hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-00263724/chunk_1/iprscan-20080502-00263724.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1352 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08264.3.fs Anticodon-binding domain 70.1 2.5e-19 1 PF08264.3.ls Anticodon-binding domain 71.9 1.9e-18 1 PF09334.1.fs tRNA synthetases class I (M) 33.1 2.5e-10 2 PF00133.12.fs tRNA synthetases class I (I, L, M and V) 21.2 6.7e-06 3 PF01406.10.fs tRNA synthetases class I (C) catalytic d 19.2 1.7e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF09334.1.fs 2/2 737 791 .. 341 397 .. 25.3 6.4e-08 PF01406.10.fs 1/1 743 782 .. 378 417 .. 19.2 1.7e-05 PF08264.3.fs 1/1 830 966 .. 1 176 [] 70.1 2.5e-19 PF08264.3.ls 1/1 830 966 .. 1 176 [] 71.9 1.9e-18 Alignments of top-scoring domains: PF09334.1.fs: domain 2 of 2, from 737 to 791: score 25.3, E = 6.4e-08 *->PtqvfaHGwltveGgKMSKSrGnvVdpdelldrGygvDaLRYYLlrK Pt+v a+G+l+++ +KMSKS Gn+ +++d+ + +D++R L+ KIAA1352 737 PTAVRANGHLLLNSEKMSKSTGNFLTLTQAIDK-FSADGMRLALAD- 781 eapegkDgdF<-* ++ D++F KIAA1352 782 AGDTVEDANF 791 PF01406.10.fs: domain 1 of 1, from 743 to 782: score 19.2, E = 1.7e-05 *->nGhvmiegEKMSKSLGNFltirDvLkkydpevLRyfllsa<-* nGh+ + EKMSKS GNFlt ++ k+++ R++l+ a KIAA1352 743 NGHLLLNSEKMSKSTGNFLTLTQAIDKFSADGMRLALADA 782 PF08264.3.fs: domain 1 of 1, from 830 to 966: score 70.1, E = 2.5e-19 *->DrWiLsrLnelikevteayenYdFnkAaralyeFiwndlcdwYlels Dr + s+Ln+ i +++++ye+ F +A+++ + + ++ d Y el+ KIAA1352 830 DRVFASELNAGIIKTDQNYEKMMFKEALKTGFFEF-QAAKDKYRELA 875 KdrlygeeeegeGsaadddkseapakraAqttLyevLeallrLLaPfmPF + + e ++++e+ + LLaPf+P+ KIAA1352 876 VEGMHRE------------------------LVFRFIEVQTLLLAPFCPH 901 itEEiWqrLpgeeeSvhladwPvdelevdgfdeakewelidlekleaeme ++E iW L++ ++S++ a+wP + ++ e l + KIAA1352 902 LCEHIWTLLGK-PDSIMNASWP------V---A----GPVN-EVLIHSSQ 936 llkevikaiRslRaeknikpsl.plkvliv<-* +l+ev+ ++R +++ ++ + ++ + KIAA1352 937 YLMEVTHDLRLRLKNYMMPAKGkKTDKQPL 966 PF08264.3.ls: domain 1 of 1, from 830 to 966: score 71.9, E = 1.9e-18 *->DrWiLsrLnelikevteayenYdFnkAaralyeFiwndlcdwYlels Dr + s+Ln+ i +++++ye+ F +A+++ + + ++ d Y el+ KIAA1352 830 DRVFASELNAGIIKTDQNYEKMMFKEALKTGFFEF-QAAKDKYRELA 875 KdrlygeeeegeGsaadddkseapakraAqttLyevLeallrLLaPfmPF + + e ++++e+ + LLaPf+P+ KIAA1352 876 VEGMHRE------------------------LVFRFIEVQTLLLAPFCPH 901 itEEiWqrLpgeeeSvhladwPvdelevdgfdeakewelidlekleaeme ++E iW L++ ++S++ a+wP + ++ e l + KIAA1352 902 LCEHIWTLLGK-PDSIMNASWP------V---A----GPVN-EVLIHSSQ 936 llkevikaiRslRaeknikpsl.plkvliv<-* +l+ev+ ++R +++ ++ + ++ + KIAA1352 937 YLMEVTHDLRLRLKNYMMPAKGkKTDKQPL 966 //