hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-14354273/chunk_1/iprscan-20080501-14354273.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1002 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00393 70.3 2.4e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00393 1/1 138 215 .. 1 83 [] 70.3 2.4e-16 Alignments of top-scoring domains: SM00393: domain 1 of 1, from 138 to 215: score 70.3, E = 2.4e-16 *->adflpllldiesyrprrreelielaleiakffvkstkesvelpPsMn +d++ +l+++++ +pr+r++l++l++ei++f+ +++++ +++p M+ KIAA1002 138 IDLHEFLVNTLKKNPRDRMMLLKLEQEILEFINDNNNQFKKFPQ-MT 183 syeRkivHelaekygLeSeSeGegpkeNRrvvvskk<-* sy+R++ H++a ++g+ +++ + g + v++ k+ KIAA1002 184 SYHRMLLHRVAAYFGMDHNVDQTG----KAVIINKT 215 //