hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-19311614/chunk_1/iprscan-20080501-19311614.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1177 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07719.7.fs Tetratricopeptide repeat 44.6 1.8e-11 4 PF07719.7.ls Tetratricopeptide repeat 45.2 2e-10 4 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF07719.7.ls 1/4 156 189 .. 1 34 [] 22.4 0.0015 Alignments of top-scoring domains: PF07719.7.ls: domain 1 of 4, from 156 to 189: score 22.4, E = 0.0015 *->aealynlGlayyklgdyeeAleayekAleldPnn<-* ++++ l++ y++ g++e+A++ ye+A++ + KIAA1177 156 GKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTV 189 //