hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-05401817/chunk_1/iprscan-20080502-05401817.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1537 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00064 96.0 4.4e-24 1 SM00593 89.8 3.2e-22 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00593 1/1 118 180 .. 1 68 [] 89.8 3.2e-22 SM00064 1/1 545 612 .. 1 81 [] 96.0 4.4e-24 Alignments of top-scoring domains: SM00593: domain 1 of 1, from 118 to 180: score 89.8, E = 3.2e-22 *->frAwirlaLneklLsswLnlLlsdrkllskyYepwAflrsaeadpee +rAw+rlaL++k++ +L++L+ r+lls++Ye +A+++ ee KIAA1537 118 ARAWLRLALMQKKMADYLRCLIIQRDLLSEFYEYHALMME-----EE 159 geqlltlLqgLsaldfnlpvd<-* g+ + +lL+gL+++d nl+v+ KIAA1537 160 GAVIVGLLVGLNVIDANLCVK 180 SM00064: domain 1 of 1, from 545 to 612: score 96.0, E = 4.4e-24 *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk +W +D+ea +C C+keF+l +R+HHCRnCG ifC+ Cs++ KIAA1537 545 LQGLVWLKDKEATHC-KLCEKEFSL-SKRKHHCRNCGEIFCNACSDN 589 kaplpklgkekkngknedftpvRVCdsCyerlsk<-* ++plp+ k pvRVCdsC++ l KIAA1537 590 ELPLPSSPK-----------PVRVCDSCHALLIQ 612 //