hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-05135068/chunk_1/iprscan-20080502-05135068.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1521 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00167 97.6 1.4e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00167 1/1 1379 1484 .] 1 120 [] 97.6 1.4e-24 Alignments of top-scoring domains: SM00167: domain 1 of 1, from 1379 to 1484: score 97.6, E = 1.4e-24 *->FveieqielkflqlskmYSPsdKikcLLrackviytlletqsKgeva +++++q e + +k +P+dK+ c+Lr c i +ll + v KIAA1521 1379 PWPSAQSEIRTISAYK--TPRDKVQCILRMCSTIMNLLSLANEDSVP 1423 GADdFlPvLiYvIikcdprdLllnveYieeflepslltGeegYYLtsLeA GADdF PvL++v+ik++p+ Ll+ v+Yi+ f + s l+Gee+Y + + A KIAA1521 1424 GADDFVPVLVFVLIKANPPCLLSTVQYISSF-YASCLSGEESYWWMQFTA 1472 ALafikgLteadalilspedeee<-* A++fik++ d ++ KIAA1521 1473 AVEFIKTI-----------DDRK 1484 //