hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080502/iprscan-20080502-08393329/chunk_1/iprscan-20080502-08393329.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA1643
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00064                                                  98.7      7e-25   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00064    1/1     915   984 ..     1    81 []    98.7    7e-25

Alignments of top-scoring domains:
SM00064: domain 1 of 1, from 915 to 984: score 98.7, E = 7e-25
                   *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk
                      e  p+WvpDe    C ++C+++Ft+ +rR+HHCR CG+ifCs+Css+
    KIAA1643   915    EDPPEWVPDEACGFC-TACKAPFTV-IRRKHHCRSCGKIFCSRCSSH 959  

                   kaplpklgkekkngknedftpvRVCdsCyerlsk<-*
                   +aplp  g+ k         pvRVC +Cy  + +   
    KIAA1643   960 SAPLPRYGQVK---------PVRVCTHCYMFHVT    984  

//