttsiasygkis ++sdd+++ re+E++r+e++y+++d++L+el+++H++++tt+i++y++i+ KIAA1699 24 STSDDVED-RENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSIT 72 ssIqnsrerIhalKesLkasKelLettrSdELkkLwaeslqykkVlevLk ++I+nsr++I+++Ke+L+++K+lL+++r dEL+kLw+e++++k+Vl++L+ KIAA1699 73 ERITNSRNKIKQVKENLLSCKMLLHCKR-DELRKLWIEGIEHKHVLNLLD 121 eleELrqvPdkleel<-* e+e+++qvP+kle++ KIAA1699 122 EIENIKQVPQKLEQC 136 PF04048.5.ls: domain 1 of 1, from 1 to 136: score 235.4, E = 1.1e-67 *->mnApppesasRgrkigkdenlsnnaErieGllinvIrrdyqamVEtD ++R++++++++++ Glli+vIr KIAA1699 1 --------KYRSTVSKSKDPS--------GLLISVIR---------- 21 CiPleLsLalsddtdvGrehEykrfeqlykridasLqelVheHkqdftts +L++sdd+++ re+E++r+e++y+++d++L+el+++H++++tt+ KIAA1699 22 ------TLSTSDDVED-RENEKGRLEEAYEKCDRDLDELIVQHYTELTTA 64 iasygkisssIqnsrerIhalKesLkasKelLettrSdELkkLwaeslqy i++y++i+++I+nsr++I+++Ke+L+++K+lL+++r dEL+kLw+e++++ KIAA1699 65 IRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKR-DELRKLWIEGIEH 113 kkVlevLkeleELrqvPdkleel<-* k+Vl++L+e+e+++qvP+kle++ KIAA1699 114 KHVLNLLDEIENIKQVPQKLEQC 136 //