hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-15432931/chunk_1/iprscan-20080501-15432931.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1041 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00250.8.ls Fork head domain 193.1 6.1e-55 1 PF00250.8.fs Fork head domain 192.4 1e-54 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00250.8.fs 1/1 98 175 .. 1 79 [. 192.4 1e-54 PF00250.8.ls 1/1 98 197 .. 1 101 [] 193.1 6.1e-55 Alignments of top-scoring domains: PF00250.8.fs: domain 1 of 1, from 98 to 175: score 192.4, E = 1e-54 *->KPPYSYiaLItmAIqqySpekrLtLseIYkfImdrFPYYRqnkqgWQ KPPYSY++LIt AI + Sp k++tLseIY++I d+FPYYR++ +gW+ KIAA1041 98 KPPYSYASLITFAINS-SPKKKMTLSEIYQWICDNFPYYREAGSGWK 143 NSIRHNLSLNkcFiKVpRspdkpGKGsyWtld<-* NSIRHNLSLNkcF KVpRs+d+pGKGsyW++d KIAA1041 144 NSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID 175 PF00250.8.ls: domain 1 of 1, from 98 to 197: score 193.1, E = 6.1e-55 *->KPPYSYiaLItmAIqqySpekrLtLseIYkfImdrFPYYRqnkqgWQ KPPYSY++LIt AI + Sp k++tLseIY++I d+FPYYR++ +gW+ KIAA1041 98 KPPYSYASLITFAINS-SPKKKMTLSEIYQWICDNFPYYREAGSGWK 143 NSIRHNLSLNkcFiKVpRspdkpGKGsyWtldPeaedmFenkkkkgsflk NSIRHNLSLNkcF KVpRs+d+pGKGsyW++d + +++ + k ++ KIAA1041 144 NSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDALPTRPKKRARS 193 rrrr<-* +r KIAA1041 194 VERA 197 //