hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-14423148/chunk_1/iprscan-20080501-14423148.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1006 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08366.3.fs LLGL2 238.2 7.7e-79 1 PF08366.3.ls LLGL2 240.2 4e-69 1 PF00400.22.ls WD domain, G-beta repeat 62.1 1.7e-15 5 PF00400.22.fs WD domain, G-beta repeat 56.1 7.9e-15 5 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00400.22.fs 4/5 287 313 .. 11 38 .] 14.7 0.0036 PF08366.3.ls 1/1 320 432 .. 1 112 [] 240.2 4e-69 PF08366.3.fs 1/1 320 432 .. 1 112 [] 238.2 7.7e-79 PF00400.22.ls 5/5 434 512 .. 1 38 [] 21.6 0.0026 PF00400.22.fs 5/5 434 512 .. 1 38 [] 19.6 0.00015 Alignments of top-scoring domains: PF00400.22.fs: domain 4 of 5, from 287 to 313: score 14.7, E = 0.0036 *->tVtcvafspdsgpllasgSrDgtikiWd<-* ++ +++++++ g+++ ++ +Dg++ +W+ KIAA1006 287 AIHSIDWHHE-GKQFMCSHSDGSLTLWN 313 PF08366.3.ls: domain 1 of 1, from 320 to 432: score 240.2, E = 4e-69 *->plqstvPyGKsnkdG.kpepCKaInKvewkttrsgepfiIFSGGMPr p+q+t+P+GKs+++G+k+e+CK+I+Kve+kt++++epfiIFSGG+++ KIAA1006 320 PFQTTIPHGKSQREGrKSESCKPILKVEYKTCKNSEPFIIFSGGLSY 366 asygdrhCitVlhgksttvLdftsrviDFftlcetpwenefqePyAlvVL +++++r+++t++hgk++tvL++++++++F+tlcetp++nefqePyA+vVL KIAA1006 367 DKACRRPSLTIMHGKAITVLEMDHPIVEFLTLCETPYPNEFQEPYAVVVL 416 LeeeLVviDLqtpGwP<-* Le++L+v+DL++ ++P KIAA1006 417 LEKDLIVVDLTQSNFP 432 PF08366.3.fs: domain 1 of 1, from 320 to 432: score 238.2, E = 7.7e-79 *->plqstvPyGKsnkdG.kpepCKaInKvewkttrsgepfiIFSGGMPr p+q+t+P+GKs+++G+k+e+CK+I+Kve+kt++++epfiIFSGG+++ KIAA1006 320 PFQTTIPHGKSQREGrKSESCKPILKVEYKTCKNSEPFIIFSGGLSY 366 asygdrhCitVlhgksttvLdftsrviDFftlcetpwenefqePyAlvVL +++++r+++t++hgk++tvL++++++++F+tlcetp++nefqePyA+vVL KIAA1006 367 DKACRRPSLTIMHGKAITVLEMDHPIVEFLTLCETPYPNEFQEPYAVVVL 416 LeeeLVviDLqtpGwP<-* Le++L+v+DL++ ++P KIAA1006 417 LEKDLIVVDLTQSNFP 432 PF00400.22.ls: domain 5 of 5, from 434 to 512: score 21.6, E = 0.0026 *->geck.vl.gHtstVtcvafspd......................... e + H+s+Vtc a+ d +++ + + + ++ + ++++ KIAA1006 434 FENPyPMdIHESPVTCTAYFADcppdlilvlysigvkhkkqgysnke 480 ..............sgpllasgSrDgtikiWd<-* + ++++ + ++ ++++++++g +Dg+ik Wd KIAA1006 481 wpisggawnlgaqtYPEIIITGHADGSIKFWD 512 PF00400.22.fs: domain 5 of 5, from 434 to 512: score 19.6, E = 0.00015 *->geck.vl.gHtstVtcvafspd......................... e + H+s+Vtc a+ d +++ + + + ++ + ++++ KIAA1006 434 FENPyPMdIHESPVTCTAYFADcppdlilvlysigvkhkkqgysnke 480 ..............sgpllasgSrDgtikiWd<-* + ++++ + ++ ++++++++g +Dg+ik Wd KIAA1006 481 wpisggawnlgaqtYPEIIITGHADGSIKFWD 512 //